KEGG   Vulpes vulpes (red fox): 112907029Help
Entry
112907029         CDS       T05911                                 

Definition
(RefSeq) anionic trypsin
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04080  Neuroactive ligand-receptor interaction
vvp04972  Pancreatic secretion
vvp04974  Protein digestion and absorption
vvp05164  Influenza A
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    112907029
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    112907029
   04974 Protein digestion and absorption
    112907029
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    112907029
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:vvp01002]
    112907029
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vvp04147]
    112907029
Enzymes [BR:vvp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     112907029
Peptidases and inhibitors [BR:vvp01002]
 Serine peptidases
  Family S1: chymotrypsin family
   112907029
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112907029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 112907029
NCBI-ProteinID: XP_025837988
UniProt: A0A3Q7QXR4
LinkDB All DBs
Position
Unknown
AA seq 247 aa AA seqDB search
MNPLLILAFLGAAVATPTDDDDKIVGGYTCEENSVPYQVSLNSGYHFCGGSLISDQWVVS
AAHCYKSRIQVRLGEYNIDVLEGNEQFINSAKVIRHPDYNSWLLDNDIMLIKLSSPAVLN
ARVATISLPKACAAPGTQCLISGWGNTLSSGTNYPELLQCLDAPILTQAQCETSYPGQIT
ENMICAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCAQKNKPGVYTKVCNFVDWIH
STIAANS
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatccactcctgatccttgcttttcttggagctgctgttgctacccccacagacgac
gatgacaagatcgtcgggggctacacctgtgaggagaattccgtcccctaccaggtgtcc
ctgaactcaggctaccacttctgcgggggctccctcatcagtgaccagtgggtggtgtct
gcagctcactgctacaagtcccgcatccaagtgagacttggagagtacaacatcgatgtc
ctggaggggaatgagcagtttatcaactccgccaaggtcatccgccatcccgactataac
agctggctcctggacaatgacatcatgctcatcaagctctcctcacctgcggtcctcaat
gcccgggtggccaccatatctctgcccaaggcctgcgcagcccctggcacccagtgcctc
atctccggctggggcaacactctgagctctggcaccaactaccccgagctgctgcagtgc
ctggatgccccaatcctgactcaggcccagtgcgaaacctcctaccctggccagatcacg
gagaacatgatttgcgccggcttcctcgagggaggcaaggactcctgccagggtgactct
ggtggccctgtggtctgcaatggagagctccagggaatcgtctcctggggctacggctgt
gcccagaagaacaaacctggagtctacaccaaggtgtgcaactttgtagactggattcat
tcgaccatagctgccaacagctaa

DBGET integrated database retrieval system