KEGG   Vulpes vulpes (red fox): 112907060
Entry
112907060         CDS       T05911                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X1
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp04010  MAPK signaling pathway
vvp04012  ErbB signaling pathway
vvp04015  Rap1 signaling pathway
vvp04024  cAMP signaling pathway
vvp04062  Chemokine signaling pathway
vvp04068  FoxO signaling pathway
vvp04150  mTOR signaling pathway
vvp04270  Vascular smooth muscle contraction
vvp04510  Focal adhesion
vvp04650  Natural killer cell mediated cytotoxicity
vvp04720  Long-term potentiation
vvp04722  Neurotrophin signaling pathway
vvp04726  Serotonergic synapse
vvp04730  Long-term depression
vvp04810  Regulation of actin cytoskeleton
vvp04910  Insulin signaling pathway
vvp04914  Progesterone-mediated oocyte maturation
vvp04928  Parathyroid hormone synthesis, secretion and action
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05034  Alcoholism
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05210  Colorectal cancer
vvp05211  Renal cell carcinoma
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05216  Thyroid cancer
vvp05218  Melanoma
vvp05219  Bladder cancer
vvp05220  Chronic myeloid leukemia
vvp05221  Acute myeloid leukemia
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112907060 (BRAF)
   04012 ErbB signaling pathway
    112907060 (BRAF)
   04015 Rap1 signaling pathway
    112907060 (BRAF)
   04068 FoxO signaling pathway
    112907060 (BRAF)
   04024 cAMP signaling pathway
    112907060 (BRAF)
   04150 mTOR signaling pathway
    112907060 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112907060 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112907060 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112907060 (BRAF)
   04062 Chemokine signaling pathway
    112907060 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112907060 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    112907060 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    112907060 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112907060 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    112907060 (BRAF)
   04720 Long-term potentiation
    112907060 (BRAF)
   04730 Long-term depression
    112907060 (BRAF)
   04722 Neurotrophin signaling pathway
    112907060 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112907060 (BRAF)
   05205 Proteoglycans in cancer
    112907060 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112907060 (BRAF)
   05212 Pancreatic cancer
    112907060 (BRAF)
   05225 Hepatocellular carcinoma
    112907060 (BRAF)
   05226 Gastric cancer
    112907060 (BRAF)
   05214 Glioma
    112907060 (BRAF)
   05216 Thyroid cancer
    112907060 (BRAF)
   05221 Acute myeloid leukemia
    112907060 (BRAF)
   05220 Chronic myeloid leukemia
    112907060 (BRAF)
   05218 Melanoma
    112907060 (BRAF)
   05211 Renal cell carcinoma
    112907060 (BRAF)
   05219 Bladder cancer
    112907060 (BRAF)
   05215 Prostate cancer
    112907060 (BRAF)
   05213 Endometrial cancer
    112907060 (BRAF)
   05224 Breast cancer
    112907060 (BRAF)
   05223 Non-small cell lung cancer
    112907060 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112907060 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    112907060 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    112907060 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112907060 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    112907060 (BRAF)
   05160 Hepatitis C
    112907060 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112907060 (BRAF)
   01522 Endocrine resistance
    112907060 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112907060 (BRAF)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112907060 (BRAF)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   112907060 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 112907060
NCBI-ProteinID: XP_025838011
UniProt: A0A3Q7R7I1
LinkDB
Position
Unknown
AA seq 765 aa
MAALSGGGGGGAEQGQALFNGDMEPEAGAGAAASSAADPAIPEEVWNIKQMIKLTQEHIE
ALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASTDTVTS
SSSSSLSVLPSSLSVFQNPTDISRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLK
KALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTF
FTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQ
EEASIAETALTSGSSPSAPPSDSPGPPILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDR
SSSAPNVHINTIEPVNIDDLIRDQGFRSDGGSTTGLSATPPASLPGSLTNVKALQKSPGP
QRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAV
KMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLH
IIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKS
RWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNR
DQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP
KIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggcggcggcggcggcggcgcggagcagggccaggctctgttcaac
ggggacatggagcccgaggccggcgccggcgccgcggcctcttcggctgcggaccctgcc
attcccgaggaggtgtggaatatcaaacaaatgattaagttgacacaggaacatatagaa
gccctattggacaagtttggtggggagcataatccaccatcaatatatctggaggcctat
gaagaatacaccagcaaactagatgccctccaacagcgagaacaacagttattggaatcc
ctggggaatggaactgatttttctgtttctagctctgcatccacggacaccgttacatct
tcttcctcttctagcctttcagtgctaccttcatctctttcagtttttcaaaatcccaca
gatatatcacggagcaatcccaagtcaccacaaaaacctatcgttagagtcttcctgccc
aataaacagaggacggtggtacccgcaagatgtggagttacagtccgggacagtctaaag
aaagctctgatgatgagaggtctaatcccagagtgctgtgctgtttacagaattcaggat
ggagagaagaaaccgattggctgggacactgatatttcctggctcactggagaggaattg
catgtagaagtgttggaaaatgttccacttaccacacacaactttgtacggaaaactttt
ttcaccttagcattttgtgacttttgtcgaaagctgcttttccagggttttcgctgtcaa
acatgtggttataaatttcaccagcgttgtagtacagaggttccactgatgtgtgttaat
tatgaccaacttgatttgctgtttgtctccaagttctttgaacaccacccaataccacag
gaggaggcctccatagcagagactgcccttacatctggatcatccccttctgctcccccc
tccgattctcctgggcccccaattctgaccagtccgtctccttcaaaatccattccaatt
ccacagcctttccgaccagcagatgaagatcatcgaaatcagtttggacaacgagaccgg
tcctcatcagctccaaatgtgcatataaacacaatagaacctgtcaacattgatgacttg
attagagaccaagggtttcgtagtgatggaggatcaaccacaggtttgtctgccaccccc
cctgcctcattgcctggctcactcactaatgtaaaagcattacagaaatctccaggacct
cagcgggaaagaaaatcatcttcatcctcagaagataggaatcgaatgaaaacacttggt
agacgggattcaagtgatgattgggagatacctgatgggcagatcacagtgggacagaga
attggatccgggtcatttgggacagtctacaagggaaagtggcatggtgacgtggcagtg
aaaatgttgaatgtgacagcacccacacctcagcagttacaggccttcaaaaatgaagta
ggagtactcaggaaaactcgacatgtgaatatcctactctttatgggctattcaacaaag
ccccaactggctattgttacccagtggtgtgagggctccagcttatatcaccatctccac
atcattgagaccaaatttgagatgataaagcttatagatattgcacggcagactgcacag
ggcatggattacttacacgccaagtcaatcatccacagagacctcaagagtaataatatt
tttcttcatgaagacctcacagtaaaaataggtgattttggtctagccacagtgaaatct
cgatggagtgggtcccatcagtttgaacagttgtctggatccattttgtggatggcacca
gaagtgatccgaatgcaagacaaaaacccatatagcttccagtcagatgtatacgcattt
gggattgttctatatgaattgatgacagggcagttaccttattcaaacatcaacaacagg
gaccagataatttttatggtgggacgaggatatctttctccagatctcagtaaggtacgg
agtaactgtccaaaagccatgaagagattgatggcagagtgcctaaaaaagaaaagagat
gagaggccactctttccccaaattctcgcctctattgagctgctggcccgctcattgcca
aaaattcaccgcagtgcatcagaaccctccttgaatcgggctggcttccaaacagaggat
tttagtctctatgcttgtgcttctccaaaaacacccatccaggcagggggatacggagaa
tttgcagccttcaagtag

DBGET integrated database retrieval system