KEGG   Vibrio vulnificus MO6-24/O: VVMO6_03967Help
Entry
VVMO6_03967       CDS       T01415                                 

Definition
(GenBank) alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
vvm  Vibrio vulnificus MO6-24/O
Brite
KEGG Orthology (KO) [BR:vvm00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    VVMO6_03967
Enzymes [BR:vvm01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     VVMO6_03967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 Thioredoxin_3 GIDA FAD_oxidored HI0933_like FAD_binding_2 DAO FAD_binding_3 Glutaredoxin Thioredoxin_9 AlaDh_PNT_C NAD_binding_8 Thi4 DUF5474
Motif
Other DBs
NCBI-ProteinID: ADV88989
LinkDB All DBs
Position
II:1152643..1154211
Genome map
AA seq 522 aa AA seqDB search
MLDQAIKQQLTQYLTNLKQDVRLVVSLDDSKGSQDILALANEIAELSPLISVVRDDKASA
RKPVMTVTNPEKSTALRFAGLPMGHEFTSLVLALLHSGGHPIKLDAETIEQIAQLDKELD
VEVFISLSCQNCPDVVQAFNMMAAINPKIRATMIDGALFQDEVKQRDILAVPSVFVNGEL
FGQGRMSLTEILNKLDDGAAEKAAASLNEKDPYDVLVVGGGPAGAAAAIYAARKGIRTGI
VAQRLGGQVMDTMAIENFISVKHTEGPKLAANLGEHLKEYGVDIITEQQAEKLMGAQYTE
DGKIHVNLQSGATLKSNSVILSPGARWREMNVPGEQEYRNKGVAYCPHCDGPLFKGKKTA
VIGGGNSGIEAAIDLAGIVEHVTVLEFADTLRADQVLINKANSLPNVDIITMAQTTEVVG
DGKRVTGLKYKDRNTDEIKQLDLAGIFVQIGLIPNTEWLKDSDVELSARGEIEIGSRGET
SLEGVFAAGDATTVPYKQIIIAMGEGAKASLGAFDYLIRKQG
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgctagaccaagcgatcaagcaacagttaacccagtatctaacaaatctaaaacaagac
gtccgtttagtggtcagcctagatgacagtaaaggctcacaagatattcttgcgctcgcc
aatgaaatcgcagaactaagcccgctgatctctgtcgttcgtgatgacaaagccagtgcg
cgtaaacccgttatgacggtgactaacccagagaaaagcactgcgcttcgctttgcaggt
ttaccaatgggtcatgaatttacatccttagttcttgccctgcttcattcaggtggtcat
ccgatcaaactggatgcagaaaccatcgaacagattgcacaactagacaaagaactcgat
gtggaagtctttatttccctttcatgtcaaaactgtccggatgtggtgcaagcgttcaac
atgatggcggcgattaacccgaaaattcgcgcaaccatgattgatggtgccctgttccaa
gatgaagtgaagcagcgtgacatcctcgcggtgccgagcgtctttgtaaacggtgagctg
tttggtcaaggccgcatgtcattgacagaaattcttaacaaattggacgatggcgcagca
gaaaaagcggcggcaagccttaatgaaaaagatccgtatgacgttctcgttgtcggtggt
ggcccagcaggtgcagccgctgcgatttacgcagcgcgtaaaggcattcgcactggtatt
gttgctcagcgtttgggtggtcaggtgatggacaccatggcaattgaaaactttatttca
gtcaaacacacggaaggtccaaaactggcggctaaccttggtgagcacttgaaagagtac
ggtgttgatatcatcacagagcagcaagcagaaaagctgatgggcgcgcaatacacggaa
gatggcaaaattcacgtcaatctacaaagtggtgcaacgcttaaaagtaacagcgttatc
ctcagcccaggtgctcgttggcgtgaaatgaacgtccctggtgaacaagaatatcgcaat
aagggcgtggcgtactgcccacactgcgatggccctttgttcaaaggcaagaaaaccgct
gttattggtggtggtaactccggcatcgaagcggccattgaccttgcaggtatcgtagaa
catgtgacggttttagagtttgctgacacattgcgcgcagaccaagttctgatcaacaaa
gcgaactctctgcctaacgtcgatatcatcaccatggctcaaaccaccgaagtggttggt
gatggtaaacgtgtgactggcttgaaatacaaagatcgcaacactgatgagatcaagcag
ttagatcttgctggcatctttgttcaaattggtcttatacccaataccgagtggctaaaa
gattctgacgttgagctttctgctcgcggcgaaatcgagatcggtagccgtggtgaaacc
agcctagaaggtgtatttgccgctggtgacgcgacaaccgtgccttacaagcaaatcatc
atcgcaatgggcgaaggtgcaaaagcgagcttgggagcgtttgattacttgattcgtaag
caaggctaa

DBGET integrated database retrieval system