KEGG   Vulpes vulpes (red fox): 112906873
Entry
112906873         CDS       T05911                                 

Gene name
RXRA
Definition
(RefSeq) retinoic acid receptor RXR-alpha isoform X1
  KO
K08524  retinoid X receptor alpha
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03320  PPAR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04659  Th17 cell differentiation
vvp04919  Thyroid hormone signaling pathway
vvp04920  Adipocytokine signaling pathway
vvp04928  Parathyroid hormone synthesis, secretion and action
vvp04932  Non-alcoholic fatty liver disease
vvp04976  Bile secretion
vvp05160  Hepatitis C
vvp05200  Pathways in cancer
vvp05202  Transcriptional misregulation in cancer
vvp05216  Thyroid cancer
vvp05222  Small cell lung cancer
vvp05223  Non-small cell lung cancer
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112906873 (RXRA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    112906873 (RXRA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112906873 (RXRA)
   03320 PPAR signaling pathway
    112906873 (RXRA)
   04919 Thyroid hormone signaling pathway
    112906873 (RXRA)
   04928 Parathyroid hormone synthesis, secretion and action
    112906873 (RXRA)
  09154 Digestive system
   04976 Bile secretion
    112906873 (RXRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112906873 (RXRA)
   05202 Transcriptional misregulation in cancer
    112906873 (RXRA)
  09162 Cancer: specific types
   05226 Gastric cancer
    112906873 (RXRA)
   05216 Thyroid cancer
    112906873 (RXRA)
   05222 Small cell lung cancer
    112906873 (RXRA)
   05223 Non-small cell lung cancer
    112906873 (RXRA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112906873 (RXRA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    112906873 (RXRA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vvp03000]
    112906873 (RXRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:vvp03310]
    112906873 (RXRA)
Transcription factors [BR:vvp03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    112906873 (RXRA)
Nuclear receptors [BR:vvp03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   112906873 (RXRA)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 112906873
NCBI-ProteinID: XP_025837725
UniProt: A0A3Q7S8V6
LinkDB
Position
Unknown
AA seq 439 aa
MAAPSLHPSLGPGIGSSLGSPGQLHSPISTLSSPINGMGPPFSVISSPMGPHSMSVPTTP
TLGFGTGSPQLSSPMNPVSSSEDIKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSS
GKHYGVYSCEGCKGFFKRTVRKDLTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKRE
AVQEERQRGKDRNENEVESTSSANEDMPVEKILEAELAVEPKTETYVDANMGLNPNSPND
PVTNICQAADKQLFTLVEWAKRIPHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDG
ILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKSELGCLRAIVLFNPDSKGL
SNPAEVEALREKVYASLEAYCKHKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIG
DTPIDTFLMEMLEAPHQMT
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggccgccccctcgctgcacccctctctggggcctggcatcggctcctcgcttggctcc
ccgggacaactgcactcgcctatcagcacgctgagctcccccatcaacggcatgggccca
cccttctcggtcatcagctcccccatgggcccccactccatgtcggtgcctaccacgccc
accctgggcttcggcaccggcagcccccagctcagctcccccatgaaccccgtcagcagc
agcgaggacatcaagccgccgctgggcctcaatggtgtcctcaaggtcccggcccacccc
tcagggaacatggcgtccttcaccaagcacatctgtgccatctgtggggaccgctcctca
ggcaagcactacggagtgtatagctgtgagggctgcaagggcttcttcaagcggacggtg
cgcaaggacctgacctacacctgccgcgacaacaaggactgcctgatcgacaagcggcag
cgcaaccgctgccagtactgccgctaccagaagtgcctggccatgggcatgaagcgggaa
gccgtgcaggaggagcggcagcggggcaaggaccggaacgagaatgaggtggagtccacg
agcagcgccaacgaggacatgccagtggagaagattctggaggcggagctggctgtggag
cccaagactgagacgtacgtggatgcgaacatggggctgaaccccaattcgcccaacgac
cccgtcaccaacatctgccaggctgcggacaagcagctcttcactctggtcgagtgggcc
aagcggatcccgcatttctctgagctgcccctggacgaccaggtcatcctgctcagggca
ggctggaatgagctgctcatcgcctccttctcccaccggtccatcgccgtgaaggatggg
atccttctggccaccggactgcacgtccaccggaacagtgcccacagcgcgggggtgggc
gccatcttcgacagggtgctgacagagctcgtgtccaagatgcgggacatgcagatggac
aagtcggagctgggctgcctgcgtgccattgtcctcttcaacccggactccaaggggctc
tcgaacccagcggaggtggaggcactgcgagagaaggtctacgcatccctggaggcgtat
tgcaaacataagtaccccgagcagccaggaaggtttgccaagctgctgctccgcctgccg
gccctgcgctctatcggcctcaagtgcctggaacatctcttcttcttcaaactcatcgga
gacacgcccattgacaccttcctcatggagatgctggaagccccccatcagatgacttag

KEGG   Vulpes vulpes (red fox): 112913873
Entry
112913873         CDS       T05911                                 

Gene name
RXRB
Definition
(RefSeq) retinoic acid receptor RXR-beta
  KO
K08525  retinoid X receptor beta
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03320  PPAR signaling pathway
vvp04659  Th17 cell differentiation
vvp04919  Thyroid hormone signaling pathway
vvp04920  Adipocytokine signaling pathway
vvp04928  Parathyroid hormone synthesis, secretion and action
vvp05200  Pathways in cancer
vvp05202  Transcriptional misregulation in cancer
vvp05216  Thyroid cancer
vvp05222  Small cell lung cancer
vvp05223  Non-small cell lung cancer
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    112913873 (RXRB)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112913873 (RXRB)
   03320 PPAR signaling pathway
    112913873 (RXRB)
   04919 Thyroid hormone signaling pathway
    112913873 (RXRB)
   04928 Parathyroid hormone synthesis, secretion and action
    112913873 (RXRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112913873 (RXRB)
   05202 Transcriptional misregulation in cancer
    112913873 (RXRB)
  09162 Cancer: specific types
   05226 Gastric cancer
    112913873 (RXRB)
   05216 Thyroid cancer
    112913873 (RXRB)
   05222 Small cell lung cancer
    112913873 (RXRB)
   05223 Non-small cell lung cancer
    112913873 (RXRB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vvp03000]
    112913873 (RXRB)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:vvp03310]
    112913873 (RXRB)
Transcription factors [BR:vvp03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    112913873 (RXRB)
Nuclear receptors [BR:vvp03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   112913873 (RXRB)
SSDB
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Other DBs
NCBI-GeneID: 112913873
NCBI-ProteinID: XP_025846467
UniProt: A0A3Q7RKY6
LinkDB
Position
Unknown
AA seq 525 aa
MPQGSVGRWGCEKKCIVGSPPGGGGDGPGWIPQRRRRRQQPENNKPRSRSRGRLDGTGWA
TAGGTPEAQTVPPRIPFPRGLLPLLPLLPLGYPSPLHQPQPLEAPGPHPHPXPPPQLGSP
FPVISSSMGSPGLPPPAPPGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCP
PPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCTVDKR
QRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMPVDRILEAELAVE
QKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQVILL
RAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRSLSRVLTELVSKM
RDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAK
LLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgccgcagggcagtgtgggccggtgggggtgcgaaaagaaatgcattgtggggtcgcct
cccggtggcggcggcgacggccctggctggatcccgcagcggcggcggcggcggcagcag
ccggagaacaacaaaccccggagccggagccgggggaggctggacgggacgggatgggcg
acagcgggcgggactcccgaagcccagacagttcctccccgaatcccctttcccaggggg
ctcctcccccttctcccccttctccccctgggttacccctccccccttcatcagccccaa
cccttggaggctccggggccccacccccacccccngccacccccccaactgggctccccc
ttcccagtcatcagctcttccatggggtcccctggtctgccccctccagctcccccagga
ttctccgggcctgtcagcagtccccagattaactcaacagtgtcgctccctgggggtggg
tctggcccccctgaagatgtgaagccaccagtcttaggggtccggggcctgcactgtcca
ccccctccaggtggtcctggggctggcaaaaggctgtgtgcaatctgcggggaccgaagc
tcaggcaaacactatggggtttacagctgtgagggctgcaaaggcttcttcaagcgcacc
atccgtaaggatctgacctactcatgccgggacaacaaggactgcaccgtggacaagcgc
cagcgaaaccgctgtcagtactgccgctatcagaagtgcctggccactggcatgaagagg
gaggcagttcaggaggagcgtcagcgggggaaggacaaggacggggatggggaaggggct
gggggagccccggaggagatgcctgtggacaggatcctggaggcagagcttgctgtggag
cagaagagtgaccagggcgttgagggtcctgggggaaccgggggtagtggcagcagccca
aatgaccctgtgactaacatctgtcaggcagctgacaaacagctattcacgcttgttgag
tgggcgaagaggatcccacacttttcctccttgcctctggatgaccaggtcatattgctg
cgggcaggctggaacgagctcctcattgcttccttctcccaccgatccattgatgtccga
gatggcatcctccttgccacaggtcttcatgtgcaccgcaactcagcccattctgcaggc
gtgggagccatctttgatcggtccctctccagggtgctgacagagctagtgtccaaaatg
cgtgacatgaggatggacaagacagagcttggctgcctgagggcaatcattctgttcaat
ccagatgccaagggcctttccaaccctagtgaggtggaggttctgcgggagaaagtgtat
gcatcactggagacctattgcaagcagaagtaccctgagcagcagggacggtttgccaag
ctgctgctacgtcttcctgccctcaggtccatcggccttaagtgtctagagcatctgttt
ttcttcaagctcattggagacacccctattgacaccttcctcatggagatgcttgaggct
ccccaccagctggcctga

KEGG   Vulpes vulpes (red fox): 112914313
Entry
112914313         CDS       T05911                                 

Gene name
RXRG
Definition
(RefSeq) retinoic acid receptor RXR-gamma
  KO
K08526  retinoid X receptor gamma
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03320  PPAR signaling pathway
vvp04659  Th17 cell differentiation
vvp04919  Thyroid hormone signaling pathway
vvp04920  Adipocytokine signaling pathway
vvp04928  Parathyroid hormone synthesis, secretion and action
vvp05200  Pathways in cancer
vvp05202  Transcriptional misregulation in cancer
vvp05216  Thyroid cancer
vvp05222  Small cell lung cancer
vvp05223  Non-small cell lung cancer
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    112914313 (RXRG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112914313 (RXRG)
   03320 PPAR signaling pathway
    112914313 (RXRG)
   04919 Thyroid hormone signaling pathway
    112914313 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    112914313 (RXRG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112914313 (RXRG)
   05202 Transcriptional misregulation in cancer
    112914313 (RXRG)
  09162 Cancer: specific types
   05226 Gastric cancer
    112914313 (RXRG)
   05216 Thyroid cancer
    112914313 (RXRG)
   05222 Small cell lung cancer
    112914313 (RXRG)
   05223 Non-small cell lung cancer
    112914313 (RXRG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vvp03000]
    112914313 (RXRG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:vvp03310]
    112914313 (RXRG)
Transcription factors [BR:vvp03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    112914313 (RXRG)
Nuclear receptors [BR:vvp03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   112914313 (RXRG)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 112914313
NCBI-ProteinID: XP_025847059
UniProt: A0A3Q7RNB7
LinkDB
Position
Unknown
AA seq 463 aa
MYGNYSHFMKFPTGFGGSPGHSGSTSMSPSAALSTGKPMDSHPSYTDTPVSAPRTLSAVG
PPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSISEDIKPLPGLPG
IGNMNYPSASPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLMYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEADCANSGHEDMPVERIL
EAELAVEPKTESYGDMNLENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtacgggaattattcgcacttcatgaagtttcccacgggctttggcggctcccccggc
cactctggctccacgtccatgagcccgtcggcagccttgtccactgggaagcccatggac
agccaccccagctacacggacacgccagtgagtgccccgcggactctgagtgcagtgggg
ccccccctcaatgccctgggctctccatatcgagtcatcacgtctgccatgggcccgccc
tcgggagcgctggcagcacctccaggaatcaacctggtcgccccacccagctcccagcta
aatgtggtcaacagtgtcagcatttcagaggacatcaagcccttgccagggcttcctggg
attggaaacatgaactacccatcagccagccctggctctctggttaaacacatctgtgcc
atctgtggggataggtcctcaggaaagcactacggtgtgtacagttgtgaaggctgcaaa
gggttcttcaagagaaccataaggaaagacctcatgtacacgtgtcgcgataataaagac
tgcctcattgacaagcgccagaggaaccgctgccagtactgccgctaccagaagtgcctg
gtgatgggcatgaagagggaagctgtgcaagaagaaaggcagaggagccgggagcgggcc
gagagtgaggcagactgtgccaacagcggccatgaagatatgcctgtggagaggattcta
gaagcggagcttgctgttgagccaaagacagaatcctatggtgatatgaacttggagaac
tcgacaaatgaccctgtcaccaacatatgccatgctgctgataagcagctcttcactctt
gttgaatgggccaagcgcattccccacttctctgacctcaccttggaggaccaggtcatc
ctgctccgggcagggtggaatgaattgctaattgcctccttctcccaccgctcggtctct
gtccaggatggcattcttctggccacgggtttacacgtccaccggagcagtgcccacagc
gctggggttggctccatctttgacagagtcctgactgagctggtctccaaaatgaaagac
atgcagatggacaagtcggagctggggtgcctgcgagccattgtgctgtttaacccagat
gccaaggggctgtccaacccctcagaggtggagaccctgcgagagaaggtttacgccacc
cttgaggcctacactaagcagaagtatccagaacaacctggcaggttcgccaagctgctg
ctgcgcctcccggccctgcgctccatcggcctcaagtgcctggagcaccttttcttcttc
aagctcatcggagacacgcccatcgacaccttcctcatggagatgttggagaccccgctg
cagatcacctga

DBGET integrated database retrieval system