KEGG   Vulpes vulpes (red fox): 112906897Help
Entry
112906897         CDS       T05911                                 

Gene name
C8G
Definition
(RefSeq) complement component C8 gamma chain
  KO
K03999  complement component 8 subunit gamma
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04610  Complement and coagulation cascades
vvp05020  Prion diseases
vvp05146  Amoebiasis
vvp05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    112906897 (C8G)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    112906897 (C8G)
  09164 Neurodegenerative disease
   05020 Prion diseases
    112906897 (C8G)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112906897 (C8G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipocalin
Motif
Other DBs
NCBI-GeneID: 112906897
NCBI-ProteinID: XP_025837783
UniProt: A0A3Q7QX31
LinkDB All DBs
Position
Unknown
AA seq 202 aa AA seqDB search
MLTPWTALLLTLLLAGGSVSQRARRPPRPASPISTIQPQVNFDAHQFAGTWLLVAVASSC
RFLQEQGHRAEATLLHVAPQGADMAVSTFQKLDGICWQVRQLYRDGKVLGRFLLQARGAR
GAVDMVIGETDYQGFAILYLEQKRQLSVKLYARSLPPSDLALSAFEQRIQRVNLTEDHVL
FFPKYGFCEAADQFHVLDEAGR
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccccctggactgcgctccttttgactctgctcctggctgggggctccgtgagc
caaagggctcggagaccccctcggccggcgtcccccatcagcaccatccagccccaggtc
aacttcgatgctcaccagtttgcagggacgtggctccttgtggccgtggcctcctcatgc
cgcttcctgcaggagcaaggccaccgggctgaggccaccctcctgcatgtggctccccag
ggcgcagacatggctgtcagtaccttccagaagctggatgggatctgctggcaggtgcgg
cagctgtacagagatggaaaagtcctgggccgcttcctgctgcaagcccgaggtgcccgc
ggggcagtggacatggtcatcggggagacagactaccagggcttcgccatcctgtacctg
gagcagaagcgacagctgtcagtgaagctgtacgcccgctcactccccccaagtgacttg
gccctgagcgcctttgagcaacggatccagagggtcaacctgactgaggaccatgtcctc
ttcttccccaagtatggtttctgcgaggctgcagaccagttccatgttctagacgaagcc
ggaaggtga

DBGET integrated database retrieval system