KEGG   Vulpes vulpes (red fox): 112907060
Entry
112907060         CDS       T05911                                 

Gene name
BRAF
Definition
(RefSeq) serine/threonine-protein kinase B-raf isoform X1
  KO
K04365  B-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp04010  MAPK signaling pathway
vvp04012  ErbB signaling pathway
vvp04015  Rap1 signaling pathway
vvp04024  cAMP signaling pathway
vvp04062  Chemokine signaling pathway
vvp04068  FoxO signaling pathway
vvp04150  mTOR signaling pathway
vvp04270  Vascular smooth muscle contraction
vvp04510  Focal adhesion
vvp04650  Natural killer cell mediated cytotoxicity
vvp04720  Long-term potentiation
vvp04722  Neurotrophin signaling pathway
vvp04726  Serotonergic synapse
vvp04730  Long-term depression
vvp04810  Regulation of actin cytoskeleton
vvp04910  Insulin signaling pathway
vvp04914  Progesterone-mediated oocyte maturation
vvp04928  Parathyroid hormone synthesis, secretion and action
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05034  Alcoholism
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05210  Colorectal cancer
vvp05211  Renal cell carcinoma
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05216  Thyroid cancer
vvp05218  Melanoma
vvp05219  Bladder cancer
vvp05220  Chronic myeloid leukemia
vvp05221  Acute myeloid leukemia
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112907060 (BRAF)
   04012 ErbB signaling pathway
    112907060 (BRAF)
   04015 Rap1 signaling pathway
    112907060 (BRAF)
   04068 FoxO signaling pathway
    112907060 (BRAF)
   04024 cAMP signaling pathway
    112907060 (BRAF)
   04150 mTOR signaling pathway
    112907060 (BRAF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112907060 (BRAF)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112907060 (BRAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112907060 (BRAF)
   04062 Chemokine signaling pathway
    112907060 (BRAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112907060 (BRAF)
   04914 Progesterone-mediated oocyte maturation
    112907060 (BRAF)
   04928 Parathyroid hormone synthesis, secretion and action
    112907060 (BRAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112907060 (BRAF)
  09156 Nervous system
   04726 Serotonergic synapse
    112907060 (BRAF)
   04720 Long-term potentiation
    112907060 (BRAF)
   04730 Long-term depression
    112907060 (BRAF)
   04722 Neurotrophin signaling pathway
    112907060 (BRAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112907060 (BRAF)
   05205 Proteoglycans in cancer
    112907060 (BRAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112907060 (BRAF)
   05212 Pancreatic cancer
    112907060 (BRAF)
   05225 Hepatocellular carcinoma
    112907060 (BRAF)
   05226 Gastric cancer
    112907060 (BRAF)
   05214 Glioma
    112907060 (BRAF)
   05216 Thyroid cancer
    112907060 (BRAF)
   05221 Acute myeloid leukemia
    112907060 (BRAF)
   05220 Chronic myeloid leukemia
    112907060 (BRAF)
   05218 Melanoma
    112907060 (BRAF)
   05211 Renal cell carcinoma
    112907060 (BRAF)
   05219 Bladder cancer
    112907060 (BRAF)
   05215 Prostate cancer
    112907060 (BRAF)
   05213 Endometrial cancer
    112907060 (BRAF)
   05224 Breast cancer
    112907060 (BRAF)
   05223 Non-small cell lung cancer
    112907060 (BRAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112907060 (BRAF)
   05022 Pathways of neurodegeneration - multiple diseases
    112907060 (BRAF)
  09165 Substance dependence
   05034 Alcoholism
    112907060 (BRAF)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112907060 (BRAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    112907060 (BRAF)
   05160 Hepatitis C
    112907060 (BRAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112907060 (BRAF)
   01522 Endocrine resistance
    112907060 (BRAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112907060 (BRAF)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112907060 (BRAF)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   112907060 (BRAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like C1_2 Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 112907060
NCBI-ProteinID: XP_025838011
UniProt: A0A3Q7R7I1
LinkDB
Position
Unknown
AA seq 765 aa
MAALSGGGGGGAEQGQALFNGDMEPEAGAGAAASSAADPAIPEEVWNIKQMIKLTQEHIE
ALLDKFGGEHNPPSIYLEAYEEYTSKLDALQQREQQLLESLGNGTDFSVSSSASTDTVTS
SSSSSLSVLPSSLSVFQNPTDISRSNPKSPQKPIVRVFLPNKQRTVVPARCGVTVRDSLK
KALMMRGLIPECCAVYRIQDGEKKPIGWDTDISWLTGEELHVEVLENVPLTTHNFVRKTF
FTLAFCDFCRKLLFQGFRCQTCGYKFHQRCSTEVPLMCVNYDQLDLLFVSKFFEHHPIPQ
EEASIAETALTSGSSPSAPPSDSPGPPILTSPSPSKSIPIPQPFRPADEDHRNQFGQRDR
SSSAPNVHINTIEPVNIDDLIRDQGFRSDGGSTTGLSATPPASLPGSLTNVKALQKSPGP
QRERKSSSSSEDRNRMKTLGRRDSSDDWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAV
KMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLH
IIETKFEMIKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKS
RWSGSHQFEQLSGSILWMAPEVIRMQDKNPYSFQSDVYAFGIVLYELMTGQLPYSNINNR
DQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPLFPQILASIELLARSLP
KIHRSASEPSLNRAGFQTEDFSLYACASPKTPIQAGGYGEFAAFK
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggcggcgctgagcggcggcggcggcggcggcgcggagcagggccaggctctgttcaac
ggggacatggagcccgaggccggcgccggcgccgcggcctcttcggctgcggaccctgcc
attcccgaggaggtgtggaatatcaaacaaatgattaagttgacacaggaacatatagaa
gccctattggacaagtttggtggggagcataatccaccatcaatatatctggaggcctat
gaagaatacaccagcaaactagatgccctccaacagcgagaacaacagttattggaatcc
ctggggaatggaactgatttttctgtttctagctctgcatccacggacaccgttacatct
tcttcctcttctagcctttcagtgctaccttcatctctttcagtttttcaaaatcccaca
gatatatcacggagcaatcccaagtcaccacaaaaacctatcgttagagtcttcctgccc
aataaacagaggacggtggtacccgcaagatgtggagttacagtccgggacagtctaaag
aaagctctgatgatgagaggtctaatcccagagtgctgtgctgtttacagaattcaggat
ggagagaagaaaccgattggctgggacactgatatttcctggctcactggagaggaattg
catgtagaagtgttggaaaatgttccacttaccacacacaactttgtacggaaaactttt
ttcaccttagcattttgtgacttttgtcgaaagctgcttttccagggttttcgctgtcaa
acatgtggttataaatttcaccagcgttgtagtacagaggttccactgatgtgtgttaat
tatgaccaacttgatttgctgtttgtctccaagttctttgaacaccacccaataccacag
gaggaggcctccatagcagagactgcccttacatctggatcatccccttctgctcccccc
tccgattctcctgggcccccaattctgaccagtccgtctccttcaaaatccattccaatt
ccacagcctttccgaccagcagatgaagatcatcgaaatcagtttggacaacgagaccgg
tcctcatcagctccaaatgtgcatataaacacaatagaacctgtcaacattgatgacttg
attagagaccaagggtttcgtagtgatggaggatcaaccacaggtttgtctgccaccccc
cctgcctcattgcctggctcactcactaatgtaaaagcattacagaaatctccaggacct
cagcgggaaagaaaatcatcttcatcctcagaagataggaatcgaatgaaaacacttggt
agacgggattcaagtgatgattgggagatacctgatgggcagatcacagtgggacagaga
attggatccgggtcatttgggacagtctacaagggaaagtggcatggtgacgtggcagtg
aaaatgttgaatgtgacagcacccacacctcagcagttacaggccttcaaaaatgaagta
ggagtactcaggaaaactcgacatgtgaatatcctactctttatgggctattcaacaaag
ccccaactggctattgttacccagtggtgtgagggctccagcttatatcaccatctccac
atcattgagaccaaatttgagatgataaagcttatagatattgcacggcagactgcacag
ggcatggattacttacacgccaagtcaatcatccacagagacctcaagagtaataatatt
tttcttcatgaagacctcacagtaaaaataggtgattttggtctagccacagtgaaatct
cgatggagtgggtcccatcagtttgaacagttgtctggatccattttgtggatggcacca
gaagtgatccgaatgcaagacaaaaacccatatagcttccagtcagatgtatacgcattt
gggattgttctatatgaattgatgacagggcagttaccttattcaaacatcaacaacagg
gaccagataatttttatggtgggacgaggatatctttctccagatctcagtaaggtacgg
agtaactgtccaaaagccatgaagagattgatggcagagtgcctaaaaaagaaaagagat
gagaggccactctttccccaaattctcgcctctattgagctgctggcccgctcattgcca
aaaattcaccgcagtgcatcagaaccctccttgaatcgggctggcttccaaacagaggat
tttagtctctatgcttgtgcttctccaaaaacacccatccaggcagggggatacggagaa
tttgcagccttcaagtag

KEGG   Vulpes vulpes (red fox): 112907269
Entry
112907269         CDS       T05911                                 

Gene name
ARAF
Definition
(RefSeq) serine/threonine-protein kinase A-Raf isoform X1
  KO
K08845  A-Raf proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp04010  MAPK signaling pathway
vvp04012  ErbB signaling pathway
vvp04068  FoxO signaling pathway
vvp04270  Vascular smooth muscle contraction
vvp04650  Natural killer cell mediated cytotoxicity
vvp04720  Long-term potentiation
vvp04726  Serotonergic synapse
vvp04730  Long-term depression
vvp04810  Regulation of actin cytoskeleton
vvp04910  Insulin signaling pathway
vvp04914  Progesterone-mediated oocyte maturation
vvp04928  Parathyroid hormone synthesis, secretion and action
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05034  Alcoholism
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05210  Colorectal cancer
vvp05211  Renal cell carcinoma
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05218  Melanoma
vvp05219  Bladder cancer
vvp05220  Chronic myeloid leukemia
vvp05221  Acute myeloid leukemia
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112907269 (ARAF)
   04012 ErbB signaling pathway
    112907269 (ARAF)
   04068 FoxO signaling pathway
    112907269 (ARAF)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112907269 (ARAF)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112907269 (ARAF)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112907269 (ARAF)
   04914 Progesterone-mediated oocyte maturation
    112907269 (ARAF)
   04928 Parathyroid hormone synthesis, secretion and action
    112907269 (ARAF)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112907269 (ARAF)
  09156 Nervous system
   04726 Serotonergic synapse
    112907269 (ARAF)
   04720 Long-term potentiation
    112907269 (ARAF)
   04730 Long-term depression
    112907269 (ARAF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112907269 (ARAF)
   05205 Proteoglycans in cancer
    112907269 (ARAF)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112907269 (ARAF)
   05212 Pancreatic cancer
    112907269 (ARAF)
   05225 Hepatocellular carcinoma
    112907269 (ARAF)
   05226 Gastric cancer
    112907269 (ARAF)
   05214 Glioma
    112907269 (ARAF)
   05221 Acute myeloid leukemia
    112907269 (ARAF)
   05220 Chronic myeloid leukemia
    112907269 (ARAF)
   05218 Melanoma
    112907269 (ARAF)
   05211 Renal cell carcinoma
    112907269 (ARAF)
   05219 Bladder cancer
    112907269 (ARAF)
   05215 Prostate cancer
    112907269 (ARAF)
   05213 Endometrial cancer
    112907269 (ARAF)
   05224 Breast cancer
    112907269 (ARAF)
   05223 Non-small cell lung cancer
    112907269 (ARAF)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112907269 (ARAF)
   05022 Pathways of neurodegeneration - multiple diseases
    112907269 (ARAF)
  09165 Substance dependence
   05034 Alcoholism
    112907269 (ARAF)
  09172 Infectious disease: viral
   05161 Hepatitis B
    112907269 (ARAF)
   05160 Hepatitis C
    112907269 (ARAF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112907269 (ARAF)
   01522 Endocrine resistance
    112907269 (ARAF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112907269 (ARAF)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112907269 (ARAF)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   112907269 (ARAF)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like Pkinase_fungal zf-RING-like TUG-UBL1 Kdo APH
Other DBs
NCBI-GeneID: 112907269
NCBI-ProteinID: XP_025838264
UniProt: A0A3Q7QVS0
LinkDB
Position
Unknown
AA seq 634 aa
MEPPRGPPANGAEPSRAVGTVKVYLPNKQRTVVTVRDGMSVYDSLDKALKVRGLNQDCCV
VYRLIEGRKTVTAWDTAIAPLDGEELIVEVLEDVPLTMHNFVRKTFFSLAFCDFCLKFLF
HGFRCQTCGYKFHQHCSSKVPTVCVDMSTNCRQFYHSVQDLSGGSRQHEAPSNRPLNEPL
TPQGPSSCTQHRDPEHFPFPAPANTPLQRIRSTSTPNVHMVSTTAPMDSSLIQLTAQSFS
TDGEPTTPLPCPMPPHPAPLASTHIPSTIAAAGSRGGGDGAPRGSPSPASVSLGRKSPHS
KSPSEQRERKSVADDKKKVKNLGYRDSGYYWEVPPSEVQLLKRIGTGSFGTVFRGRWHGD
VAVKVLKVAQPTAEQAQAFKNEMQVLRKTRHVNILLFMGFMTRPGFAIITQWCEGSSLYH
HLHVADTRFDMVQLIDVARQTAQGMDYLHAKNIIHRDLKSNNIFLHEGLTVKIGDFGLAT
VKTRWSGAQPLEQPSGSVLWMAAEVIRMQDPNPYSFQSDVYAYGVVLYELMTGSLPYSHI
GSRDQIIFMVGRGYLSPDLSKISSNCPKAMRRLLSDCLKFQREERPLFPQILAAIELLQR
SLPKIERSASEPSLHRTQADELPACLLSAARLVP
NT seq 1905 nt   +upstreamnt  +downstreamnt
atggagccaccacggggcccccctgccaatggggccgagccatcccgggcagtgggcact
gtcaaagtataccttcccaacaagcaacgcaccgtggtgactgtccgggatggcatgagt
gtctacgactctcttgacaaggccctcaaggtacggggtctcaatcaggattgctgtgtg
gtctaccggctcattgaggggcgaaagacagtcactgcctgggacacagccattgccccc
ctggatggagaggagctcattgtagaggtccttgaagacgtcccactgaccatgcacaat
tttgtacggaagacgttcttcagcctggcattctgcgacttctgccttaagtttctgttc
catggcttccgctgccaaacctgtggctacaagttccaccagcattgttcctccaaggtc
cccacagtctgtgttgacatgagtaccaactgccgacagttttaccacagtgtccaggat
ttgtccggaggctccagacagcacgaagctccctcaaaccgccccctgaatgagccgcta
acccctcagggtcccagctcctgcacccagcaccgcgaccctgagcactttcccttccct
gcccctgccaacaccccactccagcgcatccgctccacatccactcccaacgtccatatg
gtcagcaccacagcccccatggactccagcctcatccagctcactgcccagagttttagc
accgatggtgagcccaccacccccctgccatgccccatgccccctcaccccgccccactt
gcctccactcacatcccctccaccattgcagctgctggtagtagaggtggtggtgatgga
gcccctcgggggagccccagcccggccagcgtgtccttggggaggaagtccccacattcc
aagtccccgtcagagcagcgggagcggaagtccgtggctgatgacaagaagaaagtgaag
aatctggggtaccgggactccggctattactgggaggtgccacccagtgaggtgcagctg
ctgaagaggattgggacgggctcatttggcactgtgtttcgcgggcggtggcatggcgat
gtggctgtgaaggtgctcaaggtggcccagcccacagctgagcaggcccaggccttcaag
aatgagatgcaggtgctcaggaagacacgtcatgtcaacatcttgctgttcatgggtttc
atgacccggccaggatttgccatcatcacacagtggtgtgagggctccagcctctaccac
cacctgcatgtggccgacacacgcttcgacatggtccagctcattgatgtggcccgacag
actgcccagggcatggactacctccatgccaagaacatcatccaccgagatctcaagtct
aacaacatcttcctacatgaggggctcacagtgaagattggtgattttggcctggccacg
gtgaagacgcggtggagtggggcccagcccttggagcagccctcaggctctgtactgtgg
atggcagctgaggtgatccgtatgcaggatccgaacccctacagcttccaatcggatgtc
tacgcctatggggttgtgctctatgagctcatgaccggctcactgccttacagccacatt
ggcagccgtgaccagattatctttatggtgggccgtggttatctgtccccggacctcagc
aaaatctccagcaactgccccaaggccatgcggcgcctgctgtctgactgcctcaagttc
cagcgggaggaacgtcccctcttcccccagatcctggccgcgattgagctgctgcagcgg
tcactccccaagattgagcggagtgcctccgaaccctccttgcaccgcacccaggctgat
gagttgcccgcctgcctactcagcgcagcccgccttgtgccttag

KEGG   Vulpes vulpes (red fox): 112933694
Entry
112933694         CDS       T05911                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X1
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp04010  MAPK signaling pathway
vvp04012  ErbB signaling pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04022  cGMP-PKG signaling pathway
vvp04024  cAMP signaling pathway
vvp04062  Chemokine signaling pathway
vvp04068  FoxO signaling pathway
vvp04071  Sphingolipid signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04140  Autophagy - animal
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04210  Apoptosis
vvp04218  Cellular senescence
vvp04270  Vascular smooth muscle contraction
vvp04360  Axon guidance
vvp04370  VEGF signaling pathway
vvp04371  Apelin signaling pathway
vvp04510  Focal adhesion
vvp04540  Gap junction
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04613  Neutrophil extracellular trap formation
vvp04625  C-type lectin receptor signaling pathway
vvp04630  JAK-STAT signaling pathway
vvp04650  Natural killer cell mediated cytotoxicity
vvp04660  T cell receptor signaling pathway
vvp04662  B cell receptor signaling pathway
vvp04664  Fc epsilon RI signaling pathway
vvp04666  Fc gamma R-mediated phagocytosis
vvp04720  Long-term potentiation
vvp04722  Neurotrophin signaling pathway
vvp04726  Serotonergic synapse
vvp04730  Long-term depression
vvp04810  Regulation of actin cytoskeleton
vvp04910  Insulin signaling pathway
vvp04912  GnRH signaling pathway
vvp04914  Progesterone-mediated oocyte maturation
vvp04915  Estrogen signaling pathway
vvp04916  Melanogenesis
vvp04917  Prolactin signaling pathway
vvp04919  Thyroid hormone signaling pathway
vvp04921  Oxytocin signaling pathway
vvp04926  Relaxin signaling pathway
vvp04928  Parathyroid hormone synthesis, secretion and action
vvp04929  GnRH secretion
vvp04935  Growth hormone synthesis, secretion and action
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05034  Alcoholism
vvp05132  Salmonella infection
vvp05152  Tuberculosis
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05165  Human papillomavirus infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05210  Colorectal cancer
vvp05211  Renal cell carcinoma
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05218  Melanoma
vvp05219  Bladder cancer
vvp05220  Chronic myeloid leukemia
vvp05221  Acute myeloid leukemia
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05230  Central carbon metabolism in cancer
vvp05231  Choline metabolism in cancer
vvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112933694 (RAF1)
   04012 ErbB signaling pathway
    112933694 (RAF1)
   04014 Ras signaling pathway
    112933694 (RAF1)
   04015 Rap1 signaling pathway
    112933694 (RAF1)
   04370 VEGF signaling pathway
    112933694 (RAF1)
   04371 Apelin signaling pathway
    112933694 (RAF1)
   04630 JAK-STAT signaling pathway
    112933694 (RAF1)
   04068 FoxO signaling pathway
    112933694 (RAF1)
   04072 Phospholipase D signaling pathway
    112933694 (RAF1)
   04071 Sphingolipid signaling pathway
    112933694 (RAF1)
   04024 cAMP signaling pathway
    112933694 (RAF1)
   04022 cGMP-PKG signaling pathway
    112933694 (RAF1)
   04151 PI3K-Akt signaling pathway
    112933694 (RAF1)
   04150 mTOR signaling pathway
    112933694 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112933694 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    112933694 (RAF1)
   04218 Cellular senescence
    112933694 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112933694 (RAF1)
   04540 Gap junction
    112933694 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    112933694 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112933694 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    112933694 (RAF1)
   04625 C-type lectin receptor signaling pathway
    112933694 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    112933694 (RAF1)
   04660 T cell receptor signaling pathway
    112933694 (RAF1)
   04662 B cell receptor signaling pathway
    112933694 (RAF1)
   04664 Fc epsilon RI signaling pathway
    112933694 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    112933694 (RAF1)
   04062 Chemokine signaling pathway
    112933694 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112933694 (RAF1)
   04929 GnRH secretion
    112933694 (RAF1)
   04912 GnRH signaling pathway
    112933694 (RAF1)
   04915 Estrogen signaling pathway
    112933694 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    112933694 (RAF1)
   04917 Prolactin signaling pathway
    112933694 (RAF1)
   04921 Oxytocin signaling pathway
    112933694 (RAF1)
   04926 Relaxin signaling pathway
    112933694 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    112933694 (RAF1)
   04919 Thyroid hormone signaling pathway
    112933694 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    112933694 (RAF1)
   04916 Melanogenesis
    112933694 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112933694 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    112933694 (RAF1)
   04720 Long-term potentiation
    112933694 (RAF1)
   04730 Long-term depression
    112933694 (RAF1)
   04722 Neurotrophin signaling pathway
    112933694 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    112933694 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112933694 (RAF1)
   05206 MicroRNAs in cancer
    112933694 (RAF1)
   05205 Proteoglycans in cancer
    112933694 (RAF1)
   05230 Central carbon metabolism in cancer
    112933694 (RAF1)
   05231 Choline metabolism in cancer
    112933694 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112933694 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112933694 (RAF1)
   05212 Pancreatic cancer
    112933694 (RAF1)
   05225 Hepatocellular carcinoma
    112933694 (RAF1)
   05226 Gastric cancer
    112933694 (RAF1)
   05214 Glioma
    112933694 (RAF1)
   05221 Acute myeloid leukemia
    112933694 (RAF1)
   05220 Chronic myeloid leukemia
    112933694 (RAF1)
   05218 Melanoma
    112933694 (RAF1)
   05211 Renal cell carcinoma
    112933694 (RAF1)
   05219 Bladder cancer
    112933694 (RAF1)
   05215 Prostate cancer
    112933694 (RAF1)
   05213 Endometrial cancer
    112933694 (RAF1)
   05224 Breast cancer
    112933694 (RAF1)
   05223 Non-small cell lung cancer
    112933694 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112933694 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    112933694 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    112933694 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112933694 (RAF1)
   05152 Tuberculosis
    112933694 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112933694 (RAF1)
   05161 Hepatitis B
    112933694 (RAF1)
   05160 Hepatitis C
    112933694 (RAF1)
   05164 Influenza A
    112933694 (RAF1)
   05163 Human cytomegalovirus infection
    112933694 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112933694 (RAF1)
   05165 Human papillomavirus infection
    112933694 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112933694 (RAF1)
   01522 Endocrine resistance
    112933694 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112933694 (RAF1)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112933694 (RAF1)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   112933694 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 112933694
NCBI-ProteinID: XP_025872688
UniProt: A0A3Q7T6P7
LinkDB
Position
Unknown
AA seq 668 aa
MEHIQGAWKTISNGFGFKDTVFDGPSCISPTIVQPFGFQRRASDDGKLTDSSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
NSSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIENNSLNASPRAWSRRFCLRGRDA
IRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPGSGTQEKNKIRPRGQRDSSY
YWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKT
RHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLH
AKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQVEQPTGSILWMAPEVIRMQ
DNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKA
MKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLT
TSPRLPVF
NT seq 2007 nt   +upstreamnt  +downstreamnt
atggagcacatacagggggcctggaagacgatcagcaatggttttggattcaaagacaca
gtgtttgatggccccagctgcatctcccctacaatagttcagccgtttggctttcagcgc
cgggcgtcagatgatggcaaacttacggactcgtctaaaacaagcaacactatccgtgtt
ttcttgccaaacaagcaaagaacagtggtcaatgtgcgaaatggaatgagtttgcatgat
tgccttatgaaagcactcaaggtgagaggcctgcagccagagtgctgtgctgtgttcaga
cttctccatgaacataaaggtaagaaagcacgcttagattggaatactgatgccgcttcg
ttgattggagaagaacttcaagtagatttcctggatcatgttccccttacaacacacaac
tttgctcggaagaccttcctgaagcttgccttctgtgacatctgtcagaagttcctgcta
aatggatttcgttgtcagacttgtggctacaaatttcatgagcactgtagcaccaaagta
cctactatgtgtgtggactggagtaatatcagacaactcttattgtttccaaattctact
attggtgatagtggggtcccagcactgccttctttgacaatgcgtcggatgcgagagtcg
gtttcccggatgcctgttagttcccagcacagatactccacaccccatgccttcacattc
aactcctccagcccctcctctgaaggttccctctcccagaggcagaggtcgacatccaca
cctaatgtccacatggtcagcactactctgcctgtggatagcaggatgatcgagaataac
agcctgaatgcttctcccagggcgtggtccagacgattttgtttgaggggaagagatgca
attcgaagccacagtgaatcagcctcaccttcagccttgtccagcagccctaacaatctg
agcccaaccggctggtcacagcccaaaacccctgtgccagcacagagagagcgggcacca
ggatctgggacccaggagaaaaacaaaattaggcctcgtggacagagagattcaagctat
tactgggaaattgaagccagtgaagtgatgctctccactcggattgggtcaggctccttt
ggaacagtgtataagggcaagtggcacggagatgtcgcggtaaaaatcctaaaggttgtc
gaccccacaccagagcagttccaggccttcaggaacgaggtggctgtccttcgcaaaaca
cggcacgtgaacatcctgctcttcatggggtacatgacgaaggataacctggcaattgtg
acccagtggtgcgaaggcagcagcctctataaacacttgcatgtccaggagactaagttc
cagatgttccagttgattgacatcgcccgccagactgctcagggaatggactatttgcat
gcaaagaacatcatccacagagacatgaaatccaacaatatatttctccatgaaggccta
acggtgaaaatcggagattttggtttggcaacagtaaagtcacgctggagcggttctcag
caggttgaacaacccactggctctatcctgtggatggcccccgaggtgatccgaatgcag
gataataatccattcagcttccagtccgacgtctactcctacggcattgtgctctatgag
ctcatgacgggggagctcccttactcccacatcaataaccgtgatcagatcatcttcatg
gtgggccgagggtatgcctccccagacctcagtaagctatataagaactgccccaaagca
atgaagaggctggtagccgactgtgtgaaaaaggtgaaggaagagaggcctctttttccc
cagatcctgtcttccatcgagctgctccagcactctctgccgaagatcaacaggagcgct
tctgagccgtccctgcatcgggcggcccacactgaggacatcaacgcctgcacgctgacc
acgtcccccagactgcctgtcttctaa

DBGET integrated database retrieval system