KEGG   Vulpes vulpes (red fox): 112906959
Entry
112906959         CDS       T05911                                 

Gene name
CHEK2
Definition
(RefSeq) serine/threonine-protein kinase Chk2 isoform X1
  KO
K06641  serine/threonine-protein kinase CHEK2 [EC:2.7.11.1]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04110  Cell cycle
vvp04115  p53 signaling pathway
vvp04218  Cellular senescence
vvp05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112906959 (CHEK2)
   04115 p53 signaling pathway
    112906959 (CHEK2)
   04218 Cellular senescence
    112906959 (CHEK2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112906959 (CHEK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112906959 (CHEK2)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:vvp03400]
    112906959 (CHEK2)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112906959 (CHEK2)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: CAMK group
  RAD53 family
   112906959 (CHEK2)
DNA repair and recombination proteins [BR:vvp03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    112906959 (CHEK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr FHA Kinase-like Kdo Pkinase_fungal YrbL-PhoP_reg RIO1 Haspin_kinase LEA_6 APH
Other DBs
NCBI-GeneID: 112906959
NCBI-ProteinID: XP_025837876
UniProt: A0A3Q7R749
LinkDB
Position
Unknown
AA seq 544 aa
MSRETDVECQQSHGSGACSQSQGTFSQSQGISSQTHGSSSHSQGTSSSTSTAPTSSQSSH
SSSGTLSSLDTVSTQELCSIPEDQEPEEPVPAPWARLWALQDGFPNLECVNDNYWFGRDR
SCEYCFDEPLLKRTDKYRTYSKKHFRIFREMGPKNSYIAYIEDHSGNGTFVNRELVGKGR
RLPLNNNSEIALSVWSNKVFVFFDLTVDDQSVYPKELRDEYIMSKTLGSGACGEVKLAFE
RKTCKKVAIKIISKRKFAIGSEREADPALDVETEIEILKKLNHPCIIKIKDFFDAEDYYI
VLELMEGGELFDRVVGNKRLKEATCKLYFYQMLLAVQYLHENGIIHRDLKPENVLLSSQK
EDCLIKITDFGQSKILGETSLMRTLCGTPTYLAPEVLNSFGTAGYNRAVDCWSLGVILFI
CLSGYPPFSEHKTQVPLKDQITSGKFNFIPEVWAEVSEKALDLVKKLLLVDPKVRFTTEE
ALRHPWLQDEDMKRKFQNLLSEEKKSTALLQVPAQPSTSRKRLLEGEAEDADTTKRLAVC
AAVS
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgtctcgggagacggatgtggagtgtcagcagtcccatggcagtggtgcttgttcgcag
tcccaaggcactttctcacagtctcaaggcatctcctcccagacacacggctcttcctca
cactctcagggcacatccagctccaccagcacagcacccacatctagccagtcgtctcac
tccagctcggggaccctgagctccttagacacagtgtccacccaggaactctgttctatt
cctgaggaccaggaacctgaagagcctgtccctgccccttgggctcgattatgggccctt
caggatggattccccaatcttgagtgtgttaatgacaactactggtttgggagagataga
agctgtgaatactgctttgatgagccattgctgaaaagaacagataaataccggacttac
agcaagaagcactttcggattttcagagaaatgggtcctaaaaactcttacatcgcatac
atagaagatcacagtgggaatggaacctttgtaaatagagagctggtagggaaaggaaga
cgccttcctttgaataacaattctgaaattgcactttcagtatggagtaataaagttttt
gtattttttgatctgactgtagatgatcagtcagtttatcctaaggaattaagagatgaa
tacatcatgtcaaaaactctcggaagtggtgcctgtggtgaggtgaagctagcttttgag
aggaaaacatgtaagaaagtagccataaaaatcatcagcaagaggaagttcgctattggc
tctgagagagaggcagatccagctctcgatgttgaaacagaaatagaaattttgaaaaag
ctaaatcatccttgtatcatcaagatcaaagacttttttgatgccgaagattattatatt
gttttggaattgatggaaggaggagagctgtttgacagggtggtggggaataagaggctg
aaagaagctacgtgcaaactctatttttaccagatgctcctggctgtacagtaccttcat
gaaaatggcattatacatcgggacttaaagccagagaatgttctactctcatctcaaaaa
gaggactgtcttataaagattactgattttgggcagtctaagattttgggggagacctct
ctcatgagaaccttatgtggtactcccacctacctggctcctgaggttcttaattccttt
gggactgctggatataaccgagcggtggattgctggagtttaggagttattctttttatt
tgccttagtgggtacccacctttctctgagcataagactcaagtgcccttgaaggatcag
atcaccagtggaaaattcaacttcattcctgaagtctgggcagaggtctcagaaaaggcc
ctggatcttgtcaagaagttgttgttggtggatccaaaggtgcgttttacgacagaagaa
gctttaagacacccgtggcttcaggatgaggacatgaagagaaaatttcagaatttactt
tctgaagaaaagaagtcgacagctctactccaggttccagcccagccttccacaagtcga
aagcggcttcttgaaggggaagcagaggatgctgacaccacaaagcgtctggctgtgtgt
gctgctgtgtcgtga

DBGET integrated database retrieval system