KEGG   Vulpes vulpes (red fox): 112907138
Entry
112907138         CDS       T05911                                 

Gene name
LAMB3
Definition
(RefSeq) laminin subunit beta-3 isoform X1
  KO
K06244  laminin, beta 3
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp05145  Toxoplasmosis
vvp05146  Amoebiasis
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112907138 (LAMB3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112907138 (LAMB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112907138 (LAMB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112907138 (LAMB3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112907138 (LAMB3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112907138 (LAMB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112907138 (LAMB3)
   05145 Toxoplasmosis
    112907138 (LAMB3)
SSDB
Motif
Pfam: Laminin_N Laminin_EGF Laminin_II ATG16
Other DBs
NCBI-GeneID: 112907138
NCBI-ProteinID: XP_025838077
UniProt: A0A3Q7QY25
LinkDB
Position
Unknown
AA seq 1172 aa
MRPLLLLCLVWPSFLCAQQACSRGACYPPVGDLLIGRTRFLRASSTCGLTKPETYCTQYG
EWQMKCCKCDSRLPHSYNSHRVENVVSSSGPMRWWQSQNDVNPVSLQLDLDRRFQLQDIL
MDFKGLMPAGMLIERSSDFGNTWQVYQYLAADCASTFPRVRQGQPQSWQDVRCQSLPQRP
NGRPEGGKVQLHIMDLASGIPATQSQKIRELGEITNLRVNFTRLAPVPQRGYHPPSAYYA
VSQLRLQGRCLCHGHADRCAPQPGAPAGPSTTVQVHDVCVCQHNTAGPNCERCAPFYNNQ
PWRPAEDQDPHECQRCDCNGHSETCHFDPAVFAASQGAHGGVCDNCRDHTEGKNCERCQL
HYFRNRHPGAPIQETCIPCECDPDGAVPGVPCDPVTGQCVCKEHVQGERCDLCKPGFTGL
TYANPQGCHRCDCNILGSRRDLPCDEETGQCLCLPHVVGPKCDQCAPYHWKLASGRGCEP
CACDPHNALSPQCNQFTGQCPCREGFGGLTCNAAALRQCPDRTYGDAGSGCRACDCDFRG
TEGPGCDKASGRCLCRPGLTGPRCDQCQRGYCDRYPVCVACHPCFQNYDADLRGRALRLS
SLRNATASLWPGMGLEDPGLTSRIADARSKMEQIQAILSSAPATEQELSQVANAIFSIRR
TLQGLQPDLPIEEETLSLQGDLKNLDRSFQHLLMTYQSKKEHFERLSGANPSGAFQVLTA
AYQRSSRAAQQVSDGSRRLFQLRDSRREAERLEGQLGGGAGVGGPQLVALRLEMASLPDL
TPTINKLCGGSRQTACTPGACPGELCPRDNGTACGSHCRGALPRADGAFRMAGQVAEQLQ
RFNAQLQQTREMIRATEKAALKVQSDAQRLETQVSASRSQMEEDVRRMRFLIQQVRDFLS
DPDTDAATIQEVSEAVLALWLPTDSATVLRKMNEIQAIAARLPNVDLVLSQTKQDVARAR
SLQAAAEQARSRAHAAEGQVEDVVGNLRQGTVALQEAQDTMQGTSRSLRLIQERVAEVQQ
VLGPAERLVASMTEQLGDFRARLAELRRRARQQREQAVRAQQLSEGAEQQALSAQEGFER
MKQKYAELKDQLGRSPMLGDQGSRILSVKTEAEELFGETMEMMDRMKDMESELLRGSQAI
QLRSADLTGLEKHVEQIRDYINERVLYYATCK
NT seq 3519 nt   +upstreamnt  +downstreamnt
atgaggccactcctcctcctgtgccttgtctggcccagcttcctatgtgcccagcaagcc
tgctcccgtggggcctgctatccacctgttggggacctgctcattgggaggacccggttt
ctccgagcttcatccacctgtggattgaccaagcctgagacctactgcacccagtatggc
gagtggcagatgaaatgctgcaagtgtgactctaggttgcctcacagttacaacagtcac
cgagtggagaatgtggtttcatcttcgggccctatgcgctggtggcagtcacagaatgat
gtaaaccccgtctctctgcagttggacctggataggaggttccagcttcaagacatcctg
atggattttaaggggctcatgcccgctgggatgctgattgagcgctcctcggacttcggc
aacacctggcaggtgtaccagtacctggctgccgactgcgcctccaccttccctcgggtc
cgccagggccagcctcagagctggcaggatgttcggtgccagtccctgccccagaggcct
aacgggcgcccggaaggggggaaggttcagcttcacattatggatttagcatctgggatc
ccagccactcaaagtcaaaaaattcgagagctgggggaaatcacaaacttgagagtcaac
tttaccaggctggccccggtgccccagaggggctaccacccgcccagtgcctactacgcc
gtgtcccagctgcgtctccagggccgctgcctctgccacggccacgccgaccgctgtgcc
ccgcaacccggagcccccgccggcccctccaccaccgtgcaggtccatgacgtctgcgtc
tgccaacacaacactgctggccccaattgtgaacgctgtgcgcccttctacaacaatcag
ccctggagacctgcagaggaccaggacccccatgaatgccaacggtgtgactgcaacggg
cactcagagacctgtcacttcgacccagcggtgtttgccgctagccagggggcacatgga
ggtgtgtgtgacaactgccgggaccacacggagggcaagaactgtgagcggtgtcagctg
cactatttccgcaaccggcatccaggggcccccattcaggagacctgtatcccctgcgag
tgtgatcccgatggggccgtgccgggggttccctgcgacccggtgacggggcagtgcgtg
tgcaaggagcacgtgcagggggagcgctgcgacctgtgcaagccaggatttacgggactc
acctatgccaaccctcagggctgccaccgctgcgactgcaacatcctggggtctcgccgg
gacctgccctgtgatgaggagactggacagtgcctgtgcctgccccacgtggtgggcccc
aaatgtgaccagtgcgctccctaccactggaagctggccagcggccggggctgtgagccg
tgtgcctgtgaccctcacaatgccctcagcccccagtgcaaccagttcacagggcagtgc
ccctgtcgagaagggtttggtggcctgacgtgcaatgccgcagcccttcgccagtgtccc
gaccggacctacggagacgcgggctcaggatgccgtgcttgtgactgtgacttccgggga
acagagggcccaggctgtgacaaggcttcgggccgctgcctctgccgccccggcttgacc
ggcccccgctgcgaccagtgccaacgaggttactgtgaccgctacccggtgtgcgtggcc
tgccacccttgcttccagaactacgatgccgacctccggggccgggccctgcgactcagc
agcctccgcaatgccaccgccagcctgtggccggggatgggtctggaggatcctggtctc
acctcccgcatcgcggacgccaggagcaagatggagcagatccaagccatcctctccagt
gccccggccaccgagcaggagctgtcccaggtggccaatgccattttctccatcaggcgg
actctccagggcctgcagcctgacctgcccatcgaggaggagaccttgtccctccaggga
gacctgaagaatctggacaggagcttccagcacctcctcatgacgtatcagagcaagaag
gagcactttgaaaggctaagcggtgccaatccttcaggggccttccaggtgctgacggcg
gcctaccagcggtcctcccgggctgctcagcaggtgtccgacggctcccgccggctcttc
cagctcagggacagccggagagaggcagagaggctggagggtcagctgggaggaggagcc
ggcgtcgggggtccccagctcgtggccctgaggctggagatggcttccttgcctgatctg
acgccgactatcaacaagctctgtgggggctcccggcagacggcctgtaccccaggagca
tgccctggagagctgtgtccccgagacaacggcacggcctgtggctctcactgcagaggt
gccctccccagggcggatggggccttccggatggccgggcaggtggctgagcagctgcag
cgtttcaacgcccagctccagcagaccagggagatgatcagggccaccgagaaagccgcc
ttgaaggtccagtcagacgcccagcgcctggagacccaggtgagcgccagccgctcgcag
atggaggaggatgtcaggcgcatgcggttcctcatccagcaggtccgggacttcctgtca
gaccctgacactgatgcggccaccatccaggaggtcagcgaggccgtgctggccctgtgg
ctgcccacggactctgccaccgtcctgcggaagatgaacgagatccaggccattgccgcc
aggcttcctaacgtggacctggtgctgtcacagaccaagcaggacgttgctcgggcccgt
agcctccaggcggcagccgagcaggccaggagccgagcccacgcagcggagggccaggtg
gaggacgtggtggggaacttgcgccagggcacggtggcgctgcaggaagcgcaggacacc
atgcaaggcaccagccgctcccttcggctcatccaggaaagggttgctgaggttcagcag
gtcctggggccggcggaaagactggtggccagcatgacggagcagctgggtgacttccga
gcgcggctggccgagctccgccgcagggccaggcagcagcgggagcaggcagtgagggcc
cagcagctctcagagggtgctgagcagcaggcgctgagcgcccaggagggatttgagagg
atgaagcaaaaatatgctgaattgaaggaccagttgggtcggagtcccatgctgggggat
cagggcagccggatcctgagcgtcaagacggaggcagaagagctgtttggggagaccatg
gagatgatggacaggatgaaagacatggagtcggagctgcttcgggggagccaggccatc
cagcttcgctcggcagacctgacggggctggagaagcacgtggagcagatccgagactac
atcaatgagcgagtgctctactatgccacctgtaagtga

KEGG   Vulpes vulpes (red fox): 112908232
Entry
112908232         CDS       T05911                                 

Gene name
COL9A2
Definition
(RefSeq) LOW QUALITY PROTEIN: collagen alpha-2(IX) chain
  KO
K08131  collagen type IX alpha
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04974  Protein digestion and absorption
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112908232 (COL9A2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112908232 (COL9A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112908232 (COL9A2)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    112908232 (COL9A2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112908232 (COL9A2)
Proteoglycans [BR:vvp00535]
 Extracellular matrix (ECM) proteoglycans
  Collagen family
   112908232 (COL9A2)
SSDB
Motif
Pfam: Collagen
Other DBs
NCBI-GeneID: 112908232
NCBI-ProteinID: XP_025839485
UniProt: A0A3Q7SD86
LinkDB
Position
Unknown
AA seq 657 aa
TCILQGDKGPPGKAGPPGPKGEPGKPGPDGPDGKPGIDGLTGAKGEPGPMGIPGVKGQPG
LPGPPGLPGPGFAGPPGPPGPVGLPGEIGITGPKGDPGPDGPSGPPGPPGKPGRPGTIQG
LEGSADFLCPTNCPAGVKGPPGLQGVKGHPGKRGVLGDSGRQGKPGPKGDVGASGEQGIP
GPPGPQGIRGYPGMEGPKGEMGPRGYKGMVGSIGAAGSPGEEGPRGPPGRAGEKGDVGGQ
GLRGPQGITGPKGATGPPGIDGKDGTPGTPGMKGSAGQAGRPGNQGHQGLAGVPGQPGTK
GGPGDKGEPGQQGLPGFSGPPGKEGEPGPQGEIGPRGILGQKGDQGERGPVGQPGPQGRQ
GPKGEQGPPGIPGPQGLPGIKGDKVQRGWKIPGSKAPRPAGSGGWSGLEGEAGCRGVLTR
APPRQPGVRGEAGYPGPSGDAGAPGVQGYPGPPGPRGLAGXXXXXXXXXXXPAGLLPGGL
LCPQGRDASDQHIVTVMMKMMQEQLAEVAVSAKREALGAVGMVGPPGPPGPPGYPGKQGP
HGHPGPRGVPGIVGAVGQIGNTGPKGKRGEKGDWGEMGRGHPGMPGPPGIPGLPGRPGQA
INGKDGARGAPGAPGEAGRPGPPGPVGLPGFCEPTACLAASAYASARLTEPGSIKGP
NT seq 1974 nt   +upstreamnt  +downstreamnt
acttgtatcttgcagggtgacaaggggccccctgggaaagccggccctccgggaccgaag
ggagagcctggcaaacccgggccagatgggcctgatgggaagcctgggattgatggtcta
actggagccaagggggagcctggccccatggggatccctggagtcaagggccagcctggg
ctccccggtccccctggcctgccgggccctggctttgctggacctcctggaccacctgga
cctgttggcctccccggtgagattggaatcacaggccccaagggggatcccggaccagat
gggccatcggggcccccggggccacctggcaaaccgggccgacccggaaccatccagggc
ctggaaggcagcgccgatttcttgtgtccgaccaactgtccggcgggggtgaaaggcccc
ccagggctgcagggggtgaaggggcatcctggcaaacgcggggttctgggcgattctggc
cgccaggggaagccgggtcccaagggagatgtgggtgcctctggagagcaaggcatccct
ggaccaccgggtccccagggcatcaggggctacccgggcatggagggacccaaaggagag
atgggtcctcgtgggtacaaaggcatggtgggctccattggtgctgccgggtcacccggt
gaggaaggtccacgggggccaccgggccgagcgggggagaagggcgatgtgggcggccaa
ggtctccgaggacctcagggcataacaggcccaaagggagcaaccgggcccccaggcatc
gacggcaaggacgggaccccaggcacgccaggcatgaagggcagcgcgggacaggcaggg
cggccaggaaaccaaggccaccaaggcctagcgggcgtgccgggccagcctgggacaaaa
ggaggcccgggagacaagggtgaaccaggccagcagggcctccctggattctctggtcct
cctgggaaggagggagagccaggacctcaaggagaaatcggaccccgaggcatcctgggg
cagaagggtgaccagggtgagagggggccggtggggcagccaggccctcagggacggcag
ggccccaagggggagcagggcccccccggaattccagggccccaaggcttgccaggcatc
aagggagacaaggtacagaggggctggaaaatacctgggagcaaggccccaagacctgcg
gggagcgggggatggagcgggctggagggggaggcgggctgcaggggggttctcacccgc
gctccgccccggcagccaggagtccgcggagaagccggctacccgggccccagcggggat
gcgggcgccccgggggtgcagggctaccccgggccccccggccctcgaggactggcggga
gnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnngccggcggggcttcttcctggaggcctc
ctctgcccgcagggccgggacgccagcgaccagcacatcgtgaccgtgatgatgaagatg
atgcaagagcaactggcagaggtcgctgtgagtgccaagcgggaggccctgggtgccgtc
gggatggtgggtccgccaggaccccccgggcctcctgggtacccaggcaagcagggaccc
catgggcaccctggccctcggggcgttcctggcatcgtgggagccgtgggtcagattggc
aacaccggccccaagggaaaacgtggagagaagggtgactggggagagatgggacgcggg
caccctgggatgcctggaccccccgggatcccagggctccccggccggcccgggcaggca
atcaatggcaaggacggggcccgcggtgccccaggggccccgggggaagcaggccgaccg
ggtccgccgggccccgtggggctgcccggcttctgtgagcccacggcctgcctggcagcc
tcggcctacgcctctgcgcgcctcacggagcccggatccatcaaagggccatga

KEGG   Vulpes vulpes (red fox): 112908567
Entry
112908567         CDS       T05911                                 

Gene name
LAMB4
Definition
(RefSeq) laminin subunit beta-4
  KO
K06245  laminin, beta 4
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp05145  Toxoplasmosis
vvp05146  Amoebiasis
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112908567 (LAMB4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112908567 (LAMB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112908567 (LAMB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112908567 (LAMB4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112908567 (LAMB4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112908567 (LAMB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112908567 (LAMB4)
   05145 Toxoplasmosis
    112908567 (LAMB4)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N E1_4HB
Other DBs
NCBI-GeneID: 112908567
NCBI-ProteinID: XP_025839844
UniProt: A0A3Q7R0E3
LinkDB
Position
Unknown
AA seq 1747 aa
MQFQLALFWHLGLLSYVKAQDDCKRGTCHPTTGDLLVGRGAQLTASSTCGLDRAQKYCIL
GYLEGEQKCFVCDSRFPYDPYTQSRSHTIENVITSFEPEREKKWWQSENGVDHVSIRLDL
EALFQFSHLILTFKTFRPAAMLVERSADYGHTWKVLKYFAKDCAASFPNITSGQAQGVGD
LVCDSKYSDIEPSTGGEVVLKVLDPSFDIENPYSPDIQELVTLTNLRINFTKLHTLGDTL
LGRREEDALENYYYAVHAMVVRGSCFCNGHASECDPVQEARGDVFSPPGMVHGRCVCQHN
TDGPNCKRCKDFFQDAPWRPGAGPQDSICRACRCNSHSDRCHFDMTAYLSSGGRSGGVCE
ACRHNTEGQHCDRCRPLFYRDPLKAMSDPYACIPCECDPDGTLSGGMCVSHSDPALGAVA
GQCLCKENVEGAKCDQCKPNHHTLSATDPMGCQPCNCHPSGSAPLPACDVDTGQCLCQPF
ATGPRCEECAVGYWRMEDHLHGCSPCDCDIGGAYSNVCSPKDGQCECRPHITGRSCTEPA
PGYFFAPLNFYLYEAEEATPLQGLAPLGSVTSGQAPVVHVVFREPVPGTPAAWTGPGFAR
VLSGAGLRFAVANISFPMDFTVALRYETQPAADWAVQVLVNPLGGSKHCTHETPWPRPPP
FPLPAASRIVLLPTPICLEPDVQYSIDAYFSQPLEGGSHAHSHILVDSLGLIPQINSLEN
FCSKQDLEEYQLHNCVEIASKMGPQVSPGVCERLIVSMSAKLHNGAIACKCHPQGSVGPS
CSRLGGQCQCKPHVAGRCCDRCSPGSYGLGHHGCHPCHCHPQGSKTTVCDQITGQCSCQG
EVAGRRCDRCLQGYFGFPSCRPCLCNGFAELCDPETGSCFNCGGFTTGRNCERCIDGYYG
NPAAGQSCRPCPCPDVPSSSQYFAHSCYQHPWSSDVICNCLQGYTGKQCGECSAGFYGNP
RVSGAPCQPCVCNNNTDVTDPESCSPLTGECLKCLHNTQGPNCQFCKPGHFGSALNQTCR
RCSCHPPGVNPAECPPGLGACLCDPDTGMCPCLPNVTGQTCDRCADGYWNLVPGRGCQPC
DCDPRTSHGGHCDQLTGQCRCKLGYDGKHCSGCKENYYGDPLEQCIPCDCSGEGAQKPTC
DQDTGMCRCREGVGGPRCDRCARGHGREFPACPRCHQCFDHWDRTVSALSEAVQGLMRLA
ANVEDKRETVLVCEADFKGLQENLSEIERILKHPVFSSGEFLIVKDYQDSAREHAAQLSV
QLKAVHEFPDLKGRLGSMRDEADLLLEGLQREIHLRARARDTSIVDSSENIKKHYQRSLS
AEKKINETTSIIKNSEKIRNDLLTIFDRLSSKENSSLEKLQQITVPDIQILNKKVCGESG
DMPCVLSSCEGPSCHDFLTLSSNALQQAQEAESVIQNLSDQVQGWKNRLKNVSKLAEVSK
NNALQLSEKLRNMKNQSESEKEKMSLLIKKLKKFLSEENVPPEDIEKVADHVLDVHLPTT
SRNLTGELDKIQKVMQLCEDYRTDEDRLRKAVDGAPKLLLKAKGAEEAANVLLNLDKTLN
KLQQVQVTQGRINTTITQLTAEITKIKKNVLQAEKEAKDSKNVLDLAKQPSELEDGLSRL
RTTLQRTGERATRVTAQAAWARRQAGGLEQEFVELKNQYAVLQRKASAMGLTKATLERVE
RLKDVAGKLAEDTEDKIRRIADLEKKIQDLQLSRQEKADQLKQLEDQVVAIKNEIAEQGN
KYATCYS
NT seq 5244 nt   +upstreamnt  +downstreamnt
atgcaatttcaactggccctcttttggcaccttgggttgctcagttacgtgaaggcccag
gatgactgcaaaaggggcacctgtcatcctaccactggcgatctcctggtgggtcgtggt
gcacagctcacagcttcttctacctgcgggctggacagagcccagaaatactgcatcctc
ggctaccttgagggggagcaaaaatgtttcgtctgtgactcgagatttccatatgacccg
tacacccaatcccgcagccacaccatcgagaatgtaattacaagttttgaaccagagaga
gaaaagaaatggtggcaatcagaaaatggtgttgatcatgtcagcatcagattggaccta
gaggcattatttcagttcagccaccttattctgacctttaagacttttcggcctgctgca
atgttagttgaacgctccgcagactatggacacacctggaaagtgctcaaatattttgca
aaagactgtgctgcttcctttcccaatatcacatcgggccaggcccagggagtgggagac
cttgtttgtgactccaaatactcggatatcgaaccctcaactggtggcgaggtcgtttta
aaggttctggatcccagctttgacatcgaaaacccttacagccccgacatccaggagctt
gtgacgttaacaaacctgcggataaactttaccaaactccacaccctgggggatactttg
cttggaaggagggaagaggatgcccttgaaaattactactatgctgtgcatgcgatggtg
gtgcggggcagctgcttttgcaacggccacgccagcgagtgcgacccggtgcaggaggcc
cgcggagacgtcttcagcccgcccggcatggtgcacggtcggtgcgtctgccagcacaat
acagacggcccgaactgcaagcgctgcaaggacttcttccaggacgccccgtggaggccg
ggagcgggtccccaggacagcatctgcagagcctgtcgctgcaacagccactctgaccgc
tgtcacttcgacatgacggcctacctgagcagcggcggccgcagcggaggggtgtgcgaa
gcctgtcgccacaacaccgagggccagcactgtgaccgctgcaggcccctcttctacagg
gaccctctcaaggccatgtccgacccttacgcgtgcatcccttgtgaatgtgacccggac
gggaccttatcaggtggcatgtgtgtgagccactctgatcctgctttgggggctgtggcc
ggccagtgcttgtgcaaggagaacgtggaaggagccaagtgtgaccagtgcaagcccaac
caccacacactgagcgccactgaccccatgggttgtcagccctgcaactgccacccctcc
gggagtgcgccgctcccggcctgcgacgtggatacaggccagtgcttgtgccagcccttt
gccaccgggccacgctgtgaagaatgtgctgttgggtactggagaatggaagatcacctc
cacggctgttccccctgtgactgtgacattggaggtgcttattccaacgtgtgctcaccc
aaggatgggcaatgtgaatgccgcccacacatcactggccgcagttgcaccgaaccagcc
ccgggctacttctttgctcctttgaatttctatctctatgaggcagaggaagccacccca
ctgcaaggacttgcacctttgggctcagtgacttctggccaggcgcctgtcgttcacgtt
gttttccgagaaccagtgcccgggacccctgctgcgtggactggacctggatttgccagg
gttctctctggggctggcttgagatttgctgtcgccaacatctcctttcccatggacttc
accgttgcccttcgctatgaaactcagcccgcagccgactgggccgtccaggtcctggtt
aacccccttggagggagcaagcactgtacgcacgagactccatggccacggccaccacct
ttccctctaccggcggcttccagaatcgtgctgcttcccacacccatctgtttagaacca
gatgtacaatattccatagacgcctatttttcccagcctttggaaggagggtcccacgct
cattcacacatcttggtggattcacttggtctgattccccaaatcaattcattggagaat
ttctgcagcaagcaggatttagaggagtatcagctgcacaactgtgttgagatcgcctca
aagatgggacctcaggtgtcccccggtgtgtgtgaaaggcttatagtcagcatgtctgcc
aagctgcacaacggggctatagcctgcaagtgtcacccccagggctcggtggggcccagc
tgcagccgacttgggggccagtgccaatgtaagcctcacgtggccgggcgctgctgtgac
aggtgctcacctggaagctacggtctgggacatcatggctgtcacccatgtcactgccac
cctcaaggctcaaagaccactgtatgcgaccaaataacgggacagtgctcctgccagggg
gaggtggccggccgccgttgtgaccggtgcctgcaaggctacttcggatttcccagctgc
cgcccttgcctttgtaatgggttcgccgaactttgtgacccagagacagggtcatgcttc
aattgcgggggttttacaactggaagaaactgtgaaagatgcatcgatggttactatggg
aatcctgctgcgggacagtcctgtcgcccttgcccatgtccagatgttccctcgagcagc
caatattttgcccactcctgttatcagcatccttggagctcagatgtgatctgcaattgt
cttcaaggttatacaggtaagcagtgtggagaatgctctgcgggtttctatggaaatccc
agagtttcgggagccccttgccagccgtgtgtgtgcaacaacaacaccgatgtgacggat
ccggagtcctgcagcccgctaaccggggagtgccttaagtgtttgcacaacactcagggg
cccaactgccagttctgcaaaccaggtcactttggatctgccctcaatcagacctgcagg
aggtgctcctgccatcctcctggtgtgaatccagctgagtgtccccctggcctgggagct
tgcctctgtgaccctgacactggcatgtgcccttgtctgcccaacgtcacgggccagacc
tgtgaccgctgtgcagacggatactggaatctggtccctggcagggggtgtcagccatgt
gattgtgacccccggacctctcacggtggccactgtgaccagcttacaggccaatgtcgg
tgtaaattaggctatgatgggaaacactgcagtggatgcaaggaaaattattatggtgat
ccactggagcaatgcattccatgtgactgcagcggagaaggtgcccagaagcccacctgt
gaccaggacacgggcatgtgccgctgtcgggagggagtcggcggcccgcgatgcgatcgc
tgtgcccggggtcacggccgggagttccctgcctgtccgcggtgtcaccagtgctttgat
cactgggaccgcaccgtctctgccctctccgaagcggtgcaagggttaatgaggctggct
gctaacgtggaagataaaagagagaccgtgctggtctgcgaggccgacttcaaaggcctc
caagagaacttgtcagaaatagaaaggattctgaaacatcctgttttctcatctggggaa
ttcttaatagtcaaggattatcaggactccgctcgggaacacgccgcgcagctaagtgtg
caactgaaagccgtgcatgagtttccagatctgaaaggaaggctgggaagcatgagggat
gaagcagacctcttactggaaggtcttcagagagaaatccacctgcgcgcccgagcccgt
gacacgagcatcgtggattcctcagagaacatcaagaagcattatcagaggtcattatct
gctgaaaagaaaattaatgaaaccacttctatcataaaaaactctgaaaaaatcaggaat
gacttacttaccatctttgataggctaagctcaaaagaaaactcatcattggaaaaatta
cagcagattacggtaccagatatccaaatattgaacaaaaaggtgtgtggagaatcaggg
gacatgccgtgtgtgctctcatcctgtgaaggccccagctgtcacgacttcctgaccctc
tcaagcaatgccctccagcaagctcaggaagcagagtctgtgattcaaaatttgagtgac
caggtccagggttggaagaaccggctcaaaaatgtaagtaaactggcagaggtctccaaa
aacaatgccttacaactaagcgagaaactgaggaatatgaaaaaccaaagtgaatctgag
aaagagaaaatgagtcttttaatcaaaaagctgaaaaagtttttgtcagaggaaaacgtg
cctccagaggacatagagaaggttgcagatcacgtgcttgacgtccacctaccaacgaca
tcgcgaaacctaaccggtgaacttgacaaaatacagaaggtgatgcagctctgtgaggac
tacaggacagatgaggacaggctgcgcaaagcggtcgatggagccccaaagcttttgtta
aaggcaaagggagcagaagaagcagcaaatgttctattaaatcttgacaaaacgttgaat
aaattgcaacaagttcaagtcacccaaggacggataaataccaccatcacgcagctgact
gcggagataacaaaaattaaaaagaacgtactgcaggctgaaaaggaagccaaggactcg
aagaatgtgctggacttagcaaagcagccgtcagagctggaggatgggctttcccggctg
cggaccacgttgcaaaggactggagagcgagccacccgggtgacagctcaggctgcatgg
gcccgacgccaggccgggggcctggagcaggagtttgtagagctgaaaaaccaatatgct
gttcttcaacgtaaggccagcgctatgggactaaccaaggcgacgttggaaagagtggaa
cggctaaaagacgtggcagggaagctggccgaggatacagaggacaagataagaagaata
gcagatttagaaaagaagatccaagatctgcagctgagtagacaagaaaaagctgatcaa
ctgaaacagttggaagatcaagttgttgccattaaaaatgagatcgctgagcagggaaat
aaatatgctacttgctatagttag

KEGG   Vulpes vulpes (red fox): 112908586
Entry
112908586         CDS       T05911                                 

Gene name
LAMB1
Definition
(RefSeq) laminin subunit beta-1
  KO
K05636  laminin, beta 1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp05145  Toxoplasmosis
vvp05146  Amoebiasis
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112908586 (LAMB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112908586 (LAMB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112908586 (LAMB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112908586 (LAMB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112908586 (LAMB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112908586 (LAMB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112908586 (LAMB1)
   05145 Toxoplasmosis
    112908586 (LAMB1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N CorA F5_F8_type_C
Other DBs
NCBI-GeneID: 112908586
NCBI-ProteinID: XP_025839862
UniProt: A0A3Q7R3J6
LinkDB
Position
Unknown
AA seq 1785 aa
MGPLQVLAFSFAALCGAQVRAQEPEFSYGCAEGSCYPATGDLLIGRAQRLSVTSTCGLHK
PEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLKIWWQSENGVEN
VTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYDCESSFPGISTG
PMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFRIEDPYSPRIQNLLKITNLRIKFVKL
HTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVEGFSEEVEGMVHGHCMC
RHNTKGLNCEQCMDFYHDLPWRPAEGRNSNACKKCNCNEHSSSCHFDMAVYLATGNVTGG
VCDDCQHNTMGRNCEQCKPFYFQHPERDVRDPNLCERCTYPAGSQNEGVCDGHTDFSTGL
IAGQCRCKLHVEGEHCEICKEGFYGLSAEDPFGCRSCACNPLGTIPGGNPCDSETGYCYC
KRLVTGQHCDQCLPEHWGLSNDLDGCRPCDCDLGGALNNSCSAESGQCVCRPHVIGRQCN
EVEPGYYFTTLDHYIYEAEEANFGPGVSIVERQYIQDRIPSWTGPGFVRVPEGAYLEFFI
DNIPYSMEYDILIRYEPQLPDRWEKAVIIVQRPGKIPTSSRCGNTIPDDDNQVVSLSPGS
RYVVLPRPVCFEKGVNYTVRLELPQYTSSDSDVESPYTLIDSLVLMPFCKSLDIFTVGGS
GDGLVTNSAWETFQRYRCLENSRSVVKTPMTDVCRNIIFSISTLLHQTGLACECDPQGSL
SSVCDPNGGQCRCRPNVAGRTCDRCAPGTFGFGPNGCKPCECHLQGSVSASCHPVTGQCH
CFQGVYARQCDRCLPGYWGFPSCQPCQCNGHAEDCDPGTGACLSCQDYSTGHNCERCLAG
YYGDPIIGSGDHCRPCPCPDGPDSGRQFAGSCYQDPVTLQLACVCDPGYVGSRCDSCAPG
FFGNPSDVGGSCRPCQCHHNIDTTDPEACDRETGRCLKCLYHTEGERCQLCRVGYYGDAL
RQDCRKCVCNSLGTEQDHCDGSDCQCDKATGQCSCLPNVVGLNCDRCAPNTWQLASGTGC
DPCDCDPAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPNVECRACDCDPRGIET
PQCDQSTGQCVCVEGVEGPRCDKCTRGYSGVFPDCAPCHQCFALWDVIVAELTNRTRKFL
EKAKALKISGVIGPYRETVDSVEKKVNEIRDILAQSPAAEPLKNIGDLFEEAEKLTKDVS
EKMAQVEVKLSDTASLSNSTARELDSLQTEAESLDNTVKELAEQLEFIKNSDIRGALDSI
TKYFQMSLEAEERVNASTTDSNSTVEQSALTRDRVEDLMMDREAQFREKQEEQARLLDEL
AGKLQSLDLSAAAEMTCGTPPGASCSETDCGGPNCRTDEGEKKCGGPGCGGLVTVAHSAW
QKAMDFDRDVLSALAEVEQLSKMVSEAKLRADEAKQNAQDVLQKTNATKEKVDKSNEDLR
NLIKQIRNFLTQDSADLDSIEAVANEVLKMEMPSTPQQLQNLTEDIRERVESLSQVEVIL
QQSAADVARAEALLEEAKRASKSATDVKVTADMVKEALEEAEKAQIAAEKAIKQADEDIQ
GTQHLLTSIESETAASEETLLNASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVKQ
SADDVKKALDNEVDEKYKKVEKLIAQKTEESADARRKAEMLQNEAKTLLAQANSKLQLLK
DLERKYEDNQKYLEDKAQELVRLEGEVRSLLKDISQKVAVYSTCL
NT seq 5358 nt   +upstreamnt  +downstreamnt
atggggccgctccaggtgctcgctttcagcttcgcagccctgtgcggagcccaggtgcgc
gctcaagaacccgaattcagctacggctgcgcggagggcagctgctaccccgccaccggc
gaccttctcatcggccgggcgcagaggctctcggtgacctcgacgtgcgggctgcacaag
cctgagccctactgtatcgtcagccacctccaggaggacaaaaaatgcttcatctgcaat
tcacaagatccttatcacgagaccctcaatcctgacagtcatctcattgaaaatgtggtc
actacatttgctccaaaccgccttaagatttggtggcaatctgaaaatggtgtggaaaat
gtaactatccaactggatttggaagcagaattccattttactcatctcatcatgactttc
aagacattccggcctgccgctatgctgatagaacgatcgtctgactttgggaaaacctgg
ggcgtgtacagatactttgcctatgactgcgagagctcatttccaggcatttccactggc
cccatgaagaaagtggatgatataatctgtgattctcgctattccgacattgaaccctca
acggagggagaggtgatatttcgtgctttagatcctgctttcagaatagaagatccttat
agtccaaggatacagaatctcttaaaaatcaccaacttgagaatcaagtttgtgaagctg
cacactttgggagataaccttctggattccaggatggaaatcagagagaagtattactac
gctgtttatgacatggtggttcgaggaaattgcttctgctatggacatgccagcgaatgc
gccccagtggagggattcagtgaggaagtagaaggaatggttcacggacactgcatgtgt
aggcataataccaagggcttaaactgtgagcagtgcatggatttctaccacgatttacct
tggagacccgccgagggtcgaaacagcaacgcctgtaaaaagtgtaactgcaatgaacat
tcaagctcgtgccacttcgacatggcggtgtacttggccactggaaacgtcactggaggg
gtgtgtgatgactgtcagcataacacgatgggacgcaactgtgagcagtgcaagccgttt
tacttccagcatccagagagagacgtccgagaccctaacctctgtgaacggtgtacctac
ccagctggatctcagaacgagggagtctgtgacggtcacactgatttttccaccggcctc
attgctggtcagtgccggtgtaaattacacgtggaaggggaacactgtgaaatttgcaaa
gaaggtttctacggtttaagtgctgaggatccattcggttgtcgatcttgtgcttgcaat
cctctgggaaccatccctggtgggaatccttgtgattctgagaccggttactgctactgt
aagcgtctggtgacaggacagcattgtgaccagtgtctgccagagcactggggcttaagc
aatgatttggatggatgtcggccttgtgactgtgaccttggaggagccttgaacaacagc
tgctcagcggagtcaggccagtgtgtgtgccgaccccacgtgatcgggcgtcagtgcaac
gaagtggaacctggttactacttcaccaccttggatcactacatctatgaagcagaagaa
gccaactttgggcctggggtgagcatcgtggagcggcagtacatccaggaccgcattcct
tcctggaccggaccgggcttcgtccgagtgcccgaaggggcttatctggagtttttcatt
gacaacataccatattccatggagtatgacatcttaattcgctacgaaccacagctaccc
gaccgctgggaaaaagctgtcatcatagtgcagcgacctggaaagatcccaaccagcagc
cgatgtggtaacacaattcccgatgatgacaaccaggtggtgtccttatcgcctggctca
aggtatgtggtccttccacgccccgtgtgctttgagaagggtgtgaactacacagtgagg
ttggagctgccccagtacacctcctccgatagcgacgtggagagtccctacacgctcatc
gattctctagttctcatgccgttctgtaagtcactggacatcttcactgtaggaggatca
ggggacgggttggtcaccaacagtgcctgggaaacctttcagagatacagatgtctggag
aatagcagaagcgttgtgaaaacaccaatgacggacgtatgcagaaacataatcttcagt
atttctaccctgttacaccagacaggcctggcttgtgagtgtgacccccagggctcccta
agttctgtctgtgaccccaacggaggccagtgccgctgccggcccaacgtggctgggaga
acctgcgacagatgtgctcctggcacttttggcttcggccccaatggatgcaaaccatgt
gagtgccacctgcaagggtccgtcagcgcctcctgccaccctgtcaccggccagtgccac
tgcttccagggcgtgtacgctcggcagtgcgaccgctgcctgcccggctactggggcttc
cccagctgccagccctgccagtgtaacggccacgccgaggactgcgacccagggacgggg
gcgtgcttgagctgccaggactacagcaccgggcacaactgtgagaggtgcctggccggt
tactacggtgatcccatcatcgggtcaggggaccactgccgcccttgtccttgcccggac
ggtcccgacagcggacgccaattcgccggtagctgctatcaagaccctgtgacgctgcag
ctggcgtgtgtctgtgaccctggatacgtcggctccaggtgtgacagctgcgcccccggc
ttcttcggcaacccctcggacgtcgggggctcttgtcggccttgccagtgtcaccacaac
atcgacacgacggacccggaagcctgcgacagggagacggggaggtgcctcaagtgcctg
taccacacggaaggggagcggtgccagctgtgccgcgtggggtactacggggacgccctc
cggcaggactgccgcaagtgcgtctgcaactccctgggcaccgagcaggaccactgcgat
ggctctgactgccagtgtgacaaagccaccggccagtgctcgtgtctccccaacgtggtt
gggctgaactgtgaccgctgtgcgcccaatacctggcagctggccagcgggacgggctgc
gacccgtgcgactgcgaccccgcacattccttcgggccgtcttgcaacgagttcacgggg
cagtgccagtgcatgcctggcttcggggggcgcacctgcagcgagtgccaggagctgttc
tggggagaccccaacgtggagtgccgagcctgtgactgtgaccccaggggcattgagacg
ccacagtgtgaccagtccactggccagtgcgtctgcgtcgagggtgtcgagggtcctcgc
tgtgacaagtgcactcgcgggtactcgggggtcttccccgactgcgctccctgccaccag
tgctttgccctctgggacgtgatcgtcgccgagctgaccaatcggacccgcaaattcctg
gagaaagccaaggccttgaagatcagtggtgtgatcgggccttaccgggagactgtggac
tcggtggagaaaaaggtcaacgagatcagagacatcctggcccagagcccagccgcggag
ccgctgaaaaacattggggatctctttgaggaagcggagaaattaaccaaagatgtttcg
gaaaagatggctcaagtcgaagtgaaattgtctgacacagcttcactaagcaacagcaca
gccagagaactagattctctacagacagaagcagaaagcctagacaacacagtgaaagag
cttgctgagcaattggaatttatcaaaaactcagatattcggggtgccttggatagcatt
accaagtatttccagatgtctctcgaggcagaggagagggtgaatgcctccaccacggat
tccaacagcactgtggagcagtcggctctcactcgggacagagtagaagacctgatgatg
gaccgagaggcccagtttagggaaaaacaagaggaacaggcccgccttctggatgaactg
gcaggcaaactacaaagtctagacctttctgctgctgccgaaatgacctgcgggacgccc
ccgggggcctcttgttctgagacggactgtggcggccccaactgcaggacggacgaaggc
gagaagaagtgtggggggcctggctgcgggggcctggtcacggttgcacacagtgcctgg
cagaaagccatggacttcgaccgagatgtcctgagcgcgctggctgaggtggagcagctc
tccaagatggtctccgaagcaaaactgagagcagatgaggcaaaacagaacgctcaggat
gtcctgcagaaaaccaatgccaccaaagagaaagtggacaagagtaatgaggacctgaga
aatctgatcaagcaaatcaggaactttctgacccaggacagtgccgatttggacagcatt
gaagcggttgctaacgaagtgctgaagatggaaatgcccagcaccccacagcagttacag
aacttgacagaggatattcgcgaacgagtcgaaagcctttctcaagtggaggtgattcta
cagcagagcgctgctgatgtcgccagagctgaggcattgctggaagaagctaaaagagcc
agcaaaagtgcaactgatgttaaagtcaccgcagacatggtaaaggaggcgctggaggaa
gcagagaaggcccagattgcagccgagaaggcaatcaagcaggcagacgaagacatccaa
ggaacccagcacctgctgacctcgattgaatctgaaactgctgcttctgaggagaccctg
ctcaacgcctcccagcgcatcagcgagctggagagaaatgtggaagagctgaagcggaag
gctgcccagaactcgggggaggcagagtacatcgagaaagtagtgtacactgtgaaacaa
agcgcagatgatgtgaaaaaggctctggacaatgaagttgatgaaaagtataagaaggta
gaaaaattaattgcccaaaaaaccgaagaatcagcagatgccaggaggaaagcggagatg
ctacaaaatgaagcaaaaacacttttggctcaagcaaacagcaagctgcagctcctgaaa
gatttagaaagaaaatatgaggacaatcaaaaatatttagaagataaagctcaagaatta
gtaagattggaaggagaagtccgctcgctcctaaaggatataagccagaaggttgctgtt
tatagcacctgcctataa

KEGG   Vulpes vulpes (red fox): 112908780
Entry
112908780         CDS       T05911                                 

Gene name
COL6A3
Definition
(RefSeq) collagen alpha-3(VI) chain isoform X1
  KO
K06238  collagen type VI alpha
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04974  Protein digestion and absorption
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112908780 (COL6A3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112908780 (COL6A3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112908780 (COL6A3)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    112908780 (COL6A3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112908780 (COL6A3)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112908780 (COL6A3)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112908780 (COL6A3)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   112908780 (COL6A3)
SSDB
Motif
Pfam: VWA VWA_2 Collagen VWA_3 Kunitz_BPTI fn3 HC2
Other DBs
NCBI-GeneID: 112908780
NCBI-ProteinID: XP_025840125
UniProt: A0A3Q7SET7
LinkDB
Position
Unknown
AA seq 3181 aa
MRKHRHLPLVAIFCLFLSGFSLTRAQQQQADVKNGAAADIIFLVDSSWSIGKEHFQLVRE
FLYDVIKSLAVGDSDFRFALVQFNGNPHTEFLLNTYRTKQEVLSHISNMSYIGGSNETGK
GLEYVMQHHLTEAAGSRAGDGVPQVIVVLTHGHSDDRLALPSAELKSADANVFAIGVEDA
DEGALKEIASEPPNMHVFNLENFTSLHDIVGNLVSCVQSSVAPEGAGGTETLKDITAQDS
ADIIFLIDGSNNTGSAHFAVIRDFLVNLLERLSVGAQQIRVGVVQYSDEPRTVFSLDTYS
TKAQVLDAVKALAFTGGELANVGLALDFVVENHFTRAGGSRVEEGVPQVLVLISAGPSSD
EIRDGVVALKQASVFSFGLGAQAASRAELQHIATNDNLVFTVPEFRSFGDLQEQLLPYIV
GVAQRHIVLQPPTIVTEVIEVNKRDIVFLVDGSSALGLANFNAIRDFIAKVIQRLEIGQD
LIQVAVAQYADTVRPEFYFNSYPSKREVIAAVRRMKPMEGSVLYTGSALDFARDNLFTSS
AGYRAAEGVPKLLVLITGGKSLDEISQPAQELKRNSIMSFAVGSKAADQAELEEIAFDSS
LVFIPTEFRAAPLQGLLPGLLAPLRTLSGTSEVHANRRDIIFLLDGSFNVGKANFPYVRD
FVMNVVNSLDVGSDNIRVGLVQFSDTPVTEFSLNTYQTKSDLLAHLRQLQLKGGSGLNTG
SALSYVHANHFTEAGGSRIREHVPQLLLLLTAGRSEDAYLPAANALARAGVLTFCVGASQ
ANRAELEQIAFNPSLVYLMDDFSSLPALPQQLIQPLTTYVSGGVEEVPLAQPESKRDILF
LFDGSANLVGQFPAVRDFLYKVIDELDVKPEGTRVAVAQYSDDVRVESRFDEHQNKPEIL
NLVKRMKIKTGKTLNLGYALDYARRYIFVKSAGSRIEDGVLQFLVLLVAGRSSDRLDTPA
LNLKQSGVVTFILQAKNADPTELELMVPSPVFILAAESLPKIGDLQPQIVNLLKSVQNGA
PAPVSGEKDVVFLIDGSEGVRSGFPLLKEFVQRVVESLDVGPDRVRVAVVQYSDRTRPEF
YLNSYMDQQSVVNAIRRLTLLGGPTPNTGAALDFVLRNILISSAGSRIAEGVPQLLIVLT
ADRSGDDVRGPSVVLKRGGAVPIGIGIGNADITEMQTISFIPDFAVAIPTFRQLGTIQQV
VSDRVIQLSREELSRLQPVLLPPTSPGVGSKKDVVFLIDGSQNASPEFQYIRTLIERLVD
YLDVGFDTTRVAVIQFSEDPRVEFLLNAHSSKDEVQNAVRRLRPKGGRQINIGSALEYVS
RNIFKRPLGSRIEEGVPQFLVLISSGKSDDEVDDSAAELKQFGVAPFTIARDADQEQLVK
ISLSPEYVFSVNTFRELPSLEQKLLTPITTLTSEQIQQILASTRYPSPGIESDAADIIFL
IDSSDSVKPDDIAYIRDFIIKIVRRLNIGPNKVRIGAVQFSNEVFPVFYLKTHKSQASVI
NALRQLRHRGGSPLNTGKALEFVARNLFVKSAGSRIEDGVPQHLVLFLGGKSQDDTSRFS
QVISSSGIVSLGVGNRNIDRAELQTITNNPRLVFTVREFRELPNIEDRVMHAFGPSGVTP
APPGVDTPSPSRPEKKKADVVFLLDGSINFRRDSFQEVLRFVSEIVDTLYEGGDSIQVGL
VQYNSDPTDEFFLKDFSTKQQIIDAINKVVYKGGRHANTKVGIEHLRLNHFVPEAGSRLD
QRVPQIAFVITGGKSVEDAQEASLALTQKGVKVFAVGVKNIDSEEVGKIASNSATAFRVG
NVQELSELSEQVLETLHDAMHETLCPGVTDISKVCNLDVILGFDGSRDQNVFVTQKGLES
KMDTILNRISQMQRISCSGGQMPTVRVSVVANTPTGPVEAFDFAEYQPELFEKFRNMRNQ
HPYVLTADTLKVYQNKFRQSSADNVKVVIHFTDGVDGNLADLQKASEELRQEGVQALILV
GLERVANLEQLMHLEFGRGFLYNRPLRLNLLDLDYELAEQLDNIAEKACCGVPCKCSGQR
GDRGPIGSIGPKGIPGEDGYRGYPGDEGGPGERGPPGVNGTQGFQGCPGQRGIKGSRGFP
GEKGELGEIGLDGLDGEDGDKGLPGSSGEKGNPGRRGDKGPKGVKGERGDVGFRGDPGDS
GRDSQQRGPKGETGDIGPMGLPGRDGVSGRPGDPGKDGGFGRRGPAGTKGNKGGPGQPGS
AGEQGARGAQGPPGPTGPPGLIGEQGISGPRGGGGTTGVPGERGRIGPLGRKGEPGEPGQ
KGGIGSRGPRGETGDDGRDGVGSEGRKGKKGERGFPGYPGPKGVPGEPGTGGPPGPKGIR
GRRGNSGPPGAIGQKGDPGYPGPSGPKGNRGDSMDQCALVQSIKDKCPCCYGPLECPVFP
TELAFALDTSEGVTQDTFSRMRDVVLKLVGDLTIAESNCPRGARVAVVTYNNEVTTEIRF
ADSKKKSVLLDKIKNLQVALTSKQQSLETAMSFVARNTFKRVRNGFLMRKVAVFFSNKPT
RASPQLREAVLKLSDAGITPLFLTSQEDRQLVNALQINNTAVGHALVLPARRDLTDFLKN
VLTCHVCLDICNIDPACGFGNWKPSFRDRRAAGSDVDIDMAFILDSSESTSLFQFNEMKK
YIGYLVRQLDISPDPKASQHFARVAVVQHAPYESLGNPSLPPVKVEFSLTDYDSKEKLVD
FLSRRMTQLEGTRDLGSAIEYTIENVFESAPNPRDLKIIVLMLTGEVEKEQLEEAHRVIL
QAKCKGYFFVILGIGRKVNVKEVYSFASEPNDVFFKLLDKPTELNEEPLMRFGRLLPSFV
GSENAFYLSPDIRKQCDWFQGDQLTKNPVKFGHKQLNTPNNATSSPTSKPVTTAKPVTTT
EPVTTTTKPVTVVNLPASKPAAAKPAPPKPAAAKPVAARPVAAKPEVAKPEATKTATVKP
AVAVKPAAAKPVAAKPAAVRPPAAARLVAAKPEAPKPQGAKPAATKPATSKPVAKATREV
RVSDITENSAKLHWERPEPPSPYFYDLTVTSAHDQSLVLRQNLSATERAVGGLLAGHTYH
VAVVCYLRAQARAVYQGSFSTKKAQPPPSQARLASSSTVNLMVSTEPLAGGETDICKLPK
EEGTCRKFMLKWYYDVETKSCMRFWYGGCSGNENRFDSQKECETVCTPALVNPGVIAAMG
T
NT seq 9546 nt   +upstreamnt  +downstreamnt
atgaggaaacatcgacatttgcccttggtggccatcttttgtctttttctctcaggcttt
tctcttactcgtgcccaacagcagcaagcagatgtcaaaaatggtgctgctgccgatata
atatttctagtggattcctcttggagcattggaaaggaacatttccaacttgttcgagag
tttctgtatgatgttataaaatctttagctgtgggagacagtgatttccgttttgctctg
gtccagttcaacggcaacccacataccgagttcctgttaaatacctaccgtactaagcaa
gaagtcctctcccacatttccaacatgtcttatattgggggaagcaatgagactggaaaa
ggattagaatacgtaatgcagcaccacctcactgaggctgccggaagccgggccggggac
ggagtccctcaggttatcgtagtgttaacccatggacactccgacgaccgccttgctctg
ccctcagcggaacttaagtctgctgacgctaacgtgtttgcaattggagttgaggatgca
gatgaaggagccttaaaagaaatagcaagcgaaccgcccaatatgcatgtgttcaaccta
gagaattttacctcacttcatgacatagtaggaaacttagtgtcctgtgtgcaatcatcc
gtggctccggaaggggctggaggcacggagacccttaaagacatcacagcacaagattct
gcagacattattttccttattgacggatcaaacaacaccggaagtgcccatttcgcagtc
attcgcgacttccttgtaaatctccttgagagactctcagttggagctcagcagatccga
gtgggggtggtccagtatagtgatgagcccagaaccgtattctccttggacacctactcc
accaaggcccaggttctggatgcagtgaaagccctggcgttcactggtggggagctggcc
aatgtcggccttgcccttgatttcgtggtggagaaccacttcacccgggcagggggcagc
cgagtggaggaaggggttccccaggtgctggtcctcataagtgctgggccttctagtgac
gagatccgcgacggggtggtagcgctgaagcaggctagcgtgttctcatttggcctcgga
gcccaggccgcctccagggcagagcttcagcacatagctaccaatgacaacttggtgttt
actgtcccggaattccgtagctttggggacctccaggagcaattactgccgtacattgtt
ggcgtggcccaaaggcacattgtcttacaaccgccaaccattgtcacagaagtcattgaa
gtcaacaagagagacatagttttcctggtggatggctcatccgcactgggactggccaac
ttcaatgcaatccgcgacttcattgccaaagtcatccagaggctggagatcggacaggat
ctaatccaagtggcagtggctcagtatgcagacactgtgaggcccgagttttatttcaat
agctaccccagtaaaagggaagtcattgccgccgtgcggagaatgaaacccatggaaggc
tcggtcctgtacacgggctccgctctggactttgctcgggacaacctgttcactagttcg
gctggctaccgggccgccgagggggtccctaagcttctggtgctgattacaggcggtaag
tccctagatgaaatcagccagcccgcccaggagctgaagagaaacagcatcatgtccttt
gccgttgggagcaaggcggccgaccaggctgagctggaagagattgcatttgattcctcc
ctggtgttcatccccaccgagttccgagccgcccctttgcagggcctgctgcccggcttg
ctggcgcctctcaggaccctctccggaacctctgaagttcacgcaaacagaagggatatc
atctttcttttggatggatcgttcaacgttggaaaggccaatttcccttatgtgcgggac
tttgtaatgaacgtagttaacagccttgatgttggaagcgacaacattcgtgtcggttta
gtgcaatttagtgacactccagtaacagagttctccctaaacacataccagacaaagtca
gatttgcttgctcatctgaggcagctgcagctcaagggggggtcaggcctgaacactggc
tcggccctgagctatgtccatgccaaccacttcaccgaagctggcggcagcaggatccgc
gaacacgtgccgcagctcttgctcctgctcacagctgggcggtctgaggacgcctatctg
ccagctgccaatgccctagcgcgcgcgggcgtcctcaccttctgcgtgggggctagccag
gcgaatagggcagagcttgagcagattgcttttaacccgagcctggtgtatctcatggat
gatttcagctccctgccagctttgcctcagcagctgattcagcctctaaccacttatgtt
agtggaggcgtggaggaggtcccactcgcccagccagagagcaagcgagacattctattc
ctctttgacggctcagccaatctcgtgggccagttccctgcggtccgcgactttctctac
aaggttatcgatgagctggatgtgaagccagaggggacccgggttgcggtggctcagtac
agcgatgatgtcagggtggagtcccgcttcgatgagcaccagaacaagcccgaaatcctg
aatcttgtgaagagaatgaagatcaagaccggcaaaaccctcaatctgggctacgcgctg
gactacgcacggagatacatctttgtcaagtccgccggaagccggatcgaagatggagtg
ctccagttcctggtcctgctggtggcaggaaggtcctccgatcgtttggacacacctgcc
ctcaacctgaaacagagcggggtggtgactttcatcttgcaggccaagaacgcagatcct
actgagctggagctcatggtgccgtcgcctgtctttatcctggccgccgagtcacttccc
aagattggagaccttcaaccacagatcgtcaatctcttaaaatcagtgcaaaatggggca
ccggcaccagtttcaggtgagaaggatgtggtgtttctgattgacggctctgaaggtgtc
agaagtggcttccctctgctgaaggaatttgtccagagagtagtggagagcctggatgtg
ggcccagatcgggttcgtgtggccgtggtgcagtacagcgaccggaccagacctgagttc
tacctgaattcatacatggaccagcagagtgtggtcaatgccattcgcaggctgaccctc
ctgggagggccaacccccaacaccggggctgccctggactttgtcctgaggaatatcctg
atcagctcagctggaagcaggatagcagaaggtgtcccccagctcctgatcgtcctcacg
gctgacaggtcaggggatgatgtgaggggcccctcggtggtcctgaagaggggaggggca
gtgcccatcggcatcggcatcgggaatgctgacatcacagagatgcagaccatctccttc
atccccgactttgccgtggccattcctaccttccggcagctgggaaccatccagcaggtg
gtctccgacagagtgatccagctcagccgggaagaactgagccggttgcagccagttttg
cttcccccaacgagtccgggtgttggaagcaagaaggatgtggtcttcctcatcgatggg
tcccaaaatgctagccctgaatttcagtacatccgcaccctcattgagagactggttgac
tacctggatgtgggctttgacacgactcgggtggcagtcatccagttcagtgaggacccc
agggtggaattcctgctgaatgcccattccagtaaggatgaagtgcagaatgcggtgaga
cggctgaggcccaaaggtgggaggcagatcaacattgggagtgccctggagtacgtgtca
aggaatatcttcaagaggcccctgggaagcaggattgaggagggcgtccctcagttcctg
gtcctcatctcatctggaaagtctgacgatgaagtagatgattctgcagcagaactcaag
cagtttggtgttgcaccatttaccatcgcaagggacgcagaccaggaacagttggttaag
atctccctgagccctgaatatgtgttctcagtgaacacattccgggagctgcccagcctg
gagcagaaactgctgacccccatcacaaccctaacttcagaacagatacagcagatcctg
gccagcactcgctatccttctccaggtattgagagtgatgcagccgacattatcttccta
atcgatagctctgacagcgtcaagcctgatgacattgcatatattcgggactttattatc
aagattgttcgcagactcaacattggccccaataaagtgaggattggggctgtacagttc
agcaatgaggtcttcccagtattttacctgaagacccataaatctcaggcttccgtgatc
aatgctttgcgtcagctgaggcacagaggggggtccccactgaacaccggcaaagctctg
gaatttgtggcaagaaatctctttgtcaagtctgctgggagccggatagaagacggggtg
ccccaacacctggttctgtttctgggtggaaaatcccaggatgatacttccaggttttcg
caggtgatcagctcctcagggattgtgagtttaggagtaggaaaccgaaatatcgacaga
gcagagctgcagaccatcaccaacaaccccagactggtcttcacggtgcgagagttcaga
gagctccccaacatagaagacagggtcatgcacgcctttgggccctccggggtcacgcct
gcacctccaggagtggacacaccttctccctcacggccagagaaaaagaaagcagatgtt
gtgttcctgttggatggctccatcaatttcaggagggacagtttccaggaagtgctccgt
ttcgtgtctgaaattgtggacacgctgtatgagggcggtgactccatccaggtggggctg
gtccagtacaactctgaccccactgacgagttcttcctgaaggacttttccaccaagcag
cagattattgatgccatcaacaaagtcgtctacaaaggggggagacacgcaaataccaag
gtgggcatcgagcacctgaggctgaatcacttcgtgccggaggcaggcagccgcctggat
cagagggtccctcagatagcgtttgtgatcactggtggaaagtcggtggaggatgcccag
gaggccagcctggcactcacccagaagggtgtcaaagtgtttgccgtgggtgtgaagaac
atcgactcagaggaggttgggaaaatagcgtccaacagtgctacagcgttccgagtgggg
aacgtccaggagctgtctgaattgagcgagcaagttctggaaactctgcacgatgcaatg
catgaaaccttatgtccgggtgtgaccgatatttccaaagtctgtaatctggatgtgatt
ctggggtttgacggatcaagggatcagaatgtctttgtgacccagaagggccttgagtcc
aagatggacaccatcttgaatagaatcagccagatgcaaagaatcagctgcagcggcggc
cagatgcccaccgtgcgggtgtcggtggtggccaacacacccacaggtcctgtggaggcc
tttgactttgccgagtaccagccagaactgtttgagaagttccggaacatgcgcaaccag
cacccctatgtcctcactgcagacacactgaaggtctatcagaacaagttcagacagtct
tcagcagacaatgtaaaggtggtcattcattttacggatggggtggatggaaatctggct
gatttacaaaaggcatctgaggaactccgacaagaaggtgtccaggctctgatcctcgtg
ggccttgaacgtgtagccaacttggagcagctgatgcatttggagttcgggcgaggcttc
ctatacaacaggcccctgaggcttaacttgctggacctcgattatgaactagcagagcag
ctcgacaacatcgctgagaaagcttgctgcggagttccctgcaaatgctccgggcaaaga
ggagaccgcgggcccattggcagcatcgggccaaagggtattcccggggaagatggctat
cgaggttatcctggcgacgagggcggacccggtgagcgcggtcctcctggcgtgaacggc
actcaaggtttccagggctgccccgggcagagaggaataaagggctctcgcggattccca
ggagagaagggtgaattaggagaaatcgggctggacggtctcgacggtgaagacggagac
aaaggattgcccgggtcttctggagagaaagggaatccgggcagaaggggtgacaaagga
cctaaaggcgtcaaaggagagagaggagacgttggctttcgaggtgacccgggtgactca
ggacgggacagtcagcagagaggacccaaaggagaaactggagacatcggccccatgggt
ctccctgggcgagacggggtgtctggaaggcctggagaccccgggaaggacggtggcttt
ggccgaaggggaccagcaggaacgaagggcaacaagggtggcccgggccagccgggctcc
gcgggagagcagggggcccgaggtgcgcagggtccacctggtcccacaggtcctccaggg
ctgatcggtgaacaaggcatttctgggcctcggggaggtggagggaccacaggcgttcct
ggagagcgtggcaggatcggtcccctgggaagaaagggtgagcctggagagccgggacag
aagggaggcatcgggagccggggccctcgaggggagacgggcgacgatggcagagacggg
gttggcagtgaaggacgcaaaggcaaaaaaggagaaagaggattccctggatacccaggt
ccaaagggagtccctggcgagccagggacaggaggaccaccgggacccaaaggcatcaga
ggccgaaggggaaattcaggacctccgggcgcaattgggcagaagggagaccctggctac
ccaggaccatctggtcccaaaggcaacagaggtgactccatggatcaatgtgcccttgtc
cagagcatcaaagataaatgtccttgctgctatgggcccctggaatgccccgtcttcccg
acggagctggcctttgctttagacacctcggagggggtcacccaagacaccttcagccgg
atgagggacgtggtcctgaagctcgtgggcgacctgaccattgccgagagcaactgcccg
cggggggcgcgtgtggccgtggtcacctacaacaacgaggtgaccacggagatccggttt
gccgactccaagaagaagtcagtcctcctggacaagatcaagaaccttcaggtggcgctg
acatccaagcagcagagcctggaaacggccatgtcctttgtggccagaaacacgtttaag
cgagtgagaaacggattcctgatgcgaaaagtggctgttttcttcagcaataagcccacg
agggcctccccacagctcagggaggctgtgctaaagctttcggacgcagggatcacaccc
ttgttcctcacgagccaggaagaccggcagctggtcaacgcgttgcagatcaataacaca
gcagtggggcacgcgctcgtcctacccgctaggagagacctcacggacttcttgaagaat
gtcctgacctgccacgtttgcctggacatctgcaacattgacccggcctgtggatttggc
aactggaagccttccttcagggataggagagcagcaggcagcgatgtggacatcgacatg
gctttcatcttagacagctctgagtccacctctctgttccagttcaatgagatgaagaag
tacatagggtacctggtcaggcagctggacataagccccgaccccaaggcctctcagcac
tttgccagagtggcagttgtgcagcatgcgccctatgagtccctggggaatcccagccta
ccgcccgtgaaggtggagttctccctcactgactatgactccaaggagaagctggtggac
tttctcagcagaagaatgacacagctggaggggaccagggacctgggcagtgccattgaa
tacactatagagaacgtctttgaaagcgcccccaacccacgggacttaaaaatcatagtt
ctgatgctgacaggtgaggtggagaaggagcagctggaagaggcccatagagtcatcttg
caggccaaatgcaagggttatttcttcgtgattctgggcattggcaggaaggtgaacgtc
aaggaggtgtacagcttcgccagtgagccgaatgacgtcttcttcaaactattggataag
ccgactgagcttaacgaagagcctctgatgcgctttgggaggttgttaccatccttcgtt
ggcagtgaaaatgctttttatttgtccccagatatcaggaaacagtgcgattggttccaa
ggggaccaactgacaaagaatcctgtgaagtttggtcacaaacaattaaatactcccaat
aatgctacttcaagtcctacatccaaaccagtgaccacagccaagccagtgaccaccaca
gaaccagtgaccaccacgacgaaaccagtaactgtggtaaacctgccggcctcaaagccg
gccgcagccaagccagccccgcccaaaccggccgccgcgaaacccgtggccgcgagaccc
gtggccgccaagcccgaggtcgccaagcccgaggccacaaagacggccacggtcaaacct
gcagtggcggtgaagccagcggcagcgaagccggtggcagcgaagccagcagctgtgaga
ccccccgctgcagccaggctggtggccgccaagcccgaggcccccaagccccagggagcc
aaaccagccgccaccaagccagccacttcgaaacccgtggctaaggcaacccgagaggtc
cgggtgtccgacatcaccgagaacagcgccaaactgcactgggagaggcccgagcccccc
agtccttacttttacgacctcaccgtcacctcggcccacgaccagtccctggttctgcgg
cagaacctctcggccacggagcgcgccgtcgggggcctgctcgccggccacacgtaccac
gtggcggtggtgtgctacttgcgggcgcaggccagggccgtctaccaaggaagcttcagc
acaaagaaagctcaacctccaccttcacaagcaaggttggcttctagttcaactgtcaat
ctaatggtgagcacggaaccgttggctggcggtgagacagacatatgcaagttgcccaaa
gaagaaggcacgtgcaggaaattcatgttgaaatggtactacgacgtggagacgaaaagc
tgcatgagattctggtacggaggttgcagcggcaacgaaaacagattcgattcacagaaa
gaatgtgaaacggtttgcactcctgcgctcgtcaaccccggggtcatcgctgccatgggg
acctaa

KEGG   Vulpes vulpes (red fox): 112909516
Entry
112909516         CDS       T05911                                 

Gene name
COL6A1
Definition
(RefSeq) collagen alpha-1(VI) chain
  KO
K06238  collagen type VI alpha
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04974  Protein digestion and absorption
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112909516 (COL6A1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112909516 (COL6A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112909516 (COL6A1)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    112909516 (COL6A1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112909516 (COL6A1)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112909516 (COL6A1)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112909516 (COL6A1)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   112909516 (COL6A1)
SSDB
Motif
Pfam: VWA Collagen VWA_2 VWA_3
Other DBs
NCBI-GeneID: 112909516
NCBI-ProteinID: XP_025841262
UniProt: A0A3Q7R778
LinkDB
Position
Unknown
AA seq 1026 aa
MGPGRALLPLLLACWAAAQDAPGSPRAVAFQDCPVDLFFVLDTSESVALRLKPYGALVDK
VKAFTKRFIDNLRDRYYRCDRNLVWNAGALHYSDEVEIISPLAPMPADRDALKAKVDAVK
YFGKGTYTDCAIKKGLEELLVGGSHLKENKYLIVVTDGHPLEGYKEPCGGLEDAVNEAKH
LGVKVFSVAITPDHLEPRLSIIATDHTYRRNFTAADWGQSRDAEEIITQTIDTIVDMIKN
NVEQVCCSFECQPARGPPGPRGDPGYEGERGKPGLPGEKGEAGDPGRPGDLGPIGYQGMK
GEKGSRGEKGSRGSKGYKGEKGKRGIDGVDGMKGEMGYPGLPGCKGSPGFDGAQGPPGPK
GDAGAFGRKGEKGAPGADGEPGRPGNTGPPGDEGEPGLPGPPGEKGEAGDEGNPGPDGAP
GERGGPGERGPRGTPGVRGPRGDPGEAGPQGDQGREGPVGIPGDPGEAGPAGPKGYRGDE
GPPGPEGSRGAPGPAGPPGDPGLMGERGEDGPPGNGTEGFPGFPGYPGSRGPPGINGTKG
YPGLKGDEGEAGDPGDDNNDISPPGVKGAKGYRGPEGPQGPPGHTGPPGPDECEILDIIM
KMCSCCECKCGPIDILFVLDSSESIGLQNFEIAKDFVVKVIDRLSRDELVKFERDQSHVG
VVQYSHNQMQEHVGLRDPNIRSVQELKEAIKKLRWMAGGTFTGEALQYTRNQLLPPTQNN
RIALVITDGRSDTQRDTTPLSVLCGPDIQVVSVGIKDMFGYVAGSDQLNVISCQGLGPQG
RPGISLVKENYAELLEDNFLKNVTTQICIDKKCPDYTCPITFSSPADITILLDGSASVGS
HNFDTTKRFAKRLAERFLTAGRTDPAHDVRVAVVQYSGPGQQRPGRGALRFLQNYTVLAS
TVDGMDFFNDATDVNDALGYVTRFYREASTRDAKKRLLLFSDGNSQGATAAAIEKAVQEA
QRADIEIFVVVVGRQVNEPHVRVLVTGKTAEYDVAFGERHLFRVPSYQALLRGVFYQTVS
RKVALG
NT seq 3081 nt   +upstreamnt  +downstreamnt
atggggccgggccgcgctctgctgccgctgctgctcgcctgctgggccgccgctcaggac
gcgccggggagcccgcgggccgtggccttccaggactgccccgtggacctcttcttcgtg
ctggacacctccgagagcgtggccctgaggctgaagccctatggggccctggtggacaag
gtcaaggcgttcaccaagcgcttcatcgacaacctgagggacaggtactaccggtgtgac
cgcaacttggtgtggaacgcgggcgccctgcactacagcgacgaggtggagatcatcagc
ccgctggcgcccatgcccgccgaccgcgacgccctcaaggccaaggtggacgccgtcaag
tacttcggcaagggcacctacacggactgcgccatcaagaaggggctggaggagctgctt
gtggggggctcccacctcaaggagaacaagtacctgatagtggtgacggacgggcacccc
ctggagggctacaaggagccgtgcggcggcctggaggacgcggtgaacgaggccaagcac
ctgggcgtcaaggtcttctccgtggccatcacgcccgaccacctggagccgcgcctgagc
atcatcgccacggaccacacgtaccggcgcaacttcacggcggccgactgggggcagagc
cgggacgccgaggagatcatcacccagaccatcgacaccatcgtggacatgatcaaaaac
aacgtggagcaagtgtgctgctccttcgaatgccagcccgccagaggacctccagggcca
cggggcgaccccgggtatgagggagaacgtgggaagccgggcctcccaggagagaaagga
gaagccggggaccccggaaggcccggggacctcggacccatcggctaccaggggatgaag
ggagagaaagggagccgaggggagaagggctccagggggtccaagggctacaagggcgag
aagggcaagcgaggcatcgatggcgtggacggcatgaagggggagatgggctaccccggc
ctgccaggctgcaagggctcgcccggattcgacggagctcaaggaccccccgggcccaag
ggtgacgcaggtgccttcggacggaaaggagagaagggtgcccctggagctgatggggag
cccgggaggccggggaacacggggccaccgggagatgagggcgagccggggctgcctggt
ccccccggagagaagggagaagccggcgacgagggaaaccccggaccagacggtgcccct
ggagagaggggcggccctggggaaagaggaccacgggggaccccaggcgtgcggggccca
cggggagacccgggcgaagctggaccccaaggtgaccagggacgagaaggccccgtcggc
atccccggagacccgggcgaggctggccccgctggacctaaaggttaccgaggtgacgag
gggcccccggggcctgagggttccagaggagctcctgggcccgcggggccccccggagac
cccgggctgatgggtgaaaggggcgaagacggccccccgggaaacggcaccgagggcttc
cctggcttccctggctatccgggcagcaggggcccccccgggataaacggcaccaaaggc
tacccaggcctcaagggtgacgagggagaagccggagaccccggagatgataacaacgac
atctccccaccaggagtcaaaggagcaaaggggtaccggggccccgaaggtccccaggga
cccccaggacacacaggacccccgggaccagatgaatgtgagatcctggacatcatcatg
aaaatgtgctcttgctgtgagtgcaagtgcggccccatcgacatcctcttcgtgctggac
agctccgagagcatcggcctgcagaacttcgagatcgccaaggacttcgttgtcaaggtc
atcgaccggctgagcagggacgagctggtcaagttcgagcgtgaccagtcgcacgtgggc
gtggtgcagtacagccacaaccagatgcaggagcacgtgggcctgagggaccccaacatc
aggagcgtccaggagctcaaggaagccatcaagaagctgcggtggatggcgggcggcacg
ttcacgggcgaggctctgcagtacacgcggaaccagctgctgccgcccacccagaacaac
cgcattgccctggtcatcacggacggccgctcggacacccagagggacaccaccccgctc
agcgtgctctgtggcccggacatccaggtggtctccgtgggcatcaaggacatgtttggc
tacgtcgcgggctctgaccagctcaacgtcatctcctgccaaggcctgggaccccagggc
cggccgggcatctctctggtcaaggagaactatgcggagctgctggaggacaattttctg
aagaacgtcaccacccagatctgtatagacaagaagtgtccagattacacctgcccgatc
acgttctcctccccggccgacatcaccatcctgctggacggctcggccagcgtgggcagc
cacaacttcgacaccaccaagcgcttcgccaagcggctggccgagcgcttcctgacggca
ggcaggacggacccggcgcacgacgtgcgggtggcggtggtgcagtacagcgggcccggg
cagcagcggccgggccgcggggcgctgcggttcctgcagaactacaccgtgctggccagc
accgtggacggcatggacttcttcaacgacgccaccgacgtcaacgatgccctgggctac
gtgacgcgcttctaccgcgaggcctcgacccgcgatgccaagaagaggctgctgctcttc
tccgacggcaactcacagggcgccacggcggcggccatcgagaaggcggtgcaggaggcc
cagcgcgcggacatcgagatcttcgtggtggtggtgggccgccaggtgaacgagccccac
gtgcgcgtcctggtcaccggcaagacggccgagtacgacgtggccttcggcgagcgccac
ctgttccgcgtgcccagctaccaggccctgctgcgcggcgtcttctaccagacggtgtcc
aggaaggtggcgctgggctag

KEGG   Vulpes vulpes (red fox): 112909551
Entry
112909551         CDS       T05911                                 

Gene name
COL6A2
Definition
(RefSeq) collagen alpha-2(VI) chain
  KO
K06238  collagen type VI alpha
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04974  Protein digestion and absorption
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112909551 (COL6A2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112909551 (COL6A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112909551 (COL6A2)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    112909551 (COL6A2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112909551 (COL6A2)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112909551 (COL6A2)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112909551 (COL6A2)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   112909551 (COL6A2)
SSDB
Motif
Pfam: VWA Collagen VWA_2 VWA_3
Other DBs
NCBI-GeneID: 112909551
NCBI-ProteinID: XP_025841313
UniProt: A0A3Q7R757
LinkDB
Position
Unknown
AA seq 1388 aa
MAPGSATHPGGTPRSARQHRGPXSRASLHPSHRGDKEGAAGPCSEAGARAEAACDGSRLG
HPPWRDSSLSSAAPWGPGVGAPPGQLSAEADDSAETAARPDGVAHPAQERGSTCSLTPRP
GKLRPHNSIPDSIHLLSNTLGASPGKVPGRAWASAFPQGSSGPRPQACGPSLPAPPLAAE
SGRGSVFLGVWPCSGDPERQRRVCEPSPTFPSSRSRSPQAPGPRPQAPSRAGCKRAAGSG
SLRCPGHVGDSDPPGEAPPPVAAVPGAAGLVLSPRPCPVTARSPPCSVVANARPWRSRFL
SSCRPNARSPRGQRWARTPGHEVWLAGPRTRAPPPRHPAPAEGPGRRDTREGACAAAAPP
CCRTSGRVEKADCPINVYFVLDTSESVTMQSPIDSLLYHMKQFVRQFVKKADCPINVYFV
LDTSESVTMQSPIDSLLYHMKQFVRQFVSQLQDETYLDQVALSWRYGGLHFSDAVRVFSP
PDSDRASFTKSLESIVSIRKGTFTDCALANMTHEVRRLKGKGGAHFAVVVTDGHVTGSPC
GGVKLQAERAREEGVRVFAVAPNLSPNEQGLRDMASVPLELYRNNYATVRSDLDIDQDTV
NRIIKVMKHEAYGECYKVSCLEIPGPPGPKGYRGQKGAKGNMGEPGEPGQKGRQGDPGIE
GPIGFPGPKGVPGFKGEKGEFGADGRKGAPGLAGKNGTDGQKGKLGRIGPPGCKGDPGSR
GPDGYAGEAGSPGEQGDQGTKGDAGRPGRRGPPGDSGAKGSKGYQGNNGSPGSPGVKGAK
GGPGPRGPKGEPGRRGDPGAKGSPGVNGPKGEKGDPGPEGPRGLAGEVGNKGAKGDRGLP
GPRGPQGALGEPGKKGSRGDPGDAGPRGESGQPGPKGDPGRPGFSYPGPRGTPGEKGEPG
PPGPEGGRGDFGAKGDPGRKGEKGEPADPGPPGEPGPRGPRGSPGPEGEPGPPGDPGLTE
CDVMTYVRETCGCCDCEKRCGALDVVFVIDSSESIGYTNFTLEKNFVINVVNRLGAIAKD
PKSETGTRVGVVQYSHEGTFEAIQLDDERIDSLSSFKEAVKNLEWIAGGTWTPSALKFAY
NQLIKESRRQKTRVFAVVITDGRHDPRDDDLNLRALCNHDVTVTAIGIGDMFHERHESEN
LYSIACDKPQQVRNMTLFSDLVAEKFIDDMEDVLCPDPQIVCPDLPCQTELYVAQCTQRP
VDVVFLLDGSERLGEQNFHKARRFVEEVSRRLTLARRDDDPLNARVAMLQFGGPGEQQVE
FPLTSNLTVIHQALENARYLNSFSHVGAGIVHAINQVVHGARAGARRHAELAFVFLTDGV
TGNDSLEEAVHSMRKQNVVPTVVAVGSDVDADVLSKISLGDATAIFREKDYDSLAQPGFF
DRFIRWIC
NT seq 4167 nt   +upstreamnt  +downstreamnt
atggctcccggctcggccacccaccctggagggactcctcgctccgctcggcagcaccgg
ggccctgnctcccgggcatccctgcaccccagccacaggggagacaaggagggggcagca
ggaccctgcagtgaagcaggagcccgggccgaggcagcctgtgatggctcccggctcggc
cacccaccctggagggactcctcgctcagctcggcagcaccctggggccctggggtgggg
gccccccccggacagctgagcgctgaggctgatgacagcgcagaaacagccgccaggccc
gacggcgtggcccatcccgcccaggagaggggctccacttgcagtctgacacccaggccg
gggaagctgcgcccacacaattccatcccagattccatccacctcctctcaaacacatta
ggggcatcaccaggaaaagtgccggggcgtgcctgggcctctgccttcccgcagggctcc
tcaggcccccgaccccaggcctgcgggcccagcctccctgcgcccccactggcagccgag
tccgggcggggcagcgtgttcctcggggtctggccctgctctggggaccccgagaggcag
cgccgcgtgtgtgaaccgagtcccaccttcccctcctcgcggtcccggagcccccaggcc
ccaggccccaggccccaggccccctcccgcgctggttgcaagcgggcagcaggcagcggc
agcctccggtgccctggacacgtcggggacagtgacccgcccggggaggcacccccgccg
gtggcagctgtccctggggcggctggcctggtgctgagcccccgcccctgcccggtcacc
gcccgctcacccccgtgctctgttgtcgccaacgcccgcccctggcgttcccgcttcctc
agctcctgtcggcctaacgcccgcagccccagagggcagaggtgggcgcggaccccgggc
cacgaggtgtggctggcggggccgaggacgagggcgcccccaccgcgtcaccccgccccg
gcggagggcccagggcgccgcgacacccgcgagggcgcttgtgcagcggcggctcctccg
tgttgcaggacgtcggggcgcgtggagaaggccgactgccccatcaacgtgtacttcgtg
ctggacacgtcggagagcgtcaccatgcagtcgcccatcgacagcctgctgtaccacatg
aagcagttcgtgcgccagttcgtgaagaaggccgactgccccatcaacgtgtacttcgtg
ctggacacgtcggagagcgtcaccatgcagtcgcccatcgacagcctgctgtaccacatg
aagcagttcgtgcgccagttcgtgagccagctgcaggacgagacctacctggaccaggtg
gccctgagctggcgctacggcggcctgcacttctcggacgcggtgcgcgtgttcagcccg
cccgacagcgaccgcgcctccttcaccaagagcctggagagcatcgtctccatccgcaag
ggcaccttcaccgactgcgcgctggccaacatgacgcacgaggtgcggcggctcaagggc
aagggcggcgcgcacttcgcggtcgtggtcaccgacggccacgtcaccggcagcccgtgc
ggcggcgtcaagctgcaggccgagcgggcccgcgaggagggcgtccgggtcttcgccgtc
gcccccaacctgagccccaacgagcaggggctgcgggacatggccagcgtgcccctggag
ctctaccgcaacaactacgccacggtgcgctccgacctggacatcgaccaggacacggtc
aaccgcatcatcaaggtcatgaaacacgaagcctacggagagtgctacaaggtgagctgt
ctggagatccccgggccccccggccccaagggctaccgcggacagaagggcgccaagggc
aacatgggcgagccaggagaacccgggcagaagggtcgccagggagatcccggcatcgaa
ggccccattggcttcccaggacccaagggtgttcctggcttcaaaggagagaagggtgaa
tttggagccgacgggcggaagggggcccccggcctggccggcaagaacgggaccgacgga
cagaagggcaagctggggcgcatcgggcctcctggctgcaagggcgaccctgggagccgg
ggacccgacggatacgcaggggaagccggcagccccggggagcaaggggaccagggcacc
aagggagacgccggccgcccgggacgcaggggccccccaggagacagcggggccaaagga
agcaaggggtatcaaggcaacaacgggtccccaggaagccccggcgtgaaaggagccaag
gggggacctgggccccgaggacccaaaggcgagccagggcgcaggggggacccaggagcc
aagggcagcccgggcgtcaacggccccaagggtgagaagggagaccctggcccggagggt
ccccggggtctggctggagaggtggggaacaaaggagctaagggagaccgaggcttgcca
ggacccaggggcccccagggggctctcggggagccggggaagaagggatctcggggagac
cccggtgacgccggtccccgtggagagtcaggacagcctggtcccaagggagaccccggc
aggcctggattcagctacccgggaccccgaggaacacccggagagaaaggcgagcctggc
cctcctggccccgagggaggcagaggtgactttggtgccaaaggagatccagggaggaag
ggcgagaagggcgagcccgcagatcctggtccccctggcgagccaggccctcgcggccca
agaggatccccaggacccgagggagagcccggtcccccgggagaccccggcctcacggag
tgtgacgtcatgacctacgtgagggagacgtgcgggtgctgcgactgcgagaagcggtgt
ggcgccctggacgtggtgttcgtcatcgacagctccgagagcatcggctacaccaacttc
acgctggagaagaacttcgtcatcaacgtggtcaacaggctgggggccatcgccaaggac
cccaagtcagagaccgggacccgtgtgggcgtggtgcagtacagccacgagggcaccttc
gaggccatccagctggacgacgagcgcatcgactcgctgtccagcttcaaggaggccgtc
aagaacctggagtggatcgccggcggcacctggacgccctcggccctcaagttcgcctac
aaccagctcatcaaggagagccggcgccagaagacccgcgtgttcgcggtggtcatcacg
gacggccgccacgacccccgggacgacgacctcaacctgcgggcgctgtgcaaccacgac
gtcacggtgacggccatcggcatcggcgacatgttccacgagaggcacgagagcgagaac
ctctactccatcgcctgcgacaagccgcagcaggtgcggaacatgacccttttctctgat
ctggtggccgagaagttcatcgacgacatggaggacgtcctttgcccagaccctcagatc
gtgtgcccggaccttccctgccaaacagagctgtacgtggcgcagtgcacgcagcggccc
gtggacgtcgtcttcctgctggacggctcggagcggctgggcgagcagaacttccacaag
gcgcggcgcttcgtggaggaggtgtcccggcggctgacgctggcgcgcagggacgacgac
ccgctcaacgcccgcgtggccatgctgcagttcgggggccccggcgagcagcaggtggag
ttcccgctcacgtccaacctcacggtcatccaccaggcgctggagaacgcgcgctacctc
aactccttctcgcacgtgggcgcgggcatcgtgcacgccatcaaccaggtggtgcacggc
gcccgggccggggcacgccgccacgccgagctggccttcgtgttcctcaccgacggcgtc
acaggcaacgacagcctggaggaggcggtgcactccatgcgcaagcagaacgtggtgccc
accgtggtggccgtgggcagcgacgtggacgcggacgtgctgtccaagatcagcctgggt
gacgccactgccatcttccgtgagaaggactatgacagcctggcgcagcccggcttcttc
gacaggttcatccgctggatctgctag

KEGG   Vulpes vulpes (red fox): 112909799
Entry
112909799         CDS       T05911                                 

Definition
(RefSeq) basic proline-rich protein-like
  KO
K06237  collagen type IV alpha
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04926  Relaxin signaling pathway
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04974  Protein digestion and absorption
vvp05146  Amoebiasis
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112909799
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112909799
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112909799
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112909799
  09154 Digestive system
   04974 Protein digestion and absorption
    112909799
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112909799
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112909799
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112909799
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112909799
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112909799
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   112909799
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112909799
SSDB
Other DBs
NCBI-GeneID: 112909799
NCBI-ProteinID: XP_025841660
UniProt: A0A3Q7SIK8
LinkDB
Position
Unknown
AA seq 891 aa
MCQACRTRRHHLAPSRSPAAFPGSPICSRHTGPQALGYPDVPGLPHPPPPSGSIPLPRGL
PGLTPLDPPSTHFSICSRHTGPQALGYPDVPGLPHPPPPSGSIPLPRGLPGLTPLDPPST
HFSICSRHTGPQALGYPDVPGLPHPPPPSGSIPLPRGLPGLTPLDPPSTHFSICSRHTGP
QALGYPDVPGLPHPPPPSDPIPLCRGLPGLTPLDPPSTHFSICSHHTGPQALGYPDVPGL
SHPPPPSGPIPLPRGLPGLTVGPDLRRVPSIPLRVHPSPPLSPWTLPSAYLRVCSRHTRP
QALGYPDVPGLSHPPPPSGPIPRPRGLPGLTPRDPPSAPLSVCSRHTGPQALGYPDVPGL
PHPPPPSDPIPLCRGLPGLTVGPELRRVPSIPLGVHPSPPLSPWALPSALSICSRHTRPQ
ALGYPDVPGLPHPPPPSGPIPLPRGLPGLTVGNDLRRVPSIPLRVHPSPPLSPWTLPSAY
LRVCSRHTGPQALGYPDVPGLPHPPPPSGPIPLPRGLPGLTVGNDLRRVPSIPLRVHPSP
PLSPWTLPSAYLRVCSRHTGPQALGYPDVPGLPHPPPPSGPIPLPLGLPGLTVGNDLRRV
PSIPLRVHPSPPLSPWTLPSAYLRVCSRHTGPQALGYPDVPGLPHPPPPSGPIPLPLGLP
GLTVGNDLRRVPSIPLRGLLPXLRRSPLSPSGSVHPSPPLSPWTLPSAYLRVCSRHTRPQ
ALGPQALGYPDVPGLPHPPPPSGPIPLPRGLPGLTPRDPPSNHLSVSSCHSRPQAPGYPD
VPGLPHPPPPSGPIPLPRGLPGLTAPSAPPPRPAALRGPSPAALQGRPPPSLRGPSRGYL
LPGCRRPGPGLLPGDPSATPRTEAFRALSILTQRSAHVTSHPDPVARGPHG
NT seq 2676 nt   +upstreamnt  +downstreamnt
atgtgccaggcctgccgcacccgccgccaccatctggctccatcccgctcccccgcggcc
ttcccgggctcacccatctgctcccgccacaccgggcctcaggctctcgggtacccggat
gtgccaggcctgccgcacccgccgccaccatctggctccatcccgctcccccgcggcctt
cccgggctcacccccctggaccctccctccacccacttcagcatctgctcccgccacacc
gggcctcaggctctcgggtacccggatgtgccaggcctgccgcacccgccgccaccatct
ggctccatcccgctcccccgcggccttcccgggctcacccccctggaccctccctccacc
cacttcagcatctgctcccgccacaccgggcctcaggctctcgggtacccggatgtgcca
ggcctgccgcacccgccgccaccatctggctccatcccgctcccccgcggccttcccggg
ctcacccccctggaccctccctccacccacttcagcatctgctcccgccacaccgggcct
caggctctcgggtacccggatgtgccaggcctgccgcacccgccaccaccatccgacccc
atcccgctatgccgcggccttcccgggctgacccccctggaccctccctccacccacttc
agcatctgctcccaccacaccgggcctcaggctctcgggtacccggatgtaccaggcctg
tcgcacccgccgccaccatctggccccatcccgctcccccgcggccttcccgggctcacc
gtgggccctgacctccgccgggtcccctctatccccctcagggtccatccctcacctccc
cttagcccctggaccctcccctccgcctacctcagggtctgctcccgccacaccaggcct
caggctctcgggtacccggatgtgccaggcctgtcgcacccgccgccaccatctggcccc
atcccgcgcccccgcggccttcccgggctcaccccccgggaccctccctccgcccccctc
agcgtctgctcccgccacactgggcctcaggctctcgggtacccggatgtgccaggcctg
ccgcacccgccaccaccatccgaccccatcccgctatgccgtggccttcccgggctgacc
gtgggccctgaactccgccgtgtcccctctatccccctcggggtccatccctcgcctccc
cttagcccctgggccctcccctccgccctcagcatctgctcccgccacaccaggcctcag
gctctcgggtacccggatgtgccaggcctgccgcacccgccgccaccatctggccccatc
ccgctcccccgcggccttcccgggctcaccgtgggcaatgacctccgccgtgtcccctct
atccccctcagggtccatccctcacctccccttagcccctggaccctcccctccgcctac
ctcagggtctgctcccgccacaccgggcctcaggctctcgggtacccagatgtaccaggc
ctgccgcacccgccgccaccatctggccccatcccactcccccgcggccttcccgggctc
accgtgggcaatgacctccgccgtgtcccctctatccccctcagggtccatccctcacct
ccccttagcccctggaccctcccctccgcctacctcagggtctgctcccgccacaccggg
cctcaggctctcgggtacccagatgtaccaggcctgccgcacccgccgccaccatctggc
cccatcccactccccctcggccttcccgggctcaccgtgggcaatgacctccgccgtgtc
ccctctatccccctcagggtccatccctcacctccccttagcccctggaccctcccctcc
gcctacctcagggtctgctcccgccacaccgggcctcaggctctcgggtacccagatgta
ccaggcctgccgcacccgccgccaccatctggccccatcccactccccctcggccttccc
gggctcaccgtgggcaatgacctccgccgtgtcccctctatccccctcaggggtctgctc
ccgcnactccgccggtcccctctgtccccctcggggtcggtccatccctcgcctcccctt
agcccctggaccctcccctccgcctacctcagggtctgctcccgccacaccaggcctcag
gctctcgggcctcaggctctggggtacccggatgtgccaggcctgccgcacccgccacca
ccatccggccccatcccgctcccccgcggccttcccgggctgaccccccgcgaccctccc
tccaaccacctcagcgtcagctcctgccacagcaggccccaggctcctgggtacccggat
gtgccaggcctgccgcacccgccgccaccatccggccccatcccgctcccccgcggcctt
cccgggctgaccgccccctccgcgccccctccgcgccccgccgccctccggggcccctcc
cctgccgccctccagggccgccccccgccctccctccggggcccctcccggggctacctg
ctgcctggctgccgccggcccgggcctggcctccttccaggggaccccagtgcgaccccc
cgcaccgaggccttccgcgctctctcaattctgacgcagaggtcggcccacgtcacatca
caccctgaccccgttgccaggggtccccacggctga

KEGG   Vulpes vulpes (red fox): 112911607
Entry
112911607         CDS       T05911                                 

Gene name
LAMB2
Definition
(RefSeq) laminin subunit beta-2 isoform X1
  KO
K06243  laminin, beta 2
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp05145  Toxoplasmosis
vvp05146  Amoebiasis
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112911607 (LAMB2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112911607 (LAMB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112911607 (LAMB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112911607 (LAMB2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112911607 (LAMB2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112911607 (LAMB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112911607 (LAMB2)
   05145 Toxoplasmosis
    112911607 (LAMB2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N F5_F8_type_C
Other DBs
NCBI-GeneID: 112911607
NCBI-ProteinID: XP_025844030
UniProt: A0A3Q7SPJ9
LinkDB
Position
Unknown
AA seq 1882 aa
MVCTPAQDPLHAFLLAVLLNFAQSRRTQLVEGPPLAGGLSGKSTLDLLRLGLHGTPRAGG
GGGHGLQTLIPPLICIPFLFRMERAPGERGRDLRGQPGPWELHVGLLLSVLATALAQALA
PDMPGCSRGSCYPATGDLLVGRADRLTASSTCGLHGPQPYCIVSHLQDEKKCFLCDSRRP
FSARDNPNSHRIQNVVTSFAPQRRAAWWQSENGVPVVTIQLDLEAEFHFTHLIMTFKTFR
PAAMLVERSADFGRTWHVYRYFSYDCGADFPGVPLAPPRYWDDIVCESRYSEIEPSTEGE
VIYRVLDPAIPIPDPYSPRIQNLLKITNLRVNLTRLHTLGDNLLDPRREIREKYYYALYE
LVVRGNCFCYGHASQCAPAPGAPAHAEGMVHGACVCKHNTRGLNCEQCQDFYHDLPWRPA
EDGHSHACRKCECHGHAHSCHFDMAIYLASGNVSGGVCDGCQHNTAGRHCELCRPFFYRD
PSKDLRDPAMCRSCDCDPMGSQDGGRCDPHDDPALGLVSGQCRCKEHVVGSRCQQCRDGF
FGLSASDPAGCRRCQCDARGTVPGTTSCDPNSGTCFCKRLVTGRGCNHCLPGHWGLSHDL
LGCRPCDCDVGGALDPQCSEATGQCHCRQHMVGRRCEQVQPGYFRPFLDHLTWEAEDTRG
QVLDVVERLVTSSGTPSWTGRGFVRLQEGQALEFLVGPVPRAMDYDLLLRLEPQVPKQWA
EMEVTVQRPGPVSAHSLCGHVLPKDDHIPGTLQPETRYMVFPRPVCLEPGISYKLLLKLV
RTGGSAQTEAPYSGPSLLIDSLVLLPRVLVLEMFSGGDAAALERRATFERYRCHEEGLVP
SKTLPSEACAPLLISLSTLLYNGALPCQCDPQGSLSSECNPHGGQCVCKPAVVGRRCDHC
APGFYGFGPTGCQACQCSPEGALSGLCEETSGQCPCRTGAFGLRCDRCQRGQWGFPSCQP
CVCNGHADECDTHTGACLGCRDHTGGEHCERCIAGFHGDPRLPYGGQCRPCPCPEGPGSQ
RHFATSCHRDGYSQQIMCHCRAGYTGLRCEACAPGHFGDPSRPGGQCQPCECSGNIDPMD
PDACDPRTGQCLRCLHHTEGPHCAHCKPGFHGQAARQSCHRCTCNLLGTDPQQCPSIDRC
NCDPSSGQCPCLPNVQGPTCDRCAPNFWNLTSGHGCQPCACHPSRARGPTCNEFTGQCHC
RAGFGGRTCSECQELHWGDPGLQCRACDCDPHGIDTPQCHRSTGHCSCRPGVSGVRCDQC
ARGFSGVFPACHPCHTCFGDWDRVVQDLAARTRRLEQRVQDLQQTGVLGAFESSFWRIQE
KLGTVQGIVGARNTSAASTAQLVEATEELRREIGEATEHLTQLEAELTDVQDENFNANHA
LSSLERDGLALNLTLRQLDQHLDLLKHSNFLGAYDSIRHAHSLSAEAEHRANTSALTVPS
PVSNSADTRHHTEMLMSAQREDFNRKHKANQQALGKLSARTHSLSLTAINELVCGPPGDA
PCATSPCGGAGCLDEDGQPRCGGLGCNGAVAMADLALGRARHTQAELQRALAEGGGILSQ
VAETRRQAGEAQQRAQAALDKANASRGQVEKANQELRELIQSVKDFLSQEGADPDSIEMV
ATRVLELSIPASPEQIQHLAGAIAERVRSLADVDTILARTVGDVRRAEQLLQDARRARSR
AEGEKQKAETVQAALEEAQRAQGAAQGAIQGAVVDTQDTERTLHQVQAKMAGAEQALSSA
GKRAQELDGLLEALKLKRAGNSLAASSAEETAGSAQGRAREAEQLLQGPLGDQYQTVKAL
AERKAQGVLAAQVRAEQLRDEARGLLQAAQDKLQRLQELEGTYEENERALEGKAAQLDGL
EARMRSVLQAINLQVQIYNTCQ
NT seq 5649 nt   +upstreamnt  +downstreamnt
atggtatgtactcctgcccaagatccactccatgctttccttcttgccgtgcttctcaac
tttgctcaaagtcgcaggactcagctagtggagggaccgccgctggctggaggattgagt
gggaaatcaaccctggacttactccggctgggtctgcatggcaccccaagggcggggggg
ggaggtgggcacgggctccagactcttatcccccccctcatctgtattcccttcctcttc
aggatggagcgggccccaggggaacgagggagggacctgcggggacagcctgggccctgg
gagcttcatgtgggcctactgttgagtgtgctggccactgccctggcccaggccctggcc
ccggatatgccaggctgttcgaggggaagctgctaccctgccacaggtgacttgctagtg
ggccgtgctgacagactgactgcctcatccacctgtggcttacatggcccccaaccttac
tgcatcgttagtcacctacaggatgagaagaagtgcttcctgtgtgactcccggcgcccc
ttctctgccagagacaacccaaacagccatcgcatccagaatgtagttaccagctttgca
ccacagcgccgggcagcctggtggcagtcagagaatggtgtccccgtggtcaccatccag
ctggacttggaggctgagtttcatttcacgcacctcattatgaccttcaagacgtttcgt
cctgctgccatgctggtggaacgctcagctgactttggacgcacctggcatgtgtaccga
tatttttcctatgactgtggggctgactttccaggagtcccactggccccaccacgatac
tgggatgacatagtttgtgagtcccgctactcagagattgagccatccactgaaggcgag
gtcatctatcgggtgctggatcctgccatccctatcccagacccctatagcccacggatc
cagaacctgctgaagatcaccaacctacgggtgaacctgacacggctacatacgctggga
gacaacctgcttgacccacggcgggagattcgtgagaaatactattatgccctttacgag
ctggttgttcgaggcaactgcttctgttatggacacgcctcacagtgtgcacctgcccca
ggagcaccagcccatgctgagggcatggttcatggggcctgcgtctgcaaacacaacact
cgaggcctcaactgtgagcagtgtcaggatttctatcatgacttgccctggcgtccagct
gaggatggccacagtcatgcctgcaggaaatgtgagtgccatgggcatgcacacagctgc
cactttgatatggccatatacctggcatctggcaacgtgagtggaggcgtgtgtgatgga
tgtcagcacaatacagctgggcgccactgtgagctctgccgacccttcttctaccgtgat
ccaagcaaggacctgcgggacccagctatgtgtcgctcctgtgattgtgaccccatgggt
tcccaagatggtggtcgctgcgatccccatgatgatcctgccctggggctggtttcgggc
cagtgtcgctgcaaagaacatgtggtgggctctcgctgccagcaatgtcgtgatggcttc
tttggacttagtgccagtgaccctgcaggctgccggcggtgccagtgtgatgcacgaggc
acagtgcctgggaccacctcttgtgaccccaacagtggaacctgtttctgcaagcgtcta
gtgactggacgtggctgcaaccactgcctgcctggccactggggcctgagccatgacctg
cttggctgtcgtccttgtgattgcgacgtgggcggtgccttggatccccagtgcagtgag
gccacaggtcagtgccactgtcgccagcacatggtggggcgacgctgtgagcaggtgcag
cctggctatttccggcctttccttgatcacctaacttgggaggctgaggatacccgagga
caggtgcttgatgtggtggagcgcttggtgacttccagtgggactccatcctggaccggc
cggggctttgttaggctgcaggagggtcaggcactggagtttctggtgggccctgtgccg
agagccatggactacgacctgctgttgcgcttggaacctcaggtccccaagcaatgggca
gagatggaagtgaccgtgcagcgcccagggcctgtgtctgcccacagcctatgtgggcat
gtgctgcccaaggatgaccacatcccagggactctgcaaccagaaaccaggtatatggtg
tttcccagacctgtctgtcttgagcctggcatctcctacaagctgcttctgaagttggtg
cgaacagggggaagtgctcagaccgaggctccctactctggacccagtctgctcattgac
tcgctggtgctgctgccccgtgtcctggtgctagagatgtttagtgggggtgatgctgct
gccctggagcgccgtgccacctttgaacgctaccgttgccatgaggagggtctggtgcct
agcaagacccttccctctgaggcctgcgctcccctccttatcagtctgtccaccctcctc
tacaatggtgccttgccctgtcagtgtgacccccagggctcactaagttctgagtgcaat
cctcatggcggtcagtgcgtgtgtaaacctgcagtggtggggcgccgctgtgatcactgt
gcccctggcttctacggctttggtcccacaggctgtcaagcctgccagtgtagccctgag
ggggcactcagtggcctatgtgaagagaccagtgggcagtgcccctgccgaactggtgcc
tttgggcttcgctgtgatcgctgccagcgtggccagtggggattccctagctgccagcca
tgtgtctgcaatgggcatgccgacgaatgtgacacccacacaggcgcttgcctgggctgc
cgtgatcacacagggggtgagcactgtgaaaggtgcattgctggcttccatggggaccca
aggctaccatacgggggtcagtgccggccctgtccctgccctgaaggccctgggagccag
cgtcactttgctacttcttgccatcgggatgggtactcccagcagatcatgtgccactgt
agggcagggtacacagggctacggtgtgaagcttgtgcccctggacactttggggaccca
tcaaggccaggtggccagtgccaaccgtgtgagtgcagtggaaacattgaccctatggac
cctgatgcctgtgatccccgcacggggcagtgcctgcgctgcttacaccacacggagggg
ccacactgtgcccactgcaagcctggcttccatgggcaggctgcccgacagagctgtcac
cgctgtacctgcaacttgctgggaacagatccccagcagtgcccgtccattgatcgctgc
aactgtgacccaagcagtgggcagtgcccatgcctccccaatgtccagggccctacctgt
gaccgctgtgctcccaacttctggaaccttactagtggccacggctgccagccctgtgcc
tgtcatccaagccgagccagaggccccacctgcaatgagttcacagggcagtgccactgc
cgtgctggctttggtgggcgaacctgttctgaatgccaggagctccactggggagaccct
gggttgcagtgtcgtgcctgtgattgtgaccctcatggaatagacacacctcagtgtcac
cgctctacaggtcactgcagctgccgcccaggagtgtctggcgtgcgctgtgaccagtgt
gctcgtggcttttccggggtctttcctgcctgccacccatgtcacacatgcttcggggac
tgggaccgtgtggtacaggatttggcggcccgtacacggcgcctggagcagcgggtgcag
gatttacaacagactggtgtgctgggtgcctttgagagcagcttctggcgcatccaggag
aagctggggactgtgcaggggatcgtgggtgcccgcaacacctcagctgcctccactgca
cagctcgtggaggccacagaggagctgcggcgtgaaattggagaggccactgagcacctg
acccagctagaagcagaactgacagatgtgcaggatgagaacttcaatgccaaccatgca
cttagcagtctggagcgagatgggcttgcgcttaatctcacgctgaggcagctggaccag
catctggacctgctcaagcattcaaatttcctgggtgcctatgacagcatccgccacgcc
cacagtctctctgcagaggcagaacatcgtgccaacacatcagctttgacagtgcctagc
cctgtgagcaactcagcagatactcggcaccatacagagatgctaatgagtgcccagagg
gaggacttcaaccgcaaacacaaggccaaccagcaggcactaggcaaactctctgcccgt
acccactccctgagcctgacagccataaatgaactggtgtgtggacccccaggggatgca
ccctgtgctacaagcccttgcgggggtgctggctgtctggatgaggatgggcagccccgc
tgtgggggcctcggctgcaatggggcagtagccatggcggacctggcactgggtcgggcc
cggcacacacaggcagagttgcagcgggcactggcagaaggtggaggcatcctcagccag
gtggctgagacccgtcggcaagcaggcgaggcacagcaacgggcccaggcagccctggac
aaagctaatgcttccagaggacaggtggagaaggccaaccaagaacttcgggaacttatc
cagagtgtgaaggacttcctcagccaggagggggctgatcccgatagcattgagatggtg
gccacaagagtgctagagctctccatcccagcatcacctgagcagattcagcacctggca
ggtgcaattgcagagagagtccggagcctggcagatgtggacacaatcctggcgcgtacc
gtgggagatgtgcgtcgggcagagcagctactacaagatgcacggcgggcaaggagccgg
gctgagggtgagaagcagaaggcagaaacagtacaggcagcactggaggaagcccagagg
gcacagggtgctgctcagggcgccatccagggggcagtagttgacacacaggacacagag
cggaccctgcaccaggtgcaggcgaagatggcaggtgcagagcaggcactgagctctgca
ggcaagcgggctcaagaattggatggtctcctggaggctctgaaattgaaacgagcaggg
aatagcctggcagcctctagtgctgaagaaacagcaggcagtgcccagggtcgtgcccgg
gaggctgagcagctgctgcagggcccactaggcgaccagtaccagacagtgaaggccttg
gctgagcgcaaggcccagggtgtgctggctgcacaggtgcgggcagaacaacttcgggat
gaagctcgtggcttgttgcaggctgcgcaggacaagctgcaacggctgcaagagctggaa
ggcacctatgaggagaacgagcgggcactggaaggcaaagcagcccaattggatgggctg
gaggccaggatgcgtagtgtgcttcaagccatcaacttgcaggtccagatctacaacacc
tgccagtga

KEGG   Vulpes vulpes (red fox): 112913266
Entry
112913266         CDS       T05911                                 

Gene name
COMP
Definition
(RefSeq) cartilage oligomeric matrix protein
  KO
K04659  thrombospondin 2/3/4/5
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04145  Phagosome
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp05144  Malaria
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112913266 (COMP)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112913266 (COMP)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112913266 (COMP)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112913266 (COMP)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112913266 (COMP)
  09174 Infectious disease: parasitic
   05144 Malaria
    112913266 (COMP)
Membrane trafficking [BR:vvp04131]
 Endocytosis
  Phagocytosis
   Opsonins
    112913266 (COMP)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112913266 (COMP)
  Exosomal proteins of colorectal cancer cells
   112913266 (COMP)
  Exosomal proteins of bladder cancer cells
   112913266 (COMP)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112913266 (COMP)
Domain-containing proteins not elsewhere classified [BR:vvp04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   112913266 (COMP)
SSDB
Motif
Pfam: TSP_C TSP_3 EGF_CA COMP EGF_3 cEGF EGF_MSP1_1 hEGF
Other DBs
NCBI-GeneID: 112913266
NCBI-ProteinID: XP_025845634
UniProt: A0A3Q7RIX5
LinkDB
Position
Unknown
AA seq 756 aa
MVPAAACVLLLTLAALGVSGQGQIPLGADLGPQMLRELQETNAALQDVRELLRQQVKEIT
FLKNTVMECDACGMQPARTPGLSVRPLSQCAPGFCYPGVVCTQTASGARCGPCPAGFTGN
GSHCVDVNECNAHPCFPRVRCINTKPGFRCEACPPGYSGPAHEGVGLAFAKANKQVCTDI
NECETGQHNCVPNSVCVNTRGSFQCGPCQPGFVGDQASGCQRRSQRFCPDGTPSPCHEKA
DCILERDGSRSCVCAVGWAGNGLLCGRDTDLDGFPDEKLRCSERQCRKDNCVTVPNSGQE
DVDRDGIGDACDPDADGDGVLNEQDNCKLVRNPDQRNADGDKWGDACDNCRSQKNDDQKD
TDQDGKGDACDDDIDGDRIRNTVDNCPRVPNSDQKDSDGDGVGDACDNCPQKSNADQRDV
DHDFVGDACDSDQDQDGDGHQDSRDNCPTVPNSAQQDSDHDGQGDACDDDDDNDGVPDSR
DNCRLVPNPNQEDVDRDGVGDACQGDFDADKVVDKIDVCPENAEVTLTDFRAFQTVVLDP
EGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTVTDDDYAGFIF
GYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALWHTGDTA
SQVRLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDTTMRGGR
LGVFCFSQENIIWANLRYRCNDTIPEDYETQRLLQA
NT seq 2271 nt   +upstreamnt  +downstreamnt
atggttcctgccgccgcctgcgttctcctgctcaccctggccgccctgggcgtgtcgggt
cagggccagataccactaggtgcagatctaggaccgcagatgcttcgggaacttcaggag
accaacgcggcgctgcaggatgtgcgggagctgctgcggcagcaggtcaaggagatcacg
tttctgaaaaacacagtgatggagtgcgacgcgtgcgggatgcagcccgcgcgcaccccg
gggctgagcgtgcggcccctatcccagtgcgcgcccggcttctgctaccccggcgtggtc
tgcactcagaccgcaagcggcgcgcgctgtggcccctgccccgcgggcttcaccggcaat
ggctcgcactgcgtcgacgtcaacgagtgcaacgcccatccctgcttcccccgcgtccgc
tgcatcaacaccaaacccggcttccgctgcgaggcttgcccgccggggtacagcggcccc
gcccacgagggcgtggggctggccttcgccaaggccaacaagcaggtttgcacggacatt
aacgagtgtgagaccgggcagcataactgcgtccccaactccgtgtgcgtcaacacccgg
ggctccttccagtgcggcccttgccagcccggcttcgtgggcgaccaggcgtctggctgc
cagcggcgctcgcagcgcttctgccccgacggcacgcccagcccgtgccacgagaaggcc
gactgcatcctggaacgcgacggctcgcgatcgtgcgtgtgcgccgttggctgggcaggc
aacgggctcctctgcggccgcgacacggatttggacggcttccccgacgagaagctccgc
tgctcagaacgccagtgccgcaaggacaactgtgtgacggtgcccaactcagggcaagag
gacgtggatcgcgacggcatcggagacgcctgcgacccggatgctgatggggacggggtc
ctcaacgagcaggacaactgtaagctggtgcggaacccagaccaacgcaatgcggacggc
gacaagtggggtgatgcttgcgacaactgccggtcccagaagaacgacgaccagaaggac
acagatcaggacggcaaaggcgacgcctgcgacgacgacatcgacggcgaccggatccga
aatacggtggacaactgcccaagggtacccaactcagaccagaaggacagtgatggtgac
ggtgtaggagatgcctgtgacaactgtccccagaaaagcaacgcagaccagagggatgta
gaccacgactttgtgggagacgcttgtgacagcgaccaagaccaggatggggatgggcac
caggactcacgggacaactgccctacagtaccgaatagtgcccagcaggactcagaccac
gatggccagggtgacgcctgcgatgacgacgatgacaatgacggagtccccgacagtcgg
gacaactgtcgccttgtgcccaacccaaaccaggaagatgtagaccgggacggtgtgggc
gatgcgtgccagggcgacttcgacgccgataaggtggtggacaagatcgatgtgtgtccg
gagaatgccgaggtcaccctcaccgacttccgggccttccagactgtcgtactggacccc
gagggcgatgcgcagattgatcccaactgggtggtgctcaaccagggtatggagatcgtg
cagaccatgaacagcgaccccggcctggctgtgggttacacggccttcaacggcgtggac
ttcgaaggcacgttccacgtgaacacagtcacagatgatgactatgctggcttcattttt
ggctaccaggacagctccagcttctacgtggttatgtggaaacagatggagcagacatac
tggcaggcgaatcccttcagggcggtagctgaacctggcattcagctcaaggctgtgaag
tcctccacaggccccggggagcagctgcggaatgcactctggcacacaggggacacagca
tcacaggtgcggctgctgtggaaggacccccgcaatgtgggttggaaggacaagacatcc
taccgctggttcctgcagcatcggccccaagtgggctacatcagagtgcgtttctacgag
ggtcctgagctggtggccgacagcaacgtggtcctggacacaaccatgcggggtggccgc
ctgggggtcttttgcttctcccaagagaacatcatctgggccaatctgcgctaccggtgc
aatgacaccataccagaggactacgagactcagaggcttctgcaggcctag

KEGG   Vulpes vulpes (red fox): 112913632
Entry
112913632         CDS       T05911                                 

Gene name
TNXB
Definition
(RefSeq) tenascin-X isoform X1
  KO
K06252  tenascin
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp05165  Human papillomavirus infection
vvp05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112913632 (TNXB)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112913632 (TNXB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112913632 (TNXB)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    112913632 (TNXB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112913632 (TNXB)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112913632 (TNXB)
SSDB
Motif
Pfam: fn3 Fibrinogen_C
Other DBs
NCBI-GeneID: 112913632
NCBI-ProteinID: XP_025846286
UniProt: A0A3Q7RW39
LinkDB
Position
Unknown
AA seq 1243 aa
MKPPSLCLLSGPQDEVEETPSPTEPITEAPEPPKEPLLGELTVTGSSPDSLSLSWTVPQG
HFDSFTVQYKDRDGRPQVVRVPGDESEVTVGGLEPGRKYKMHLYGLDRGRRVGPVSTVGL
TEYEAVTTQAPSTMSSEPPIKPHLGELAVTKATPNSLHLSWTIPEGQFDHFLVQYKNGDG
QPKAVRVPGHEDGVTISGLEPDHKYKMNLYGFHGGQRMGPISAIGVTAAEEETPTPTEVE
ETPSPPEPSTEAPEPPKEPLLGELTVTGSSPDSLSLSWTIPQGHFDSFTVQYKDRDGRPQ
VVRVPGDESEVTVGGLEPGRKYKMHLYGLDRGRRVGPVSTVGLTGPDTKPPSLGELTVTD
VTPDSISLSWTVPEGEFDSFVVQYKDRDGQPRGVPVAADQREVTIPGLEPSRKYRFLLYG
LAGRKRLGPISADSSTAPLEKEQQHPPRLGELTVIDETPNSLSLSWTVAQGLFDSFVVQY
RDPAGQPRAVPVAKDQRDVTIQGLEPGRKYKFLLYGIHGRQHLGPISVLGVTAPEADTPA
PWSPATEAPEPPEGPHLRTLAVSDITPDSLHLLWNVAQGPFDSFVVQYQDTDGQPQALLV
GGNQNKVLVSGLEPSTSYQFFLYGLHGGKRLGPISAEGTTGPAPAGLTPGEPGPRLSQLS
VTDVTTSSLRLNWEAPSEAFDSFLLRFGVPSPSTLEPHSRPLLQRELTVPGTQRSAVLRD
LHPGTLYSLTLYGLRGPHKADSIQGTARTLSPVLESPRDLQFREIRETSAQVSWMPPPSR
VDSFKVSYQLADGGEPQSVQVDGQARTQKLQGLMPGSHYEVTVVSVRGFEESEPLTGYLT
TVPDGPTQLRALNLTEGSALLHWKPPQAPVDTYNIRVTAPGDPPLQASAPGSAVEYPLGG
LRLHTNYTATVRGLRGPNLTSPASITFTTGLEAPQDLEAKEVTPRMALLTWTEPQVPPTS
YLLSVNTLGGQTQEVLLPGGATSHQLLGLFPSTPYSVWLRAVWGESLTPPVSTSFTTGGL
RIPFPRDCGEEMQNGAGTSRTTTIFLNGNRERPLHVFCDMETDGGGWLVFQRRMDGQTDF
WRDWEDYAHGFGNISGEFWLGNEALHSLTEAGDYSMRVDLRAGDEAVFAQYDSFRVDSAA
EYYRLHLDGYHGTAGDSMSYHSGSVFSARDRDPNNLLISCAVSYRGAWWYRNCHYANLNG
LYGSTVDHQGVSWYYWKGFEFSVPFTEMKLRPRSYRPPAAQGG
NT seq 3732 nt   +upstreamnt  +downstreamnt
atgaagccaccatccctgtgtcttctctcaggcccccaggatgaggtggaggagaccccc
agccccacagaacccatcacagaggccccagagccccccaaggagcccctccttggggag
ctgacggtaacgggatcctccccagactccctgagcctctcctggaccgtcccccagggc
cactttgactccttcactgtccagtacaaggacagggatgggcggccccaggtggtacgt
gtcccgggcgatgagagtgaggtgaccgttgggggtctggagccgggacgcaagtacaag
atgcacctgtatggcctggacagggggcggcgcgtgggccccgtgtccaccgtgggcctg
accgaatatgaagctgtgaccacccaagccccatccaccatgtcctctgagcctcccatc
aagccacacctgggggagctggcagtgaccaaagccacccccaactccctgcacctgtcc
tggaccatccccgagggccagtttgaccacttcctggtccagtacaagaatggggatggg
cagcccaaggcggtgagggtgccagggcatgaagacggggtcaccatctcaggcctggag
ccagaccacaagtacaagatgaacctgtatggcttccacggtggccagcgcatgggcccc
atctctgccattggggtgacagctgcagaagaagagacgccaacccccaccgaggtggag
gagacccccagccccccagaacccagcacagaggccccagagccccccaaggagcccctc
ctgggggagctgacggtgacgggatcctccccagactccctgagcctctcgtggaccatc
ccccagggccactttgactccttcactgtccagtacaaggacagggatgggcggccccag
gtggtacgtgtcccgggtgacgagagtgaggtgaccgttgggggtctggagccgggacgc
aagtacaagatgcacctgtatggcctggacagggggcgccgcgtgggccccgtgtccacc
gtgggcctgaccggcccagacacaaaacctcccagccttggggagctgacagtgacagat
gtgaccccagactccattagcctctcgtggacggtccccgagggtgaattcgactccttc
gtggtccaatacaaggacagggatgggcagccccggggggtgcctgtggccgcagaccag
cgtgaggtcaccatccctggcctggagcccagcaggaagtacaggttcctgctctacggg
ctggcgggcaggaagcgcttgggccccatctctgccgacagcagcacagctcccctggag
aaggagcagcagcacccaccccgcctcggagagctgacagtgatagatgagacccccaac
tccctgagcctctcatggacggtagcccagggcctctttgattcctttgtggtccagtac
agggacccagctgggcagccccgggcagtgcctgtggccaaagaccagcgggacgtcacc
atacagggcctggagcctggcagaaaatacaaattcctgctctatgggatccacggaaga
cagcacttgggccccatctccgtcctgggagtgacagccccggaagcggacacaccagcc
ccctggagcccggccacagaggcccctgagccccctgaagggccccacctaaggacactg
gcagtgagcgacataaccccagactctctgcacctgttgtggaatgtggcccagggcccc
tttgactctttcgtggtccagtatcaggacacagatgggcagccccaggccttgctcgtg
ggtggcaaccagaacaaggtcctagtgtcaggcctggagcccagcacctcctaccagttc
ttcctctatggcctccatggagggaagcgcctggggcctatctcagctgagggcaccaca
gggcctgctcctgccggtctgaccccaggggagccagggccccgcctgtcccagctgtca
gtgactgatgtgaccaccagttcgctgcggctcaactgggaggccccatcggaggccttt
gactccttcctgctccgttttggggtcccatcaccaagcactctagagccccactcacgt
cctctgctgcagcgggagttgacggtgcccgggacgcagcgctcagccgtgctccgggac
ctgcatccggggaccctgtacagccttacattgtatgggctgcgtgggccccataaggcc
gacagcatccagggcacagcccgtaccctcagcccagttctggaaagcccccgggacctt
cagttcagggaaatcagggaaacgtcggcccaggtcagctggatgcctccaccatccaga
gtggacagtttcaaagtttcctaccagctggcagatggaggggagccacagagtgtgcag
gtggatggccaagcccggacccagaaactccaggggctgatgccaggctctcactatgag
gtgaccgtggtctctgtccgtggctttgaggagagtgagcctctcacaggctacctcacc
acagttcctgatggccccacccagcttcgtgcactgaacttgacggagggatcagctctg
ctgcactggaagcctcctcaggcccccgtggacacatataacatccgtgtcacagcccca
ggggaccccccactgcaggcctcggcccctggcagcgcggtggagtaccctctggggggc
ctgaggctccacaccaactacacagcgactgtgcgtggtctccggggccccaacctcacc
tccccagccagcatcaccttcaccacagggctggaagccccccaggacttggaggccaag
gaagtaaccccccgcatggccctgctcacttggaccgagccccaagtcccgccgactagc
tacctgctcagtgtcaacacccttggtggacagacacaggaggtcctgctcccaggcggg
gccacttctcaccagcttctgggcctctttccctccaccccctacagcgtgtggctccgg
gctgtgtggggcgagagcctcacgccgccagtgtccacctccttcaccactggtggactt
cgaatccccttccctcgggactgcggggaagagatgcagaacggagccggcacctccagg
accaccaccatcttcctcaatggcaaccgcgagcggcccctccatgtgttttgtgacatg
gagaccgacgggggcggctggctggtgttccagcgccgcatggacggacagacagacttt
tggagggactgggaggactatgcccacggcttcggcaacatctctggggagttctggttg
ggcaacgaggccctgcacagcctgacagaagcgggcgactactccatgcgtgtggacctg
cgggctggggacgaggccgtgttcgcacagtatgactccttccgagtagactccgcggcg
gagtactaccgccttcatctggacggctaccacggcacagcaggggactccatgagctac
catagtggcagtgtcttttccgcccgtgaccgcgaccccaacaacctgctcatctcctgc
gcggtgtcataccgcggggcctggtggtacaggaactgccactacgccaacctcaacggg
ctctatggaagtacagtggaccaccagggggtgagctggtactactggaagggcttcgag
ttctctgtgcccttcacggaaatgaagctcagaccaagaagctaccggcccccagcagcc
cagggaggctga

KEGG   Vulpes vulpes (red fox): 112914112
Entry
112914112         CDS       T05911                                 

Gene name
COL9A1
Definition
(RefSeq) collagen alpha-1(IX) chain
  KO
K08131  collagen type IX alpha
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04974  Protein digestion and absorption
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112914112 (COL9A1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112914112 (COL9A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112914112 (COL9A1)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    112914112 (COL9A1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112914112 (COL9A1)
Proteoglycans [BR:vvp00535]
 Extracellular matrix (ECM) proteoglycans
  Collagen family
   112914112 (COL9A1)
SSDB
Motif
Pfam: Collagen Laminin_G_3 Laminin_G_2 Laminin_G_1 DUF4882
Other DBs
NCBI-GeneID: 112914112
NCBI-ProteinID: XP_025846915
UniProt: A0A3Q7SWW3
LinkDB
Position
Unknown
AA seq 919 aa
MKNFWKIPVFFFVCSFLGSWTSAAVKRRPRFPVNSNSNGGNELCPKVRIGQDDLPGFDLI
SQFQVDKAASRRAIQRVVGSTALQVAYKLGNNVDFRIPTRDLYPSGLPEEYSFLTTFRMT
GSTLEKNWSIWQIQDSSGKEQVGVKINGQTKSVAFSYKGLDGSLQTATFSNLPSLFDSQW
HKIMIGVERSSATLFVDCNRIQSLPIKPRGQIDVDGFAVLGKLADNPQVSVPFELQWMLI
HCDPLRPRRETCHELPVRPSETADQRGPPGVQGPPGPPGPPGVPGIDGIDGDRGPKGPPG
PPGPAGEPGKPGAPGKPGTPGADGLTGPDGSPGSVGPRGQKGEPGVPGSRGFPGRGIPGP
PGPPGAAGLPGELGRVGPIGDPGRRGPPGPPGPPGPSGTIGFHDGDPLCPNSCPPGRSGY
PGLPGMRGHKGAKGEIGEPGRQGHKGEEGDQGEQGEVGAQGPPGAQGLRGITGIVGAKGE
KGARGIDGEPGPQGIPGAPGDQGQRGPPGEIGPKGDRGPQGSRGIPGLPGTKGDTGLPGV
DGREGIPGMPGTKGEPGKPGPPGDAGLQGLPGVPGIPGAKGVAGEKGNTGAPGKPGQLGN
SGKPGQQGPPGEVGPRGPRGLPGSRGEVGPVGPPGLPGKLGSLGSPGLPGLPGPPGLPGM
KGDRGVVGEPGPKGERGSSGEEGEAGERGELGEIGLPGPKGSVGNPGEPGLRGPEGSRGL
PGEEGPRGPPGPRGVQGEQGATGLPGIQGPPGRAPTDQHIKQVCMRVMQEHLAEMAASLK
RPDSGASGLPGRPGPPGPPGPPGENGFPGQMGLRGLPGIKGPPGALGLRGPKGDLGERGE
RGPPGRGPKGLPGATGLPGEPGPASYGRNGRDGERGPPGVAGIPGVPGPPGPPGPPGFCE
PASCTMQAGQRAFSKGPDQ
NT seq 2760 nt   +upstreamnt  +downstreamnt
atgaagaacttctggaaaattccagttttcttctttgtatgcagtttcctgggatcttgg
acatctgcagctgtcaaacgtcgcccaagatttcctgttaattcaaattctaatggtgga
aatgaactctgtccaaaggtcaggattggccaagatgatttgccagggtttgacttgatt
tctcagttccaggtagataaagcagcatctagaagagctattcagagggtagtgggatca
actgcattacaagtggcttacaaactgggaaataatgtagacttcaggattccaacaagg
gatttatatcccagtggtctgcctgaagaatactcctttttaactacctttcggatgact
ggaagcacacttgaaaagaactggagcatttggcagattcaggattcctcagggaaggag
caagttggcgtgaagattaatggccaaacaaaatctgttgcattttcatacaagggactg
gatggaagtctccaaactgcaactttttcaaatttgccttctttgtttgattcccaatgg
cataagatcatgattggtgtggaaaggagtagtgctactctttttgttgattgcaacagg
attcaatccttacctataaagccaagaggccaaattgatgttgatggctttgctgtgctg
ggaaaacttgcagataatcctcaagtttctgttccgtttgaacttcagtggatgctgatt
cattgtgacccactacgccccaggagagagacttgccatgagctgccagttcggcccagc
gagaccgcggaccagagaggtcccccgggcgtgcaggggcccccggggccccccggcccc
cctggagttccaggcatcgatggcatcgacggtgaccgaggtcccaagggtcccccgggc
cccccgggtcctgctggagaaccgggcaagccaggagctccgggcaagccgggcacgccg
ggcgcggacggattaacaggacctgatggatcccctggttctgtcggaccaagaggacaa
aaaggagaacctggtgttcctggatctcggggatttccaggtcgtggtattcctgggcct
cccggccctcctggggcagcagggcttcctggagagcttggccgtgttggaccaattggt
gaccctgggagaagaggaccacctggcccccctggccctccaggacccagtggaaccatt
ggctttcatgatggagatccattgtgtcccaattcttgtccaccaggtcgctcaggatat
ccaggcttaccaggcatgaggggtcataaaggggctaaaggagaaattggtgaacctgga
agacaaggtcacaagggtgaagaaggtgaccagggggaacagggagaagttggagctcaa
ggacctccaggagctcaaggattacgaggcatcactggcattgttggggccaaaggggaa
aaaggtgctcggggcatagatggagaacctgggccccaagggattcctggtgcacctggt
gatcaaggacagcgaggacctccaggagaaataggtcccaagggagatagagggcctcaa
ggttctagaggaattcctggcctccctgggaccaaaggagacacgggcttgccaggtgtg
gatggccgtgaagggatacctggaatgcctggaacaaagggtgaaccagggaagcctggg
cctcctggtgatgcgggattgcagggcttacctggtgtacctggaattcctggtgcaaag
ggtgttgctggtgaaaagggtaacacaggtgctccagggaagcctggtcaactggggaat
tcaggcaaaccgggtcaacaggggcctccaggagaagtgggacctcgaggacctcggggg
cttcctggcagtagaggggaagtaggaccagtgggacccccaggactaccaggtaaactg
ggttctcttggtagtcctggcctccctggcttgcctggcccccctggacttcctggaatg
aaaggtgacaggggagtagtcggtgaacctggtccaaaaggtgaacggggttcctctggt
gaagaaggtgaagcaggagaaaggggtgaacttggagagataggattacctggaccaaag
ggatctgtgggtaaccctggggagcctggcttgagggggcctgaaggaagtcgggggctt
cctggagaggaaggacccagaggaccgcctggaccacgaggtgtgcagggagagcagggt
gccactggcctgcccggcatccagggtcctccaggtagagcaccaacagatcagcacatt
aagcaggtttgcatgagagtcatgcaagagcatcttgctgagatggctgctagtctcaag
cgaccggactcaggagcctctggactccctggaaggcctgggccccctggtcccccagga
cctcctggagagaatggtttcccaggccaaatgggacttcgtggcctcccaggcattaaa
ggcccccctggtgctcttggtttgagggggcctaaaggtgacttgggagaaaggggggaa
cgtggccctccaggaagaggtcctaagggcttgcccggagctacaggtctcccaggtgag
cctggtcctgccagctacgggaggaatggccgggatggtgaacgaggccccccaggggtg
gcaggaattcctggtgtacctggtcctccaggccctcctggccctcctgggttttgtgag
ccagcctcctgcaccatgcaggctgggcaacgggcgtttagcaaagggcctgaccagtga

KEGG   Vulpes vulpes (red fox): 112917517
Entry
112917517         CDS       T05911                                 

Gene name
VWF
Definition
(RefSeq) von Willebrand factor
  KO
K03900  von Willebrand factor
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04610  Complement and coagulation cascades
vvp04611  Platelet activation
vvp05165  Human papillomavirus infection
vvp05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112917517 (VWF)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112917517 (VWF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112917517 (VWF)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    112917517 (VWF)
   04611 Platelet activation
    112917517 (VWF)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    112917517 (VWF)
   05165 Human papillomavirus infection
    112917517 (VWF)
Chaperones and folding catalysts [BR:vvp03110]
 Intramolecular chaperones
  Others
   112917517 (VWF)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112917517 (VWF)
SSDB
Motif
Pfam: VWD VWA C8 VWA_N2 TIL VWC Pacifastin_I MCR_beta_N
Other DBs
NCBI-GeneID: 112917517
NCBI-ProteinID: XP_025851352
UniProt: A0A3Q7RXA5
LinkDB
Position
Unknown
AA seq 2810 aa
MSLTRLARVLLALALILPGKLCTKGTVGRSSMARCSLFGGDFINTFDESMYSFAGDCSYL
LAGDCQEHSVSLIGGFQNGKRVSLSVYLGEFFDIHLFVNGTMLQGTQSISMPYASNGLYL
EAEAGYYKLSSEAYGFVARIDGNGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFRTQEGTL
TSDPYDFANSWALSNGEQRCKRVSPPSSPCNVSSDEVQQVLWEQCQLLKSASVFARCHPL
VDPEPFVALCERTLCTCVQGMECPCAVLLEYARACAQQGIVLYGWTDHSICRPACPAGME
YKECVSPCTRTCQSLHVKEVCQEQCVDGCSCPEGQLLDEGHCVGSAECSCVHAGQRYPPG
ASLLQDCHTCICRNSLWICSNEECPGECLVTGQSHFKSFDNRYFTFSGVCHYLLAQDCQD
HTFSVVIETVQCADDLDAVCTRSVTVRLPGHHNSLVKLKHGGGVSMDGQDIQIPLLQGDL
RIQHTVMASVRLSYGEDLQMDWDGRGRLLVTLSPVYAGKTCGLCGNYNGNRGDDFVTPAG
LAEPLVQDFGNAWKLHGACDNLQKQHSDPCSLNPRQSTYPSWNYFSSPSAPCHRAVGPQP
YVQNCRYDVCACSDGRDCLCSAVADYAAACARRGVHIAWREPGFCALSCPQGQVFLQCGT
PCNMTCRSLSYPEEDCNEVCLEGCFCPPGLYLDERGDCVPKAQCPCYYDGEIFQPEDIFS
DHHTMCYCEDGFMHCTTSGGLGSLLPNTVLSSPLSHRSKRSLSCRPPMVKLVCPADNPRA
EGLECAKTCQNYDLQCMSTGCVSGCLCPQGMVRHENRCVALERCPCFHQGREYAPGETVK
IDCNTCVCRDRKWNCTDHVCDATCSAIGMAHYLTFDGLKYLFPGECQYVLVQDYCGSNPG
TFRILVGNEGCSYPSVKCKKRVTILVEGGEIELFDGEVNVKKPMKDETHFEVVESGQYVI
LLLGKALSVVWDHRLSISVTLKQTYQEQVCGLCGNFDGIQNNDFTSSSLQIEEDPVDFGN
SWKVNPQCADTKKVPLDSSPAVCHNNIMKQTMVDSSCRILTSDIFQDCNRLVDPEPFLDI
CIYDTCSCESIGDCACFCDTIAAYAHVCAQHGKVVAWRTATFCPQNCEERNLHENGYECK
WRYNSCAPACPITCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTCIDPEDCPVCEVAG
RRLAPGKKIILNPNDPEHCQICHCDSVNFTCEACREPGSLVVPPTEGPIGSTTSYVEDTP
EPPLHDFHCSRLLDLVFLLDGSSKLSEDEFEVLKVFVVGMMEHLHISQKRIRVAVVEYHD
GSHAYIELKDRKRPSELRRITSQVKYAGSEVASTSEVLKYTLFQIFGRIDRPEASRIALL
LMASQEPPRLARNLVRYVQGLKKKKVIVIPVGIGPHASRKQIHLIEKQAPENKAFVVSGV
DELEQRRDEIINYLCDLAPEAPAPTQHPPMAQVTVGPELLGVSSPGPKRNSMVLDVVFVL
EGSDKIGEANFNKSREFMEEVIQRMDVGQDSIHVTVLQYSYMVAVEYTFSEAQSKGEVLQ
QVRDIRYRGGNRTNTGLALQYLSEHSFSVSQGDREQVPNLVYMVTGNPASDEIKRMPGDI
QVVPIGVGPHADVQELEKIGWPNAPILIHDFEMLPREAPDLVLQRCCSGEGLQIPTLSPT
PDCSQPLDVVLLLDGSSSIPASYFNEMKSFTKAFISRANIGPRLTQVSVLQYGSITTIDV
PWNVAYEKVHLLSLVDLMQQEGGPSQIGDALGFAVRYVTSEVHGARPGASKAVVILVTDV
SVDSVDAAAEAARSNRVTVFPIGIGDRYNEAQLSSLAGPKAGSNMVRLQRIEDLPTVATL
GNSFFHKLCSGFDRVCVDEDGNEKRPGDVWTLPDQCHTVTCLPDGQTLLKSHRVNCDRGP
RPSCPNGQPPLRVEETCGCRWTCPCVCMGSSTRHIVTFDGQNFKLTGSCSYVLFQNKEQD
LEVILHNGACSPGARETCMKSIEVKHDGLSVELHSDMQMTVNGRLVSIPYVGGDMEVNVY
GTIMYEVRFNHLGHIFTFTPQNNEFQLQLSPRTFASKTYGLCGICDENRANDFILRDGTV
TTDWKALIQEWTIQQLGKTCQPVPEEQCPVSSSSHCQVLLSELFAECHKVLAPATFYAMC
QPDSCHPKKVCEAIALYAHLCRTKGVCVDWRRANFCAMSCPPSLVYNHCEHGCPRLCEGN
TSSCGDQPSEGCFCPPNQVMLEGSCVPEEACTQCISEDGVRHQFLETWVPAHQPCQICTC
LSGRKVNCTLQPCPTARAPTCGPCEVARLRQNAEQCCPEYECVCDLVSCDLPPVPPCEGG
LQMTLTNPGECRPNFTCACRKDECRRESPPSCPPHRTPALRKTQCCDEYECACNCVNSTV
SCPLGYLASAVTNDCGCTTTTCFPDKVCVHRGTIYPVGQFWEEACDVCTCTDLEDSVMGL
RVAQCSQKPCEDNCLSGFTYVLHEGECCGRCLPSACEVVIGSPRGDSQSHWKNVGSQWAS
PDNPCLINECVRVKEEVFVQQRNVSCPQLNVPTCPTGFQLSCKTSECCPTCHCEPLEACL
LNGTIIGPGKSLMIDVCTTCHCTVQVGVISGFKLECRKTTCEACPLGYKEEKNQGECCGR
CLPIACTIQLRGGQIMTLKRDETIQDGCDSHFCKVNERGEYIWEKRVTGCPPFDEHKCLA
EGGKIMKIPGTCCDTCEEPECKDIIAKLQRVKVGDCKSEEEVDIHYCEGKCASKAVYSIH
MEDVQDQCSCCSPTRTEPMQVPLRCTNGSLIYHEILNAMQCRCSPRKCSK
NT seq 8433 nt   +upstreamnt  +downstreamnt
atgagtcttaccagacttgcgagggtgctgctggctctggccctcatcttgccagggaaa
ctttgtacaaaagggactgttggaaggtcatcgatggcccgatgtagcctcttcggaggt
gacttcatcaacacctttgatgagagcatgtacagctttgcgggagactgcagttacctc
ctggctggggactgccaggaacactccgtctcacttattgggggcttccaaaatggcaag
agagtgagcctctccgtgtatctcggagaatttttcgacattcatttatttgtcaatggt
accatgctgcaggggacccaaagcatctccatgccctacgcctccaatgggctgtatcta
gaggcggaggctggctactacaagctgtccagtgaggcctatggctttgtggccagaatt
gatggcaatggcaactttcaagtcctgctgtcagacagatacttcaacaagacctgtggg
ctgtgtggcaactttaatatctttgctgaggatgacttcaggactcaagaagggacgttg
acttcggacccctatgactttgccaactcctgggccctgagcaatggggaacaacggtgc
aaacgggtgtcccctcccagcagcccatgcaatgtctcctctgatgaagtgcagcaggtc
ctgtgggagcagtgccagctcctgaagagtgcctcagtgtttgcccgctgccacccgctg
gtggatcctgagccttttgtcgccctgtgtgaaaggactctgtgcacctgtgtccagggg
atggagtgcccttgcgcggtcctcctggagtatgcccgggcctgtgcccagcaggggatt
gtcttgtacggctggaccgaccacagcatctgccgaccagcatgccctgctggcatggag
tacaaggagtgcgtgtccccttgcaccagaacttgccagagccttcatgtcaaagaagta
tgtcaggagcaatgtgtagatggctgcagctgccccgagggccagctcctggatgaaggc
cactgcgtgggaagtgctgagtgttcctgtgtgcatgctgggcaacggtaccctccgggc
gcctccctcttacaggactgccacacctgcatttgccgaaatagcctgtggatctgcagc
aatgaagaatgcccaggcgagtgtctggtcacaggacagtcccacttcaagagcttcgac
aacaggtacttcaccttcagtggggtctgccactacctgctggcccaggactgccaggac
cacaccttctctgttgtcatagagaccgtccagtgtgcggatgacctggatgctgtctgc
acccgctcggtcactgtccgcctgcctggacatcacaacagccttgtgaagctgaagcac
gggggaggagtctccatggatggccaggatatccagattcctctcctgcagggtgacctc
cgcatccagcacaccgtgatggcctccgtgcgcctcagctacggggaggacctgcagatg
gactgggacggccgaggcaggctgctggtgacgctgtccccggtctacgcggggaagacg
tgcggcctgtgtgggaactacaacggcaaccggggggacgacttcgtgacgcccgcaggc
ctggcggagcccctggtgcaggacttcgggaacgcctggaagctgcacggggcctgcgac
aacctgcagaagcagcacagcgatccctgcagcctcaacccgcgccagagtacgtaccca
tcctggaactatttctcctctccgtcagcgccctgccaccgcgcggtgggtcctcagccc
tacgtgcagaactgccgctacgacgtctgcgcctgctccgacggcagagactgtctttgc
agcgccgtggccgactacgccgcagcctgtgcccggaggggcgtgcacatcgcgtggcgg
gagcccggcttctgtgcgctgagctgcccccagggccaggtgttcctgcagtgtgggacc
ccctgcaacatgacctgtcgctccctctcttacccggaggaggactgcaatgaggtctgc
ttggaaggctgcttctgccccccagggctgtacctggacgagaggggagactgtgtgccc
aaggctcagtgtccctgttactatgatggtgagatctttcagcccgaagacatcttctca
gaccatcacaccatgtgctactgtgaggatggcttcatgcactgtaccacaagtggaggc
ctgggaagcctgctgcccaacacggtgctcagcagccccctgtctcaccgcagcaaaagg
agcctgtcctgtcggccccccatggtcaagttggtgtgtcccgctgataacccgagggct
gaaggactggagtgtgccaaaacctgccagaactatgacctgcagtgcatgagcacaggc
tgcgtctcaggctgcctctgcccacagggcatggtccggcatgaaaacaggtgtgtggcg
ctggaaagatgtccctgcttccaccaaggccgagagtacgccccaggagaaaccgtgaaa
attgactgtaacacttgtgtctgtcgggaccggaagtggaactgcacagaccacgtgtgt
gatgccacttgctctgccattggcatggcgcactacctcaccttcgacgggctcaagtac
ctgttccctggggagtgccagtatgttctggtgcaggattactgtggcagtaaccctggg
accttccggatcctggtggggaatgaggggtgcagctacccctcagtgaaatgcaagaag
cgggtcaccatcctggtggaaggaggagagattgaactgtttgatggggaggtgaatgtg
aagaaacccatgaaggatgagactcactttgaggtggtggagtctggtcagtacgtcatt
ttgctgctgggcaaggcactctctgtggtgtgggaccaccgcctgagcatctctgtgacc
ctgaagcagacataccaggagcaagtgtgtggcctgtgtgggaattttgatggcatccag
aacaatgatttcaccagcagcagcctccaaatagaagaagaccctgtggactttgggaat
tcctggaaagtgaacccgcagtgtgctgacaccaagaaagtaccactggactcctctcct
gccgtctgccacaacaacatcatgaagcagacgatggtggattcctcctgcaggatcctc
accagtgatattttccaggactgcaacaggctggtggaccctgagccattcctggacatt
tgcatctacgacacttgctcctgtgagtccattggggactgtgcctgcttctgtgacacc
attgctgcttacgcccatgtctgtgcccagcatggcaaggtggtggcctggaggacagcc
acattctgtccccagaattgcgaggaacggaatctccatgagaacgggtatgagtgtaag
tggcgctataacagctgtgcccctgcctgtcccatcacgtgccagcaccccgagccactg
gcatgccctgtacagtgtgttgaaggttgccatgcgcactgccctccagggaaaatcctg
gatgagcttttgcagacctgcatcgaccctgaagactgtcctgtgtgtgaggtggctggt
cgtcgcttggccccaggaaagaaaatcatcttgaaccccaatgaccctgagcactgccaa
atttgtcattgtgatagtgtcaacttcacctgtgaggcctgcagagaacccggaagtctt
gtggtgccccccacagaaggccccattggctctaccacctcgtatgtggaggacacgccg
gagccgcccctccatgacttccactgcagcaggcttctggacctggttttcctgctggat
ggctcctccaagctgtctgaggacgagtttgaagtgctgaaggtcttcgtggtgggcatg
atggagcatctgcacatctcccagaagcggatccgcgtggctgtggtggagtaccacgac
ggctcccacgcctacatcgagctcaaggaccggaagcgaccctcagagctgcggcgcatc
accagccaggtgaagtacgcgggcagcgaggtggcctccaccagtgaggtcttaaagtac
acgctgttccagatctttggcaggatcgaccgcccggaagcgtcccgcattgccctgctc
ctgatggccagccaggagcccccgaggctggcccggaatttggtccgctatgtgcagggc
ctgaagaagaagaaagtcattgtcatccctgtgggcatcgggccccacgccagccgtaag
cagatccacctcatagagaagcaggcccctgagaacaaggcctttgtggtcagtggtgtg
gatgagttggagcagcgaagggatgagattatcaactacctctgtgaccttgcccccgaa
gcacctgcccctactcagcaccccccaatggcccaggtcacggtgggtccggagctgttg
ggggtttcatctccaggacccaaaaggaactccatggtcctggatgtggtgtttgtcctg
gaagggtcagacaaaattggtgaggccaactttaacaaaagcagggagttcatggaggag
gtgattcagcggatggacgtgggccaggacagcatccacgtcacagtgctgcagtactcg
tacatggtggccgtggagtacaccttcagcgaggcgcagtccaagggcgaggtcctacag
caggtgcgggatatccgataccggggtggcaacaggaccaacactggactggccctgcaa
tacctgtccgaacacagcttctcggtcagccagggggaccgggagcaggtacctaacctg
gtctacatggtcacaggaaaccctgcttctgatgagatcaagcggatgcctggagacatc
caggtggtgcccatcggggtgggtccacatgccgatgtgcaggagctagagaagattggc
tggcccaatgcccccatcctcatccatgactttgagatgctccctcgagaggctcctgat
ctggtgctacagaggtgctgctctggagaggggctgcagatccccaccctctcccccacc
ccagattgcagccagcccctggatgtggtcctccttctggatggctcttccagcattccc
gcttcttactttaatgaaatgaagagcttcaccaaagctttcatttcaagagctaatata
gggccccggctcactcaagtgtcagtgctgcaatatggaagcatcaccaccatcgatgtg
ccttggaatgtagcctatgagaaagtccatttactgagccttgtggacctcatgcagcag
gagggaggccccagccaaattggggatgctttgggctttgccgtgcgatatgtcacctca
gaagtccacggtgccaggcccggagcctcgaaagcggtggttatcctagtcacagatgtc
tctgtggattcagtggatgctgcagccgaggccgccagatccaaccgagtgacagtgttc
cccattggaatcggggatcggtacaatgaggcccagctgagcagcttggcaggcccaaag
gctggctccaatatggtaaggctccagcgaattgaagacctccccaccgtggccaccctg
ggaaattccttcttccacaagctgtgctctgggtttgatagagtttgcgtggatgaggat
gggaatgagaagaggcccggggacgtctggaccttgccagaccagtgccacacagtgact
tgcctgccagatggccagaccttgctgaagagtcatcgggtcaactgtgaccgggggcca
aggccttcgtgccccaatggccagccccctctcagggtagaggagacctgtggctgccgc
tggacctgtccctgtgtgtgcatgggcagctctacccggcacattgtgacctttgatggg
cagaatttcaagctgactggcagctgttcgtatgtcctatttcaaaacaaggagcaggac
ctggaggtgattctccataatggtgcctgcagccctggggcgagggagacctgcatgaaa
tccattgaggtgaagcatgacggcctctcagttgagctccacagtgacatgcagatgaca
gtgaatgggagactagtctccatcccatatgtgggtggagacatggaagtcaatgtttat
gggaccatcatgtatgaggtcagattcaaccatcttggccacatcttcacattcaccccc
caaaacaatgagttccagctgcagctcagccccaggacctttgcttcgaagacatatggt
ctctgtgggatctgtgatgagaacagagccaatgacttcattctgagggatgggacagtc
accacagactggaaggcactcatccaggaatggaccatacagcagcttgggaagacatgc
cagcctgtccctgaggagcagtgtcctgtctccagcagttcccactgccaggtcctcctc
tcagagttgtttgccgagtgccacaaggtcctcgctccagccaccttttatgccatgtgc
cagcccgacagttgccacccgaagaaagtgtgtgaggcgattgccttgtatgcccacctc
tgtcggaccaaaggggtctgtgttgactggaggagggccaatttctgtgctatgtcatgc
ccaccatccctggtgtacaaccactgtgagcatggctgccctcggctctgtgaaggcaat
acaagctcctgcggggaccaaccctcagaaggctgcttctgccccccaaaccaagtcatg
ctggaaggtagctgtgtccccgaggaggcctgtacccagtgcatcagcgaggatggagtc
cggcaccagttcctggaaacctgggtcccagcccaccagccttgccagatctgcacgtgc
ctcagtgggcggaaggtcaactgtacgttgcagccctgccccacagccagagctcccacc
tgtggcccgtgtgaagtggcccgcctccgccagaacgcagagcagtgctgcccggagtac
gagtgtgtgtgtgacctggtgagctgtgacctgcccccggtgcctccctgcgaaggtggc
ctccagatgaccctgaccaatcctggcgagtgcagacccaacttcacctgtgcctgcagg
aaggatgaatgcagacgggagtccccgccctcttgtcccccgcaccggacgccggccctt
cggaagactcagtgctgtgatgagtatgagtgtgcatgcaactgtgtcaactccacggtg
agctgcccgctggggtacctggcctcggctgtcaccaacgactgtggctgcaccacaaca
acctgcttccctgacaaggtgtgtgtccaccgaggcaccatctaccctgtgggccagttc
tgggaggaggcctgtgacgtgtgcacctgcacggacttggaggactctgtgatgggcctg
cgtgtggcccagtgctcccagaagccctgtgaggacaactgcctgtcgggcttcacttac
gtccttcacgaaggcgagtgctgtggaaggtgtctgccatctgcctgtgaggtggtcatc
ggttcaccacggggcgactcccagtctcactggaagaatgttggctctcagtgggcctcc
cctgacaacccctgcctcatcaatgagtgtgtccgagtgaaggaggaggtctttgtgcaa
cagaggaatgtctcctgcccccagctgaatgtccccacctgccccacgggcttccagctg
agctgtaagacctcagagtgttgtcccacctgtcactgcgagccgctggaggcctgcttg
ctcaatggtaccatcattgggccgggcaaaagtctgatgattgatgtgtgtacaacctgc
cactgcaccgtccaggtgggagtcatctctggattcaagctggagtgcaggaagaccacc
tgtgaggcgtgccccctgggttataaggaagagaagaaccaaggtgaatgctgtgggaga
tgtctgcctatagcttgcaccattcagctaagaggaggacagatcatgacactgaagcgt
gatgagactatccaggatggctgtgacagtcacttctgcaaggtcaatgaaagaggagag
tacatctgggagaagagagtcacgggctgcccacctttcgatgaacacaagtgtctggct
gagggagggaaaatcatgaaaattccaggcacctgctgtgacacatgtgaggagccagaa
tgcaaggatatcattgccaagctgcagcgtgtcaaagtgggagactgtaagtctgaagag
gaagtggacattcattactgtgagggtaaatgtgccagcaaagccgtgtactccatccac
atggaggatgtgcaggaccagtgctcctgttgctcgcccacccggacggagcccatgcag
gtgcccctgcgctgcaccaatggctccctcatctaccatgagatcctcaatgccatgcaa
tgcaggtgttcccccaggaagtgcagcaagtga

KEGG   Vulpes vulpes (red fox): 112917855
Entry
112917855         CDS       T05911                                 

Gene name
COL1A1
Definition
(RefSeq) collagen alpha-1(I) chain
  KO
K06236  collagen type I alpha
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04611  Platelet activation
vvp04926  Relaxin signaling pathway
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04974  Protein digestion and absorption
vvp05146  Amoebiasis
vvp05165  Human papillomavirus infection
vvp05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112917855 (COL1A1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112917855 (COL1A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112917855 (COL1A1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112917855 (COL1A1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112917855 (COL1A1)
  09154 Digestive system
   04974 Protein digestion and absorption
    112917855 (COL1A1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    112917855 (COL1A1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112917855 (COL1A1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112917855 (COL1A1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112917855 (COL1A1)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112917855 (COL1A1)
SSDB
Motif
Pfam: Collagen COLFI VWC TILa
Other DBs
NCBI-GeneID: 112917855
NCBI-ProteinID: XP_025851655
UniProt: A0A3Q7T9F4
LinkDB
Position
Unknown
AA seq 1457 aa
MFSFVDLRLLLLLAATALLTHGQEEGQEEDIPPVTCVQNGLRYYDRDVWKPEACRICVCD
NGNVLCDDVICDETKNCPGAQVPXAPSATPGSPSPTDQETTGVEGPKGDTGPRGPRGPAG
PPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPQMSYGYDEKSTGGISVPGPMGPSGPR
GLPGPPGAPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDGEAGKPGRPGERGPP
GPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPGENGAPGQMGPRGLP
GERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKGEAGPQGARGSEGPQ
GVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPGARGPSGPQGPSGPP
GPKGNSGEPGAPGNKGDTGAKGEPGPTGIQGPPGPAGEEGKRGARGEPGPTGLPGPPGER
GGPGSRGFPGADGVAGPKGPAGERGSPGPAGPKGSPGEAGRPGEAGLPGAKGLTGSPGSP
GPDGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPGKAGERGVPGPPGAV
GPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPGEAGKPGEQGVPGDL
GAPGPSGARGERGFPGERGVQGPPGPAGPRGANGAPGNDGAKGDAGAPGAPGSQGAPGLQ
GMPGERGAAGLPGPKGDRGDAGPKGADGSPGKDGVRGLTGPIGPPGPAGAPGDKGEAGPS
GPAGPTGARGAPGDRGEPGPPGPAGFAGPPGADGQPGAKGEPGDAGAKGDAGPPGPAGPT
GPPGPIGNVGAPGPKGARGSAGPPGATGFPGAAGRVGPPGPSGNAGPPGPPGPAGKEGGK
GPRGETGPAGRPGEVGPPGPPGPAGEKGSPGADGPAGAPGTPGPQGIAGQRGVVGLPGQR
GERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESGREGSPGAEGSPGRD
GSPGPKGDRGETGPAGPPGAPGAPGAPGPVGPAGKNGDRGETGPAGPAGPIGPVGARGPA
GPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGPPGSPGEQGPSGASGPAGPRGPPGSA
GSPGKDGLNGLPGPIGPPGPRGRTGDAGPVGPPGPPGPPGPPGPPSGGFDFSFLPQPPQE
KAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEGSRKNPARTCRDLKMCHS
DWKSGEYWIDPNQGCNLDAIKVFCNMETGETCVYPTQPQVAQKNWYISKNPKEKRHVWYG
ESMTDGFQFEYGGQGSDPADVAIQLTFLRLMSTEASQNITYHCKNSVAYMDQQTGNLKKA
LLLQGSNEIEIRAEGNSRFTYSVTYDGCTSHTGAWGKTVIEYKTTKTSRLPIIDVAPLDV
GAPDQEFGMDIGPVCFL
NT seq 4374 nt   +upstreamnt  +downstreamnt
atgttcagctttgtggacctccggctcctgctcctcttagcggccaccgccctcctgacg
cacggccaagaggagggccaagaagaagacatcccaccagtcacctgcgtacagaacggc
ctcaggtactatgaccgagacgtatggaaacccgaggcctgccggatctgtgtctgcgac
aacggcaacgtgttgtgcgatgacgtgatctgcgacgaaaccaagaactgccccggcgcc
caagtccccngcgcgcccagtgcgacccccggctcaccgtcacctaccgaccaagaaacc
acaggagtcgagggacccaaaggagacactggcccccgaggtccgaggggacctgccggc
ccccctggccgagatggcatccccggacagcctggacttcccggaccccctggacctccc
ggaccccctggaccccctggcctcggaggaaactttgctccccaaatgtcttatggctat
gatgagaaatcaactggaggaatctccgtgcctggccccatgggtccttctggtcctcgt
ggtctccctggcccccctggcgcacctggtcctcaaggtttccaaggcccccctggtgaa
cctggcgagcctggagcctcaggtcccatgggtccccgtggtccccctggcccccctggc
aagaacggagatgatggtgaagctggaaagcctggtcgtcctggtgagcgtgggcctcct
ggacctcagggtgctcggggattgcctggaacagctggccttcctggaatgaagggacac
agaggtttcagtggtttggatggtgccaagggagatgctggtcctgctggtcccaagggt
gagcccggtagccccggtgaaaatggagctcctggccagatgggcccccgtggtctgcct
ggtgaaagaggtcgccctggagcccctggccctgccggtgctcgtggaaacgatggtgct
actggtgctgctgggccccctggtcccactggccccgctggtcctcctggcttccccggt
gctgttggtgctaagggtgaagctggtccccaaggagcccgtggctctgaaggtcctcag
ggcgtgcgtggtgagcccggcccccctggccctgctggtgctgccggccctgccggaaac
cccggtgctgatggacagcctggtgctaaaggtgctaacggcgctcctggcattgctggt
gctcccggcttccccggtgcccgaggcccctctggaccccagggccccagcggtcctcct
ggtcccaagggtaacagcggtgaacctggtgctcccggaaacaaaggagacactggtgcc
aagggagagcccggccccactggtattcaaggtccccctggccctgctggggaagaagga
aagcgaggagcccgaggtgaacctggacccactggcctgcccggaccccctggcgagcgt
ggtggacctggtagccgtggtttccctggtgcagatggtgtcgctggtcccaagggtccc
gctggtgaacgtggttctcctggtcccgctgggcccaaaggttctcctggtgaagctggt
cgccctggtgaagctggtctgcctggtgccaagggtctgactggaagtcctggcagccct
ggtccagatggcaaaactggcccccctggtcccgctggtcaggatggtcgccccggaccc
ccaggcccccctggtgcccgtggtcaagctggtgtgatgggattccctgggcctaaaggt
gccgctggagagcctggcaaggctggagagcgtggtgtccctggcccccctggtgctgtt
ggtcctgctggcaaagatggagaagcaggagctcaggggccccctggccctgctggcccc
gctggcgagagaggtgaacaaggtcctgctggctcccccggattccagggtctccctgga
cctgctggtcctcccggcgaagctggcaaacccggtgaacagggtgttcctggcgacctt
ggtgcccccggcccctctggagcaagaggcgagagaggcttccctggtgaacgtggtgtg
caaggtccccccggtcctgcaggtccccgaggagccaacggtgcccctggcaatgatggt
gctaagggtgatgctggtgcccctggagcccccggtagccagggcgctcctggccttcag
ggaatgcctggtgaacgaggtgcagctggtcttcctggccctaagggtgacagaggtgat
gccggtcccaaaggtgctgatggctctcctggcaaagatggtgtccgtggtctgactggc
cccattggtcctcctggccctgctggtgcccctggtgacaagggtgaagctggtcctagc
ggccctgctggtcccactggagctcgtggtgcccccggagaccgtggtgagcctggtccc
cctggtcctgctggcttcgctgggccccccggtgctgatggccaacctggtgctaaaggt
gaacccggtgatgctggtgctaaaggcgacgctggtccccctggccctgctggacccact
ggaccccccggccccattggtaacgttggtgctcctggacccaaaggtgctcgtggcagc
gccggtccccctggtgctactggtttccctggtgctgctggccgcgtcggtccccccggc
ccctctggaaatgctggaccccctggccctcctggccctgctggcaaagaaggcggcaaa
ggcccccgtggtgagactggccctgctggacgtcccggtgaagttggtccccctggtccc
cccggccctgctggcgagaaaggatcccctggtgctgatggacccgctggtgctcccggc
actcccggacctcaaggcattgctggacagcgtggtgtggtcggtctgcccggtcaacga
ggagaaagaggcttccctggtcttcccggcccctctggcgaacctggcaaacaaggtcct
tctggagcaagtggtgaacgtggtccccctggtcccatgggcccccctggattagctgga
ccccctggcgagtctggacgggagggatctcctggtgctgaaggctcccctggacgagat
ggttctcctggccccaagggtgaccgtggtgagaccggccctgctggaccccctggtgcc
cccggtgcccctggtgctcctggccccgtcggccctgccggcaagaacggtgaccgcggt
gagactggtcctgctggtcctgctggcccaatcggccctgttggtgctcgtggtcctgct
ggaccccaaggcccccgtggtgacaagggtgagacaggcgaacagggtgacagaggcata
aagggtcaccgtggcttctctggtcttcagggtcctcctggccctcccggctctcctggt
gaacaaggtccttctggagcttctggtcctgctggcccccgaggtccccctggctctgct
ggttctcctggcaaagacggactcaacggtctcccaggccccattggcccccccggtcct
cgtggtcgcactggtgatgccggtcctgttggtccccccggccctcctggaccccctggt
ccccccggtcctcccagcggcggtttcgacttcagcttcctgccccagccacctcaggag
aaggctcacgatggcggccgctactaccgggccgatgatgccaacgtggtccgtgaccgt
gacctcgaggtagacaccaccctcaagagcctgagccagcagatcgagaacatccggagc
cctgaaggaagccgcaagaaccctgcccgcacctgccgcgacctcaagatgtgccactcc
gactggaagagcggagaatactggattgaccccaaccaaggatgcaacctggatgccatc
aaggttttctgcaatatggagacaggtgagacctgcgtataccccactcagccccaggtg
gcccagaagaactggtacatcagcaagaaccccaaggagaagagacacgtctggtacggc
gagagcatgaccgatggattccagttcgagtatggtggtcagggctccgatcctgccgat
gtggccatccagctgaccttcctgcgcctgatgtccaccgaggcctcccagaacatcacc
taccactgcaagaacagcgtggcctacatggaccagcagaccggcaacctcaagaaggct
ctgctcctccagggttccaacgagatcgagatccgggccgagggcaacagccgcttcacc
tacagtgtcacctacgacggctgcacgagtcacactggagcctggggcaagacagtgatc
gaatacaaaaccaccaagacctcccgtttgcccatcatcgatgtggcaccattggacgtt
ggcgccccagaccaggaattcggcatggatattggccctgtctgcttcctgtaa

KEGG   Vulpes vulpes (red fox): 112917862
Entry
112917862         CDS       T05911                                 

Gene name
CHAD
Definition
(RefSeq) chondroadherin
  KO
K06248  chondroadherin
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112917862 (CHAD)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112917862 (CHAD)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112917862 (CHAD)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112917862 (CHAD)
Proteoglycans [BR:vvp00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class IV
    112917862 (CHAD)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 LRR_1 LRRNT LRR_9 LRRCT
Other DBs
NCBI-GeneID: 112917862
NCBI-ProteinID: XP_025851661
UniProt: A0A3Q7S9N1
LinkDB
Position
Unknown
AA seq 359 aa
MARPMLLLVLGLLAGLLPALAACPQNCHCHGDLQHVICDKVGLQKIPKVSEKTKLLNLQR
NNFPVLAANSFRAMPNLVSLHLQHCQIREVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFD
DLTELTYLYLDHNKVTELPRGLLSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSE
NALTSLQPGALDDVENLAKFYLDRNQLSSYPAAALSKLRVVEELKLSHNPLKSIPDNAFQ
SFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQLPSNFPFDSLETLTLTNN
PWKCTCQLRGLRRWLEAKTSRPDATCASPAKFKGQHIRDTDAFRSCKFPTKRSKKAGRH
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcccgtccgatgctcttgctcgtcctcggcctcctggccggcctgctgccggcactg
gccgcgtgcccccagaactgccactgccacggcgacctgcagcacgtcatctgcgacaag
gtggggctgcagaagatccccaaggtgtcagagaagaccaagctgctcaacctgcagcgc
aacaacttcccggtgctggctgccaactcgtttcgcgccatgcccaacctcgtgtcgctg
catctgcagcactgccagatccgcgaggtggctgcgggcgccttccgcggcctcaagcag
ctcatctacctgtatctgtcccacaacgacatccgtgtgctgcgcgccggggccttcgat
gacctgaccgagctcacctacctctacctggaccacaacaaggtgactgagctgccccgg
gggctgctctccccgctcgtcaacctcttcatcctgcagctcaacaacaacaagattcgg
gaactgcgcgctggtgccttccagggcgccaaggacctgcgctggctctacctgtcggaa
aatgcgctcacttcactgcagcccggcgctctggacgacgtagagaacctggccaagttc
tacctggacaggaaccagctgtccagctaccccgcagctgctctaagcaagctgcgggtg
gtggaagagctgaagttgtcccacaaccccctgaaaagcattcctgacaacgccttccag
tctttcggcagatacctggagaccctctggctggacaacaccaacctggagaagttctcg
gacggtgccttcctgggcgtgaccacactgaaacatgtccatctggagaacaaccgcctg
aaccagctgccttccaacttcccctttgacagcctagagacccttaccctcaccaacaac
ccctggaagtgcacctgccagcttcggggtcttcggaggtggctggaagccaagacttcc
cgccctgatgccacttgtgcctcacctgccaagttcaaaggccagcatatccgggacaca
gatgcctttcgcagctgcaagttccccaccaagaggtccaagaaagccggccgccactaa

KEGG   Vulpes vulpes (red fox): 112918914
Entry
112918914         CDS       T05911                                 

Gene name
THBS3
Definition
(RefSeq) thrombospondin-3
  KO
K04659  thrombospondin 2/3/4/5
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04145  Phagosome
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp05144  Malaria
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112918914 (THBS3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112918914 (THBS3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112918914 (THBS3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112918914 (THBS3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112918914 (THBS3)
  09174 Infectious disease: parasitic
   05144 Malaria
    112918914 (THBS3)
Membrane trafficking [BR:vvp04131]
 Endocytosis
  Phagocytosis
   Opsonins
    112918914 (THBS3)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112918914 (THBS3)
  Exosomal proteins of colorectal cancer cells
   112918914 (THBS3)
  Exosomal proteins of bladder cancer cells
   112918914 (THBS3)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112918914 (THBS3)
Domain-containing proteins not elsewhere classified [BR:vvp04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   112918914 (THBS3)
SSDB
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA cEGF EGF_3 EGF_MSP1_1
Other DBs
NCBI-GeneID: 112918914
NCBI-ProteinID: XP_025853003
UniProt: A0A3Q7SAF2
LinkDB
Position
Unknown
AA seq 952 aa
METQELRGALALLLLCTFASASQDLQVIDLLTVGESRQMTAVAEKIRAALLTAGDIYLLS
TFRLPPKQGGVLFGLYSRQDNTRWLEASVVGKINKVLVRYQREDGKVHAVNLQQAGLADG
RTHTALLRLRGPAQPSPALQLYVDCKLGDQHAGLPGMAPIPPAEVDGLEIRTGQKAYLRM
QGFVESMKMILGGSMARVGALSECPFQGDESIHSAVTNALQSILGEQTKALVTQLTLFNQ
ILVELRDDIRDQVKEMSLIRNTIMECQVCGFHEQRSHCSPNPCFRGVDCMEVYEYPGYRC
GPCPPGLQGNGTHCTDINECAHADPCFPGVSCINTMPGFHCEACPRGYKGTRVSGVGIDY
ARASKQVCNDVDECNDGNNGGCDPNSICTNTVGSFKCGPCRLGFLGNQSQGCLPARTCHS
PAHSPCHVHAHCLFERNGAVSCSCNVGWAGNGNVCGTDTDIDGYPDQALPYGQXSLDNCL
LTPNSGQEDADNDGVGDQCDDDADGDGIKNVEDNCRLFPNKDQQNSDTDSFGDACDNCPN
VPNNDQKDTDGNGEGDACDNDVDGDGIPNGLDNCPKVPNPLQTDRDEDGVGDACDSCPEM
SNPTQTDADSDLVGDVCDTNEDSDGDGHQDTKDNCPQLPNSSQLDSDNDGLGDECDGDDD
NDGVPDYVPPGPDNCRLVPNPNQKDSDGNGVGDVCEDDFDNDAVVDPLDVCPESAEVTLT
DFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVN
TVTDDDYAGFLFSYQDSGRFYVVMWKQTEQTYWQATPFRAVAQPGLQLKAVTSVSGPGEH
LRNALWHTGHTPDQVRLLWTDPRNVGWRDKTSYRWQLLHRPQVGYIRVKLYEGPQLVADS
GVIIDTAMRGGRLGVFCFSQENIIWSNLQYRCNDTVPEDFEPFRRQLLQERV
NT seq 2859 nt   +upstreamnt  +downstreamnt
atggagacgcaggaacttcggggggccctggctcttctcctcctctgcactttcgcatct
gccagtcaggacctgcaggtaattgacctgctgactgtgggcgagtctcggcagatgaca
gctgtagcggagaagatccgggcagccctgctcactgctggggacatctacctcctgtcc
accttccgcctgccccccaagcagggtggtgtcctctttggcctctactctcgccaagac
aacacacgatggctggaggcctctgttgtgggcaaaattaacaaagtgctggtacggtac
cagcgggaggatggcaaagtccacgcagtgaacctgcagcaagcaggcctggctgacggg
cggacacacacagctctcctgcgtctccgaggcccggcccaacccagccctgccctgcag
ctctatgtggactgcaagctgggagaccagcatgctggcctccctggaatggcccccatt
cccccagcagaggtggacgggctggagattcggactgggcagaaggcttatctgaggatg
cagggcttcgtggaatctatgaaaatgattctgggcgggtccatggcccgggtgggagcc
ctgagtgagtgtcccttccagggggacgagtccatccacagtgcagtgaccaatgcactc
cagtccatcctaggagagcagaccaaggcgctggtcacccagctcaccctcttcaaccag
atcctggtggagctgcgggacgatatccgagaccaggtgaaggaaatgtctctgatccga
aacaccatcatggagtgtcaggtgtgcggcttccatgagcagcgttcccactgcagcccc
aacccctgcttccgaggcgtggactgcatggaagtgtatgagtaccccggctaccgctgc
gggccctgcccccctggcctgcagggcaatggcacccactgcactgacatcaatgagtgt
gctcacgctgacccttgcttccctggggtcagctgcatcaacaccatgcctggcttccac
tgtgaagcctgtcctcgaggctacaaaggcactcgtgtgtccggtgtgggcatcgactat
gcccgtgccagcaaacaggtctgcaacgatgtggacgagtgcaacgatgggaacaatggt
ggctgtgacccaaattccatctgtaccaacactgtgggctctttcaagtgtggtccctgt
cgcctgggcttcctgggcaaccagagccagggctgcctcccagcccgcacctgccacagc
ccagcccacagcccctgccatgtccacgcgcactgtctctttgaacgcaatggggcagta
tcctgctcgtgtaatgtgggctgggccgggaatgggaacgtgtgtgggaccgacacggac
atcgatggctacccggaccaggccctgccatatggacaacanagccttgacaattgcctt
ttgacacccaactctgggcaggaagatgctgataatgatggcgtgggggaccagtgtgac
gatgatgctgacggggatgggatcaagaatgtcgaggacaactgccggctgttccccaac
aaggaccaacaaaactctgatacagattcattcggggatgcctgtgacaactgccccaac
gttcccaacaatgaccagaaggacacagacggcaacggggaaggggatgcgtgtgacaac
gatgtggatggggacggcatccccaatggattagacaattgtcctaaagtccccaacccc
ctgcagacagacagggacgaggatggggtaggagacgcctgtgacagctgccctgaaatg
agcaatcctacccagacagatgcagacagtgacctggtgggggatgtctgtgacaccaat
gaggacagtgatggggatggacatcaggacaccaaagacaactgcccacagctgccaaac
agctcccagctggactcagacaatgatggacttggagatgagtgtgatggggatgatgac
aatgatggggtcccagactatgtgcctcctggtcctgataactgtcgcctggtacccaat
cccaatcagaaggactcagatggcaatggcgttggtgatgtgtgtgaggatgattttgac
aatgatgcggtggtagatcccctggacgtgtgccctgaaagtgcagaggtgaccctcaca
gattttcgagcctatcagactgtcgtcctggatcccgagggtgatgctcagattgatcca
aactgggtcgtgctcaatcagggtatggaaatcgttcagaccatgaacagtgaccccggc
ctggcagttgggtatacagccttcaatggtgtggactttgaaggcaccttccatgtgaac
acagtgactgatgatgactacgcaggctttctcttcagctatcaggatagcggccgcttc
tatgtggtcatgtggaagcaaacagagcagacctactggcaagccacacccttccgggct
gtcgctcagcccgggctgcagctcaaggcagtgacatcagtgtccggcccaggtgaacac
ctccggaatgccctgtggcatactggccacacccctgatcaggtccgactgctgtggact
gacccacgaaacgtgggctggcgtgacaagacctcctatcgctggcagctgctgcaccgg
ccccaagttggctacattcgggtgaagctttatgagggtcctcagctagtggcggattct
ggggtgatcattgacacagccatgcgaggagggcgtcttggtgtattctgcttctcccaa
gaaaacatcatttggtccaatctccagtatcgatgcaatgacacagtgcctgaggatttt
gagccattccggaggcagctgctccaggaaagagtgtga

KEGG   Vulpes vulpes (red fox): 112919585
Entry
112919585         CDS       T05911                                 

Gene name
THBS4
Definition
(RefSeq) thrombospondin-4
  KO
K04659  thrombospondin 2/3/4/5
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04145  Phagosome
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp05144  Malaria
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112919585 (THBS4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112919585 (THBS4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112919585 (THBS4)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112919585 (THBS4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112919585 (THBS4)
  09174 Infectious disease: parasitic
   05144 Malaria
    112919585 (THBS4)
Membrane trafficking [BR:vvp04131]
 Endocytosis
  Phagocytosis
   Opsonins
    112919585 (THBS4)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112919585 (THBS4)
  Exosomal proteins of colorectal cancer cells
   112919585 (THBS4)
  Exosomal proteins of bladder cancer cells
   112919585 (THBS4)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112919585 (THBS4)
Domain-containing proteins not elsewhere classified [BR:vvp04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   112919585 (THBS4)
SSDB
Motif
Pfam: TSP_C TSP_3 COMP EGF_CA EGF_3 cEGF EGF EGF_MSP1_1
Other DBs
NCBI-GeneID: 112919585
NCBI-ProteinID: XP_025853826
UniProt: A0A3Q7SF27
LinkDB
Position
Unknown
AA seq 1001 aa
MGKVLNIWNIQEKLGERTETEDSRGRFGGQAFLGSLQGSSAGGLRRGFGSLRKRCSGAAT
KLAGSGVFDLLPSSSQRLNPAVLKPILTDPTLNEVYVISTFKLHTKSSATIFGLYSSTDN
SKYFEFTVMGRLNKAILRYLKNDGKIHLVVFNNLQLADGRRHRVLLRLTNLQRGAGSVEL
YLDCTQVDSVHNLPRAFSGSSQSPDSIELRTFQRKAQDFLEELKLVVRGSLFQVASLQDC
FLQQSEPLATTSTGDFNRQFLGQMTQLNQLLGEVKDLLRQQVKETSFLRNTIAECQACGP
LSFQSPTPNTLVPPAPPAPATSPTPPVRRCDSSSCFRGVRCTDTRDGFQCGPCPEGYTGN
GITCSDIDECKYHPCYPGVRCVNLAPGFRCEACPVGFTGPVVQGVGISFAKSNKQVCTDI
DECRNGACVLNSICINTLGSYRCGPCKPGYTGDQTRGCRTERSCRNPELNPCSVNAQCIE
ERQGDVTCVCGVGWAGDGYICGKDVDIDSYPDEELPCSARNCKKDNCRYVPNSGQEDADG
DGVGDACDEDADGDGILNEQDNCVLTHNVDQRNSDKDIFGDACDNCRNILNNDQKDTDGD
GKGDACDDDMDGDGIKNILDNCPRVPNRDQRDKDGDGVGDACDSCPDVSNPNQSDVDNDL
VGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKDGIGDECDDDDDNDGIPDLVPPGP
DNCRLVPNPAQEDSNRDGVGDICETDFDQDQVIDRIDVCPENAEVTLTDFRAYQTVVLDP
EGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTQTDDDYAGFIF
GYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVKSKTGPGEHLRNSLWHTGDTS
DQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYEGSELVADSGVTIDTTMRGGR
LGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFDRLDS
NT seq 3006 nt   +upstreamnt  +downstreamnt
atgggaaaagtactcaacatttggaatattcaagaaaagcttggagaaaggacagaaacc
gaggactcccggggccgctttggggggcaggcgttcctggggagccttcagggctcctcg
gccgggggcctgcgacgggggttcgggagcctccgcaagcgctgttctggggcggcaacc
aaactagcgggttcaggggtctttgaccttctcccatcctccagccagagactgaaccca
gctgttctgaagccaatcctgacagatcccaccctgaatgaggtctatgtgatctccacc
ttcaagctgcacactaaaagctcagccaccatctttggcctttactcttcaaccgacaac
agcaaatattttgaattcactgtgatgggacgcttaaacaaagccattctccgttacctg
aagaatgatgggaagattcatttggtggttttcaacaacttgcagctggctgatggcagg
cggcacagggtcctcctgagactgaccaacttgcagcgaggggctggctctgtagagctc
tatctggactgcacccaagtggattctgtgcacaaccttcccagagccttttccggctcc
tcccagagtcctgactccattgaattgagaaccttccagaggaaggcacaggacttcttg
gaagagctgaagctggtggtgagaggctcgctgttccaggtggccagcctgcaagactgc
ttcctgcagcagagtgagccactggccaccacaagcacaggagattttaatcggcagttc
ttggggcaaatgacacaactaaaccagctactgggagaggtgaaggatcttctgagacag
caggtcaaggaaacatcatttttgcgaaacactatagctgagtgccaggcttgtggtcct
ctcagctttcagtctcctaccccaaacacactggtgcctccagcgcccccagcacccgca
acatccccgacacccccagtgcgccgctgtgattccagctcatgtttccgcggcgtccgg
tgtacggacaccagagatggctttcagtgtgggccctgccccgagggctacacaggaaat
gggatcacctgttctgacattgatgagtgcaaatatcacccctgctacccaggtgtgcgc
tgtgtgaacttggctcctggcttcagatgtgaggcctgccccgtgggcttcactgggccc
gtggtgcagggtgtcgggatcagttttgccaagtcaaacaagcaggtctgcactgacatt
gatgagtgtcgcaatggagcatgtgttctcaattctatctgtattaacaccttgggatct
taccgctgtgggccttgcaagccagggtacaccggcgatcagacaaggggatgcagaact
gagagaagctgcagaaatcccgagctgaatccttgcagcgtgaatgcacagtgcatcgaa
gagaggcagggggatgtgacctgtgtgtgtggcgtcggctgggctggtgatggctacatc
tgtgggaaggacgtggacattgacagttaccctgacgaagaactgccttgctctgccagg
aactgcaagaaggacaactgcaggtatgtgccaaattctggccaagaagatgcagacgga
gatggcgttggggatgcttgtgatgaggatgctgatggagacgggatcctgaatgagcag
gataattgtgtcctgactcacaacgtggaccaaaggaacagtgacaaagacatctttggg
gacgcttgtgataactgccggaatatcctaaataatgaccagaaagacaccgatggggat
gggaaaggagatgcctgtgacgacgacatggatggagatggaataaaaaacattctggac
aactgcccaagagttcccaatcgtgaccaacgggataaggatggtgatggtgtgggggat
gcctgtgacagttgtcctgatgtcagcaaccctaaccagtctgatgtggataacgatctg
gttggggactcctgtgacaccaatcaggacagtgacggagatgggcatcaggacagcaca
gacaactgtcccactgtcattaacagtgcccagctggacactgataaggatgggattggt
gacgagtgtgatgatgatgatgacaatgatggcatcccagacctggtgccccctgggcca
gacaactgccggctggtcccaaacccagcccaggaggacagcaacagggacggcgtggga
gacatctgtgagaccgactttgaccaggaccaggtcatcgatcggatcgacgtctgcccg
gagaatgcagaggtcaccctgactgacttcagagcctaccagacggtggtcctggaccct
gaaggggacgcgcagatcgatcccaactgggtggtgctgaaccaaggcatggagattgtc
cagaccatgaacagcgaccccggcctggcagtggggtacacggcgtttaacggagttgac
tttgaagggaccttccacgtaaacacccagacggacgatgactacgccggcttcatcttt
ggctaccaagacagctccagcttctacgtggtcatgtggaagcagacggagcagacgtac
tggcaggccacgccgttccgtgctgtcgccgagcctggcatccagctcaaggctgttaag
tctaagacaggtcctggagagcatctccgcaactccctgtggcataccggggacaccagt
gaccaggtccggctgctgtggaaggactccaggaacgtgggctggaaggacaaggtgtcc
taccgctggttcctgcagcaccggccccaggtgggctacatcagagtgcgattttatgaa
ggctccgagttggtggctgactctggggtcaccatagacaccaccatgcgtggaggccgg
cttggtgtgttctgcttctcccaagaaaacatcatttggtccaacctgaagtatcgctgc
aatgacaccatcccagaggacttccaagagtttcaaacgcagaatttcgatcgcctggat
agctaa

KEGG   Vulpes vulpes (red fox): 112919611
Entry
112919611         CDS       T05911                                 

Gene name
IBSP
Definition
(RefSeq) bone sialoprotein 2
  KO
K06253  integrin binding sialoprotein
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112919611 (IBSP)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112919611 (IBSP)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112919611 (IBSP)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112919611 (IBSP)
SSDB
Motif
Pfam: BSP_II
Other DBs
NCBI-GeneID: 112919611
NCBI-ProteinID: XP_025853847
UniProt: A0A3Q7T1Q1
LinkDB
Position
Unknown
AA seq 320 aa
MKTALILLSILGMACAFSMKNLHRRAKLEDSEENGVFKYRPRYYLYKHSYFYPPLKRFPV
QSSSDSSEEDGDGDSSEEEEEEEETSNEEENNEENANSDENEDESDAENSTLSATPGYGE
ETTPGTEYIGLAAIQLPKKAGDIRHKATKEEESDEEEEEEDEENEENEAEVDENGQGINS
TSSNSTEAENGNGSSDGDNGEGEEESVTEAHSEGTTEAGKQNNGGSKTTLSPDGGFEPTT
PPPELYGTTTRPSGEATSNGYEEEYEQTGTNEYDNGYEVYESENGEPRGDNYRAYEDEYS
YYKGHSYDSYDGQDYYYHHQ
NT seq 963 nt   +upstreamnt  +downstreamnt
atgaagactgctttaattttgctcagcattttgggaatggcctgtgctttctcaatgaaa
aatttgcatcgaagagccaaattagaggattctgaagaaaatggggtctttaagtatcgg
ccacgttactatctttacaagcattcctacttttatcctcctctaaaacgatttccagtt
cagagcagtagtgactcatctgaagaagatggagacggtgacagctcagaagaggaggag
gaggaagaggagacttcaaatgaggaagaaaataatgaagagaatgcaaattctgatgaa
aacgaagatgaatctgatgctgagaactctaccctctctgctacacctggctatggagag
gagaccacacccggaacagagtacataggtctagctgcaatccaacttcccaagaaggct
ggggatataagacacaaggctacaaaagaggaggaaagtgatgaagaagaagaagaggaa
gatgaagaaaatgaagaaaatgaagcagaagtggatgaaaatgggcaaggtataaacagc
accagcagcaacagcacagaggcagaaaatggcaatggtagcagtgatggagacaatgga
gaaggcgaagaagaaagtgtcactgaagcccattcagaaggaaccacagaggctggaaag
cagaacaatggtggctctaagacaacactctctccagatggtgggtttgaacctacaact
ccaccaccagaactctacggaactaccacccgaccatctggggaagccacctccaatgga
tatgaggaagagtatgaacaaacaggcaccaatgaatatgacaatggatatgaagtttat
gaaagtgagaatggagaacctcgtggggataattatcgagcctatgaagatgaatacagc
tactataaagggcacagctatgacagctatgatggtcaagattactactaccaccaccag
tga

KEGG   Vulpes vulpes (red fox): 112919662
Entry
112919662         CDS       T05911                                 

Gene name
SPP1
Definition
(RefSeq) osteopontin isoform X1
  KO
K06250  secreted phosphoprotein 1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04371  Apelin signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04620  Toll-like receptor signaling pathway
vvp04929  GnRH secretion
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112919662 (SPP1)
   04151 PI3K-Akt signaling pathway
    112919662 (SPP1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112919662 (SPP1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112919662 (SPP1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112919662 (SPP1)
  09152 Endocrine system
   04929 GnRH secretion
    112919662 (SPP1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112919662 (SPP1)
SSDB
Motif
Pfam: Osteopontin
Other DBs
NCBI-GeneID: 112919662
NCBI-ProteinID: XP_025853898
UniProt: A0A3Q7SCP3
LinkDB
Position
Unknown
AA seq 299 aa
MRIAVICFCLLGIAYAIPIKQADSGSSEEKQLYNKYPGAVATWLKPDPSQKQTFLALQNA
VLTEETDDFKQKTFSSKSNESHDDVDEDDGDDVDSQDSVDSNDLDDDSNESDESDELVTD
FPTDIPATQLFTPAVPTRDSYDGRGDSVAYGLRSKSKKSHKYEVQYPDSTEEDFTSLVKS
ASMEDDFNTVLLSRTVRGTSDRDSHAKDSQETSQLDDHSMETKSRKHSQEYKLRASDESN
MHSLEIGSQENSEVSSELVSQISQSHEKELIVDSKSEEEDKHLKFHVSHELDSTSSEIN
NT seq 900 nt   +upstreamnt  +downstreamnt
atgaggattgcagtgatttgcttttgcctcttaggcattgcctacgccattccgattaag
caggctgattctgggagctctgaggaaaagcagctttacaacaaatacccaggtgctgta
gctacatggctaaagcctgacccatctcagaagcagactttcctagcactacagaatgct
gtgctgactgaggaaactgatgacttcaaacaaaaaaccttctcaagtaagtccaatgaa
agccatgacgatgtagatgaagatgatggagacgatgtggatagccaggactccgttgac
tcaaatgacttagatgatgactccaacgagtctgatgaatccgatgaactggtcactgat
tttcccactgacattccagcaacccaattattcactccagctgtccccacaagagactca
tatgatggccgaggtgatagtgtggcttatggactgaggtccaaatctaagaagtcccac
aaatatgaagtccagtatcctgattctacagaggaggacttcacatcacttgtgaaaagt
gcaagtatggaagatgacttcaataccgtccttctttcccggacagtgagaggcacctct
gacagggacagccatgcaaaagacagtcaggaaacaagtcagcttgatgaccacagtatg
gaaaccaagagccgcaagcactcccaagaatataagctgagagcaagtgatgagagcaat
atgcattcccttgagattggtagccaggaaaattctgaagtcagcagtgaacttgtcagc
caaataagtcaaagccatgagaaggagttaattgtagactccaagagtgaggaagaagat
aaacacctgaaatttcacgtttctcatgaattagatagtacatcttctgagatcaattaa

KEGG   Vulpes vulpes (red fox): 112919933
Entry
112919933         CDS       T05911                                 

Gene name
THBS1
Definition
(RefSeq) thrombospondin-1
  KO
K16857  thrombospondin 1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04015  Rap1 signaling pathway
vvp04115  p53 signaling pathway
vvp04145  Phagosome
vvp04151  PI3K-Akt signaling pathway
vvp04350  TGF-beta signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp05144  Malaria
vvp05165  Human papillomavirus infection
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05219  Bladder cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    112919933 (THBS1)
   04350 TGF-beta signaling pathway
    112919933 (THBS1)
   04151 PI3K-Akt signaling pathway
    112919933 (THBS1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112919933 (THBS1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112919933 (THBS1)
  09143 Cell growth and death
   04115 p53 signaling pathway
    112919933 (THBS1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112919933 (THBS1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    112919933 (THBS1)
   05205 Proteoglycans in cancer
    112919933 (THBS1)
  09162 Cancer: specific types
   05219 Bladder cancer
    112919933 (THBS1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112919933 (THBS1)
  09174 Infectious disease: parasitic
   05144 Malaria
    112919933 (THBS1)
Membrane trafficking [BR:vvp04131]
 Endocytosis
  Phagocytosis
   Opsonins
    112919933 (THBS1)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112919933 (THBS1)
Domain-containing proteins not elsewhere classified [BR:vvp04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   112919933 (THBS1)
SSDB
Motif
Pfam: TSP_C TSP_3 TSP_1 TSP1_spondin VWC EGF_3 cEGF EGF_CA TSP1_ADAMTS TSP1_CCN Laminin_G_3 Laminin_G_2 EGF Laminin_G_1
Other DBs
NCBI-GeneID: 112919933
NCBI-ProteinID: XP_025854228
UniProt: A0A3Q7SDJ4
LinkDB
Position
Unknown
AA seq 1170 aa
MGLAWALGVLLLLHVCAASRLPESGGDNSVFDVFELTGAARRGSGRRLVKGPDPSSPAFR
IEDANLIPPVPDDKFQDLVDAVRAEKGFLLLASLRQMKKTRGTLLAIERKDHSGQVFSVV
SNGRAGTLDLSLTVQGMQHVVSVEEALLATGQWKSVTLFVQEDRAQLYIDCEKMENAELD
VPIQSIFTRDLASVARLRIAKGGVNDNFQGVLQNVRFVFGTTPEAILRNKGCSSSTNVLL
TLDNNVVNGSSPAIRTNYIGHKTKDLQAICGISCDELSSMVLELRGLRTIVTTLQDSIRK
VTEENKELAIELRRPPLCYHNGVQYRNNEEWTVDSCTECRCQNSVTICKKVSCPIMPCSN
ATVPDGECCPRCWPSDSADDGWSPWSEWTSCSATCGNGIQQRGRSCDSLNNRCEGSSVQT
RTCHIQECDKRFKQDGGWSHWSPWSSCSVTCGDGVITRIRLCNSPSPQMNGKPCEGEARE
TKACKKDACPINGGWGPWSLWDICSVTCGGGVQKRSRLCNNPTPQFGGKDCVGDATENQI
CNKQDCPIDGCLSNPCFAGVKCTSYRDGSWKCGTCPPGYSGNGIQCKDVDECKEVPDACF
NHNGEHRCENTDPGYNCLPCPPRFTGPQPFGRGVEHATAHKQVCKPRNPCTDGTHDCNKN
AKCSYLGHYSDPMYRCECKPGYAGNGIICGEDTDLDGWPNEDLVCVANATYHCKKDNCPN
LPNSGQEDYDKDGIGDACDDDDDNDKIPDDRDNCPFHYNPAQYDYDRDDVGDRCDNCPYN
HNPDQADTDNNGEGDACAADIDGDGILNERDNCQYVYNVDQRDTDMDGVGDQCDNCPLEH
NPDQLDSDSDRIGDTCDNNQDIDEDGHQNNLDNCPYVPNANQADHDKDGKGDACDHDDDN
DGIPDDRDNCRLVPNPDQKDSDGDGRGDACKDDFDHDNVPDIDDICPENIDISETDFRRF
QMIPLDPKGTSQNDPNWVVRHQGKELVQTVNCDPGLAVGYDEFNAVDFSGTFFINTERDD
DYAGFVFGYQSSSRFYVVMWKQVTQSYWDTNPTRAQGYSGLSVKVVNSTTGPGEHLRNAL
WHTGNTPGQVRTLWHDPRHIGWKDFTAYRWRLSHRPKTGFIRVVMYEGKKIMADSGPIYD
KTYAGGRLGLFVFSQEMVFFSDLKYECRDS
NT seq 3513 nt   +upstreamnt  +downstreamnt
atggggctggcctgggcgctcggcgtcctgctcctgctgcacgtgtgcgccgccagccgc
cttccagagtctgggggagacaacagcgtgttcgacgtctttgaactcaccggggctgcc
cggaggggctccgggcgccggctggtgaagggtcctgacccctccagccccgctttccgc
atcgaggacgccaacctgatcccccccgtgcctgacgacaagttccaagacctcgtggat
gctgtgcgggcagagaaaggcttcctcctcttggcctccctgcggcagatgaagaagacc
cgaggcacactgctggccatagaacggaaagaccactctggccaggtcttcagcgtggtc
tccaacggcagagccggcaccctggacctgagcctgaccgtgcagggcatgcagcacgtg
gtgtcggtggaagaggcgctgctggccaccgggcagtggaagagcgtcaccctgttcgtg
caggaggacagggcccagctgtacattgactgtgagaagatggagaacgccgagctggat
gtccccatccagagcatcttcaccagggacctggccagcgtggccagactccgcatcgcg
aaaggaggggtcaatgacaacttccagggggtgctgcagaacgtgaggtttgtctttgga
accacaccagaagccattctcagaaacaaaggctgttccagttcgaccaacgtcctcctc
accctcgataacaatgtggtaaatggctccagccctgccatccgcactaactacatcggc
cacaagactaaggatctgcaagccatctgcggcatctcttgtgatgagctatccagcatg
gttctggaattgaggggcctgcgcaccatcgtgaccacacttcaggacagcatccgcaaa
gtgactgaagagaacaaagaactggccattgagctgaggcggcctcccctctgctaccac
aatggagttcagtacaggaacaatgaggagtggaccgtcgatagttgtaccgagtgccgc
tgtcagaactccgttaccatctgcaagaaggtgtcctgccccatcatgccctgctccaac
gccaccgttcctgacggagaatgctgcccacggtgttggcccagcgactctgcggatgat
ggctggtccccatggtccgagtggacctcctgctctgcgacatgtggcaacggaatccag
cagcgcgggcgctcctgtgatagtctcaacaaccgatgcgagggctcctccgtccagacg
cggacttgccacattcaggagtgcgacaagagatttaaacaggatggcggctggagccac
tggtccccgtggtcgtcttgttccgtgacgtgtggtgatggtgtgatcactagaattcga
ctctgcaattctcctagcccccagatgaacgggaaaccatgtgaaggcgaagcccgggag
accaaggcctgcaagaaagacgcctgccccatcaatggaggctggggtccctggtcactg
tgggacatctgttccgtcacctgtggaggaggggtgcagaaacgtagccggctctgcaac
aaccccacaccccagtttggaggcaaggactgtgtcggtgatgcgaccgaaaaccagatt
tgcaacaagcaggactgtccaattgatggatgcctgtccaatccctgctttgctggggtc
aagtgtactagttaccgcgatggcagctggaaatgtggaacttgccccccgggctacagc
gggaatggcatccagtgcaaagacgtggatgagtgcaaagaagtccctgacgcctgcttc
aaccacaacggagagcacaggtgcgagaacacggaccccggctacaactgcctgccctgc
ccaccacgcttcacaggcccgcagcccttcggccgcggtgtagaacatgccaccgcccac
aaacaggtgtgtaagccccggaacccctgcacagatgggacacatgactgcaacaagaat
gccaagtgcagctacctgggccactacagcgaccctatgtatcgctgcgagtgtaagccc
ggctatgcgggcaacggcatcatctgtggggaggacacagacctggacggctggccgaat
gaggacctggtgtgcgtggccaatgccacctaccactgcaaaaaggataactgccccaac
cttcccaactctgggcaggaagactacgacaaggacgggattggcgatgcctgtgatgac
gacgatgacaatgataaaatcccagacgacagggacaactgtcctttccattacaaccca
gcccagtatgactatgacagagatgacgtcggagaccgctgtgacaactgcccctacaac
cacaacccagatcaggctgacacggacaacaacggggaaggagatgcctgcgctgcagac
atcgatggggacggtatcctcaatgaacgtgacaactgtcagtatgtctacaacgtggac
cagagggacactgatatggatggggttggagatcagtgtgacaactgccccctggaacat
aatccagatcagcttgactctgactcagaccgcattggagatacctgtgacaacaatcag
gatattgatgaagacggccaccaaaacaacctggacaactgtccctatgtgcccaatgcc
aaccaggctgaccatgacaaagatggcaagggagatgcctgtgaccatgatgatgacaat
gatggcattcctgatgacagggacaactgcagacttgtgcccaatcctgaccagaaggat
tccgatggtgatggtcgaggggatgcttgcaaagacgattttgaccatgacaatgtgcca
gacattgatgacatctgtcctgaaaacattgatatcagtgagactgatttccgcagattc
cagatgattcctctagatcccaaagggacgtcccaaaatgaccctaactgggtggtacgt
catcagggtaaagaactcgtccagaccgtcaactgtgatcctggacttgctgtaggttat
gatgagttcaatgctgtggactttagtggcaccttcttcatcaacacagagagggatgat
gactatgctggatttgtgtttggctaccagtctagcagccgcttctatgtggtgatgtgg
aagcaagtcacacagtcctactgggacaccaaccccactcgggctcagggatactctggc
ctttccgtgaaagtcgtgaactctaccaccgggccaggcgagcacctgcggaatgccctg
tggcacacaggaaacacccctggccaggtgcgcactctgtggcatgaccctcgacacata
ggctggaaagatttcactgcctacagatggcgactcagccaccggcccaagacgggtttc
attcgcgtggtgatgtatgaagggaagaaaatcatggccgattcaggacccatctatgac
aaaacttatgctggtggtaggctagggttgttcgtcttctctcaagaaatggtgttcttc
tctgacctgaaatacgaatgcagagattcctaa

KEGG   Vulpes vulpes (red fox): 112921081
Entry
112921081         CDS       T05911                                 

Gene name
COL2A1
Definition
(RefSeq) collagen alpha-1(II) chain
  KO
K19719  collagen type II alpha
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04974  Protein digestion and absorption
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112921081 (COL2A1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112921081 (COL2A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112921081 (COL2A1)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    112921081 (COL2A1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112921081 (COL2A1)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112921081 (COL2A1)
SSDB
Motif
Pfam: Collagen COLFI VWC
Other DBs
NCBI-GeneID: 112921081
NCBI-ProteinID: XP_025855976
UniProt: A0A3Q7SKL1
LinkDB
Position
Unknown
AA seq 1487 aa
MIRLGAPQTLVLLTLLVAAVLRCHGQDVQKAGSCVQDGQRYNDKDVWKPEPCRICVCDTG
TVLCDDIICEDMKDCLSPETPFGECCPICSTDLATASGQPGPKGQKGEPGDIKDIVGPKG
PPGPQGPAGEQGPRGDRGDKGEKGAPGPRGRDGEPGTPGNPGPPGPPGPPGPPGLGGNFA
AQMAGGFDEKAGGAQMGVMQGPMGPMGPRGPPGPAGAPGPQGFQGNPGEPGEPGVSGPMG
PRGPPGPPGKPGDDGEAGKPGKSGERGPPGPQGARGFPGTPGLPGVKGHRGYPGLDGAKG
EAGAPGVKGESGSPGENGSPGPMGPRGLPGERGRTGPAGAAGARGNDGQPGPAGPPGPVG
PAGGPGFPGAPGAKGEAGPTGARGPEGAQGPRGEPGTPGSPGPAGASGNPGTDGIPGAKG
SAGAPGIAGAPGFPGPRGPPGPQGATGPLGPKGQTGEPGIAGFKGEQGPKGEPGPAGPQG
APGPAGEEGKRGARGEPGGAGPVGPPGERGAPGNRGFPGQDGLAGPKGAPGERGPSGLAG
PKGANGDPGRPGEPGLPGARGLTGRPGDAGPQGKVGPSGAPGEDGRPGPPGPQGARGQPG
VMGFPGPKGANGEPGKAGEKGLPGAPGLRGLPGKDGETGAAGPPGPAGPAGERGEQGAPG
PSGFQGLPGPPGPPGEGGKPGDQGVPGEAGAPGLVGPRGERGFPGERGSPGAQGLQGPRG
LPGTPGTDGPKGASGPAGPPGAQGPPGLQGMPGERGAAGIAGPKGDRGDVGEKGPEGAPG
KDGGRGLTGPIGPPGPAGANGEKGEVGPPGPAGTAGARGAPGERGETGPPGPAGFAGPPG
ADGQPGAKGEQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPG
AAGRVGPPGSNGNPGPPGPPGPSGKDGPKGARGDSGPPGRAGDPGLQGPAGPPGEKGEPG
DDGPSGPDGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGASGDRGPPG
PVGPPGLTGPSGEPGREGSPGADGPPGRDGAAGVKGDRGETGPVGAPGAPGPPGSPGPAG
PTGKQGDRGEAGAQGPMGPAGPAGARGIPGPQGPRGDKGEAGEAGERGLKGHRGFTGLQG
LPGPPGPSGDQGASGPAGPSGPRGPPGPVGPSGKDGANGIPGPIGPPGPRGRSGETGPAG
PPGNPGPPGPPGPPGPGIDMSAFAGLGQREKGPDPLQYMRADQAAGDLRQHDAEVDATLK
SLNNQIESIRSPEGSRKNPARTCRDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNMETG
ETCVYPNPASVPKKNWWSSKSKDKKHIWFGETINGGFHFSYGDDNLAPNTANVQMTFLRL
LSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSNDVEIRAEGNSRFTYTVLKDGCTK
HTGKWGKTMIEYRSQKTSRLPIIDIAPMDIGGPEQEFGVDIGPVCFL
NT seq 4464 nt   +upstreamnt  +downstreamnt
atgatccgcctcggggctccccagacgctggtgctgctgacgctgctcgtcgccgctgtc
cttcggtgtcacggccaggatgtccagaaggctggcagctgtgtgcaggacgggcagagg
tataatgataaggatgtgtggaagcccgagccctgccgaatctgtgtctgtgacactggg
actgtcctctgcgacgacataatctgtgaagacatgaaagactgcctcagccccgagacc
cccttcggagagtgctgtcccatctgctcaactgacctcgccactgccagtgggcaacca
ggaccaaagggacagaaaggagaacccggagacatcaaggatatcgtaggacccaaagga
cctcctggacctcagggacctgcaggtgaacaaggacccagaggtgatcgtggtgacaaa
ggtgaaaaaggcgcccctggacctcgtggcagagatggagagcctgggacccctggaaat
cctggcccccctggtcctcctggcccccctggcccccctggccttggtggaaactttgct
gcccagatggctggaggatttgatgagaaggctggtggcgcccagatgggggtgatgcaa
gggccaatgggccccatgggacctcgaggacctccaggccctgctggtgctcccggacct
caaggatttcaaggcaaccctggggaacccggggaacccggcgtctctggtcccatgggt
ccccgtggtcctcctggcccccctggaaaacctggtgatgatggcgaagctggaaagcct
ggaaaatctggtgaaagaggccctcctggccctcagggtgctcgcggcttcccgggaacc
ccaggccttcctggcgtcaagggtcacagaggctacccaggtctagatggtgctaaggga
gaagccggtgctccaggtgtgaagggagagagcggttcaccgggtgagaatggttctcca
ggcccaatgggtccccgcggcctgcccggagagagaggacggaccggtcctgctggtgct
gcgggcgcccgggggaacgatggccaaccaggccccgcgggccctccgggtcccgttggt
cctgccggtggtcctggcttccctggtgctcccggcgccaagggggaagctggccccact
ggcgcccgaggtcccgaaggcgctcaaggtcctcgcggcgagcctggcactcctgggtcc
cccgggccggctggtgcctctggtaaccccggaactgacggaattcctggagctaaagga
tctgctggtgctcctggcatcgctggcgcccccggcttccccgggccccgtggtccacct
ggccctcaaggtgcgactggtcctctgggcccgaaaggtcagacgggcgaacctggaata
gctggcttcaaaggcgaacaaggccccaagggcgagcccggccctgctggcccccaagga
gcccccggtcctgctggtgaagaaggcaaacgaggtgcccgtggagagcctggtggcgct
gggcccgttggtccccccggagaaaggggggctcctggcaaccgcggtttcccaggtcag
gatggtctggcaggtccaaagggagcccccggagagcgagggcccagcggccttgctggt
cccaagggagctaatggggaccccggccgtcccggagagcctggccttcctggagcccgg
ggtctcactggtcgccctggtgatgctggtcctcaaggcaaagttggtccttctggagcc
cctggtgaagatggtcgccccggacctccaggtcctcagggcgctcgtgggcagcctggt
gtcatgggtttccctggtcccaaaggtgccaacggcgagcctggcaaggctggtgagaag
ggacttcccggtgctcctggtctgagaggtcttccaggcaaagatggtgagactggtgct
gcaggaccccccggacctgctggacctgccggtgaacgaggcgagcagggtgctcctgga
ccatctgggttccagggacttcctggccctccgggtcccccaggcgaaggtggaaaacca
ggtgaccagggtgtccctggtgaagcgggagccccaggcctcgtgggtcccaggggtgaa
cgaggcttcccaggtgaacgtggttctcccggcgcccagggcctccaggggccccgtggc
ctccccggcactcctggcacagacggtcccaaaggcgcatctggcccggctggcccccct
ggggctcagggccctccaggtctgcaggggatgcccggtgagaggggcgcggctggcatc
gccgggcccaaaggagacaggggagacgttggtgagaaaggccccgagggagctcctgga
aaggacggaggacgaggcctgactggtcccattggcccccctggccccgctggcgccaat
ggtgagaagggagaagttggacctcctggtcctgcaggaaccgctggtgctcgtggcgcc
ccgggtgaacgtggagagactggaccccctgggcccgctggattcgcaggtcctcccggt
gctgatggccagccgggtgccaaaggcgagcaaggagaggccggccagaaaggcgatgct
ggtgccccaggtcctcagggcccctctggagctcctgggcctcagggtcctactggtgtg
actggtcctaaaggagcccgaggtgctcaaggccccccgggagccactggattccctgga
gctgctggccgcgtcggacccccaggctccaatggaaaccctggaccccctggtccccct
ggtccttctggaaaagatggtcccaaaggcgctcgaggagacagtggcccccctggccgc
gctggtgaccctggtctccaaggtcctgctggaccccctggcgagaagggagagcctgga
gatgatggtccctctggtcccgatggtcctccaggtccccagggtctggccggtcagagg
ggcatcgttggtctacctgggcagcgtggtgagagaggattccctggcttgcccggccca
tcgggtgagcccggcaagcagggagctcctggtgcatctggagaccgaggccccccaggc
cccgtgggtcctcctggtctgactggtccttctggtgaacctggacgagagggcagcccc
ggtgctgatggtcctcctggcagagatggtgcggctggagtcaagggtgatcgtggtgag
actggtcccgtgggtgctcccggagcccctgggccccctggctctcctggccccgccggc
ccaactggaaagcagggagaccgaggagaagctggtgcacaaggtcccatgggtcctgca
ggaccggctggagcccggggaatcccaggccctcaaggtccccgaggtgacaaaggagaa
gctggagaggctggcgagaggggactgaagggacaccgtggcttcactggtctgcaggga
ctgcccggccctcctggtccttctggagatcaaggtgcttctggccctgctggtccttct
ggccctagaggtcctcctggtcccgtcggtccctctggcaaagatggtgctaacggaatc
cctggccccatcggacctcctggtccccgtggacgttcaggcgaaactggccctgctggt
cctcccggaaaccccggaccccctggccctccaggtccccctggccctggcatcgacatg
tctgcctttgctggcctgggccagagagagaagggccccgaccccctgcagtacatgcgg
gctgaccaggcggccggcgacctgagacagcatgatgccgaggtggacgccacgctcaag
tccctcaacaaccagattgagagcatccgcagccccgagggctcccgcaagaaccccgct
cgtacctgccgggacctgaaactctgccaccctgaatggaagagcggagactactggatt
gaccccaaccagggctgcaccttggatgccatgaaggttttctgcaacatggagactggc
gagacgtgcgtctaccccaacccagcgagcgttcccaagaagaactggtggagcagcaag
agcaaggacaagaaacatatctggtttggagaaaccatcaatggtggcttccacttcagc
tacggtgatgacaacctggctcccaacactgccaacgtccagatgaccttcctccgcctg
ctgtccaccgagggctctcagaatatcacctaccactgcaagaacagcattgcctacctg
gacgaagcagccggcaacctcaagaaggccctgctcatccagggctccaatgatgtggag
atccgggctgagggcaacagcaggttcacatatactgttctgaaggatggctgcacgaaa
cacaccggtaagtggggcaagactatgatcgagtaccggtcacagaagacctcgcgcctc
cccatcattgacattgcgcccatggacataggagggcccgagcaggaatttggtgtggac
atcgggcctgtctgcttcttgtaa

KEGG   Vulpes vulpes (red fox): 112921712
Entry
112921712         CDS       T05911                                 

Gene name
LAMC1
Definition
(RefSeq) laminin subunit gamma-1
  KO
K05635  laminin, gamma 1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp05020  Prion disease
vvp05145  Toxoplasmosis
vvp05146  Amoebiasis
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112921712 (LAMC1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112921712 (LAMC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112921712 (LAMC1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112921712 (LAMC1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112921712 (LAMC1)
  09164 Neurodegenerative disease
   05020 Prion disease
    112921712 (LAMC1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112921712 (LAMC1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112921712 (LAMC1)
   05145 Toxoplasmosis
    112921712 (LAMC1)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Other DBs
NCBI-GeneID: 112921712
NCBI-ProteinID: XP_025856840
UniProt: A0A3Q7TNU9
LinkDB
Position
Unknown
AA seq 1594 aa
GRLWPLLAVLAAAAAGCARAAMDECTDEGGRPQRCMPEFVNAAFNVTVAATNTCGAPPEE
YCVQTGVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQTMLAGVQYPNSINL
TLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSCENTYSKANRGFIR
TGGDEQQALCTDEFSDISPLTGGNVAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVTLNR
LNTFGDEVFNDPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFDKLVCNCKHNTYGVD
CEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTGHGGHCTNCQGNTD
GANCERCRENFFRLASHEACSPCHCSPVGSLSTQCDSYGRCSCKPGVMGEKCDRCQPGYH
SLTEAGCRPCSCNPAGSIDECNVETGRCVCKDNVEGFNCERCKPGFFNLESSNPRGCTPC
FCFGHSSVCTNAVGYSVYSITSTFQIDEDGWRVEQRDGSEASLEWSSERQDIAVISDSYF
PRYFIAPAKFLGKQVWSYGQNLSFSFRVDRRDTRLSAEDLVLEGAGLRVSVPLIAQGNSY
PSETTVKYVFRLHEATDYPWRPPLSPFEFQKLLNNLTSIKIRGTYSERSAGYLDDVTLTS
ARPGPGVPATWVESCTCPVGYGGQFCEMCLSGYRRETPSLGPYSPCVLCTCNGHSETCDP
ETGVCDCRDNTAGPHCEKCSDGYYGDSTTGSSSDCQPCPCPGGSSCAVVPKTQEVVCTNC
PTGTTGKRCELCDDGYFGDPLGRNGPVRLCRLCQCNDNIDPNAVGNCNRLTGECLKCIYN
TAGFYCDRCKDGFFGNPLAPNPADKCRACACNPYGTVKQQSSCNPVTGQCECLPHVTGRD
CGACDPGFYNLQSGQGCERCDCHALGSTNGQCDIRTGQCECQPGITGQHCEHCEVNHFGF
GPEGCKPCDCHPEGSVSLQCKDDGRCECKQGFVGNRCDQCEENYFYNRSWPGCQECPACY
RLVKDKVADHRVKLQELENLIANLGTGEEVVTDQAFEDRLKEAEREVMDLLREAQDVKDV
DQNLMDRLQRVNSTLSSQISRLQNIRNTIEETGNLAEQARARVESTEQLIEIASRELEKA
KIAVANVSVTQPESTGDPNNMTLLAEEARKLAERHKQEADDIVRVAKTANDTSTEAYNLL
LKTLAGENQTALEIEELNRKYEQAKNISQDLEKQAARVHEEAKKAGDKAVEIYASVAQLT
PVDSEALENEANKIKKEAEDLDRLIDQKLKDYEDLREDMRGKELEVKKLLEKGKTEQQTA
DQLLARADAAKALAEEAAKKGRNTLQEANDILNNLKDFDRRVNDNKTAAEEALRRIPAIN
QTIIEANEKTREAQLALGNAAADATEAKSKAHEAERIASAVQKNATSTKAEAERTFAEVT
DLDNEVNNMLKQLQEAEKELKKKQDDADQDMMMAGMASQAAQEAEINARKAKNSVTSLLN
LINDLLEQLGQLDTVDLNKLNEIEGTLNKAKDEMKVSDLDRKVSDLENEARKQEAAIMDY
NRDIEEIMKDIRNLEDIKKTLPTGCFNTPSIEKP
NT seq 4785 nt   +upstreamnt  +downstreamnt
ggccggctctggccgctgctggcggtgctggcggccgccgcggccggctgcgcccgggcg
gccatggacgagtgcacggacgagggcgggcggccgcagcgctgcatgcccgagttcgtc
aacgccgccttcaacgtgaccgtggcggccaccaacacgtgcggggccccgcccgaggag
tactgtgtgcagaccggggtgaccggggtcaccaagtcctgtcacctgtgcgacgccggg
cagccccacctgcagcacggggcggccttcctgaccgactacaacaaccaggccgacacc
acctggtggcagagccagaccatgctggccggggtgcagtaccccaactccatcaacctc
acgctgcacctgggaaaagctttcgacatcacatatgtgcgcctcaagttccacaccagc
cgcccagagagctttgccatttacaagcgcacacgggaagatgggccctggattccttac
cagtactacagtggctcctgcgagaacacctactcaaaggcaaaccgtggcttcatcagg
acaggaggagatgagcagcaggccttgtgcaccgatgaattcagtgacatttcccctcta
actgggggcaacgtggccttttcgaccctagaaggaaggcccagtgcctacaactttgac
aatagccctgtgctgcaggaatgggtaactgctactgacatcagagtaactctcaatcgc
ctgaacacttttggagatgaagtgttcaacgaccccaaagttctcaagtcctattattac
gcaatctctgattttgctgtgggtggtaggtgtaaatgcaacggacatgcaagtgagtgt
gtgaagaatgaatttgacaagttggtgtgtaattgcaaacataatacttatggggtagac
tgtgaaaagtgtctgcctttcttcaacgaccggccgtggaggagggcaactgctgagagc
gccagcgaatgcctgccctgtgactgtaatggccgatcccaggagtgctactttgaccct
gaactatatcggtccaccggccatggtggccactgtaccaactgccagggtaacacagat
ggtgccaactgtgagaggtgccgggagaatttcttccgccttgcgagccatgaagcctgc
tctccatgtcactgtagtcctgtaggctctctcagcacacagtgtgatagctacggcagg
tgtagctgtaagccaggagtgatgggtgagaagtgtgaccgttgccagcctggataccat
tctctcactgaggcaggatgcaggccatgctcttgtaatcctgctggcagcatagatgaa
tgtaatgttgaaacaggaagatgtgtttgcaaagacaatgttgaaggcttcaattgtgag
agatgcaaacctggattttttaatctggaatcatctaatcctaggggttgcacaccctgc
ttctgctttgggcattcttctgtctgtacaaatgctgtcggctacagtgtttattcgata
acctctacctttcagatcgatgaagacgggtggcgtgtggaacaaagggacggctctgaa
gcatcactggagtggtcctctgagaggcaggatattgccgtcatctcagatagctacttt
cctagatacttcattgctcctgcaaagttcttgggcaagcaggtgtggagttatggtcag
aacctctccttctcctttcgagtggacaggcgagatactcggctctctgcagaagacctg
gtgctggagggagctggcctgagagtgtctgtgcccctgattgctcagggcaattcctat
ccaagtgagaccactgtgaaatatgtcttcaggctccatgaagcaacagattacccttgg
aggcctcctcttagcccttttgaatttcagaagctcctaaacaatttgacctcaatcaaa
atccgtgggacctatagtgagagaagtgctggatatttggatgatgtcaccctaacaagc
gctcgccctgggcccggggtgcctgccacctgggtggagtcctgcacctgtccggtggga
tatggagggcagttttgtgagatgtgcctctcaggttacagaagagaaactccgagtctc
gggccatacagtccatgcgtgctttgtacctgcaatggacacagtgagacctgtgaccct
gagacaggtgtttgtgactgcagagacaatacagctggcccccactgtgagaagtgcagt
gatgggtactatggagattcaaccacgggctcctcctccgattgtcagccctgtccatgt
cctgggggctccagttgtgccgtcgtccctaagacccaggaagtggtgtgcaccaactgt
cctactggcaccaccggtaaaaggtgtgagctctgtgatgatggctactttggagacccc
ctgggtagaaatggccctgtgaggctttgccgcctctgccaatgcaatgacaacatcgat
cccaatgcagttggaaattgcaatcgcttgacaggagaatgcctgaaatgcatctataac
actgctggcttctactgtgaccgatgcaaagacggattttttggaaatcccctggctccc
aatccagcagacaaatgcagagcttgcgcttgcaatccctatggaaccgtaaagcagcag
agcagctgtaaccccgtgacagggcagtgcgaatgtctgccccacgtgaccggccgggac
tgtggagcctgtgaccctggattctacaacctgcagagtgggcagggctgtgagaggtgc
gactgccatgcattgggttccaccaacgggcagtgtgacatccgcactggccagtgtgag
tgccagcctggcatcaccggtcagcactgtgagcactgtgaggtcaaccactttggattt
ggacctgaaggctgcaaaccctgtgactgtcatcctgagggatctgtttcactccagtgc
aaagatgatggtcgctgtgagtgcaaacagggttttgtgggaaatcgttgtgaccagtgt
gaagagaactatttctacaatcggtcttggcctggctgccaggagtgtccagcatgctac
cggctggtaaaggataaggttgctgaccatcgagtgaaactccaggaattagagaatctc
attgcgaaccttggaactggggaagaggtggtgacagatcaagcctttgaggacagactg
aaggaggcagagagagaggttatggacctcctgcgagaggcccaggatgtcaaagatgta
gaccagaatttgatggaccgcctccagagagtgaatagcacgttatccagccaaattagc
cgtttacagaatatccgtaataccattgaagagactggaaacttggccgagcaagcacgt
gccagggtagaaagcacagagcagttgattgaaatcgcatcccgagaactggagaaagca
aagattgctgttgccaatgtgtcagtcactcagccagagtctacaggggacccaaacaac
atgactcttttggcagaagaagcacgaaagcttgctgaacgccataaacaagaagctgat
gatattgtaagagtggcaaagacagctaatgatacatcaactgaggcatataatctgctt
ctgaaaacactggcaggagaaaatcaaacagcacttgagattgaagagcttaatagaaag
tatgaacaagcaaagaacatctcacaggatctggagaagcaagctgctcgagtacatgag
gaggccaagaaggctggagataaagccgtggagatctatgccagcgttgcccaactgaca
cctgtggactcagaagcactagagaatgaggccaataaaataaagaaggaagctgaggat
ctggaccgtctgattgaccagaaattgaaagattatgaggacctcagagaagacatgaga
gggaaggaacttgaagtcaagaagcttctggagaagggaaagaccgaacaacagactgct
gaccagctcctggcccgagcagatgctgccaaggctcttgcggaagaagctgctaaaaag
ggacgaaataccttacaggaagccaatgacattctcaacaacctgaaagatttcgatagg
cgagtgaatgacaacaagactgctgcagaggaggctttacggaggattcctgccatcaac
cagaccatcattgaagccaatgaaaagacaagggaggcgcagctggcgctgggcaatgca
gctgcagacgctactgaagccaagagcaaagcccatgaggcagagaggatcgccagcgct
gtccagaagaatgctaccagcaccaaggcagaagcagaaaggacttttgcagaagttaca
gacctggataatgaggtgaacaatatgttgaaacaactgcaggaagcagaaaaggagctg
aagaaaaaacaagatgatgctgaccaggatatgatgatggcagggatggcttcccaggct
gctcaggaagctgagatcaatgccagaaaggccaagaactccgttaccagcctcctcaac
ctgattaatgacctcctggagcagctggggcaactggacacagtggacctgaacaagcta
aatgagatcgaaggcaccctgaacaaagccaaagatgaaatgaaagtcagtgatctagac
aggaaagtgtctgatctggagaatgaagccaggaagcaggaggctgccatcatggactat
aatcgagatatcgaggagatcatgaaggacattcgcaacctggaagacatcaagaagacc
ctaccgactggctgcttcaataccccgtccattgagaagccctag

KEGG   Vulpes vulpes (red fox): 112921730
Entry
112921730         CDS       T05911                                 

Gene name
TNN
Definition
(RefSeq) tenascin-N
  KO
K06252  tenascin
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp05165  Human papillomavirus infection
vvp05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112921730 (TNN)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112921730 (TNN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112921730 (TNN)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    112921730 (TNN)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112921730 (TNN)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112921730 (TNN)
SSDB
Motif
Pfam: fn3 Fibrinogen_C DUF4998 Pur_ac_phosph_N EGF_2 EGF_Tenascin
Other DBs
NCBI-GeneID: 112921730
NCBI-ProteinID: XP_025856847
UniProt: A0A3Q7T885
LinkDB
Position
Unknown
AA seq 1409 aa
MGLQGTFCFPLGLLLGSVLLVASAPATLEPQGCSDKEQQVTVSHTYKIDVPKSALVQVET
DPQPLSDDGASLLVPGEAEEQNIIFRHNIRLQTPQKDCELAGSVQDLLARVKKLEEEMAE
VKEQCNVQRCCQGARPACPGACSGHGVCVRGVCRCHEDFTSEDCSERRCPGDCSGHGFCD
TGECYCEEGFGGLDCAQGASPQGLQLLKSTENSLLVSWEPSSEVDHYLLSYYPLGQELSG
KQIQVPKEQHSYEILGLQPGTKYIVTLRNVKKEVSSSPQHLLATTDLAVLGTAWVTDETE
NSLDVEWENPPTEVDYYKLQYGPLTGQEVAEVTVPKSSDPKSRYDITGLQPGTEYRITVV
PMKGELEGKPILLNGRTEIDSPTNVVTDRVTEDTAVVSWAPVQATIDKYVVRYTSTDGDT
RDMAVPKEQSSTVLTGLKPGEAYRVYVWAERGNQESKKANTDALTEIDSPTNLATDRVTE
DTATVSWDPVQAIIDKYMVRYTSADGDTREVPVGKEQSSTVLTGLRPGVEYTVQVWAQKG
ARESKKADTKAPTEIDSPKNLVTDRVTEDTATISWDPVRAVIDKYMVRYTSADGDTREVP
VGKEQSSTVLTGLRPGVEYTVQVWAQKGARESKKADTKAPTDIDSPTNLVTDRVTENTAT
ISWDPVQAIIDKYMVRYTSADGDMKEVPVGKEESSTVLMGLRPGVEYTVQVWAKKGAQES
KKADTKAPTDIDSPTNLVTDRVTEDTATISWTPVQAIIDKYMVRYTSADGDTREVPVGKE
QSSTVLTGLRPGVEYTVQVWAQKGARESKKADTKAPTEIDSPKNLVTDRVTEDTATISWD
PVRAVIDKYMVRYTSADGDTREVPVGKEQSSTVLTGLRPGVEYTVQVWAQKGARESKKAD
TKAPTDIDSPKNLVTNQVTENTATISWDPVQAIIDKYMVRYTSADGDTREVPVGKEQRST
VLTGLRPGVEYTVQVWAQKGARESKKADTKAPTEIDSPQNLVTNRVTEDMATISWDPVRA
VIDKYMVRYTSADGDTREVPVGKEQSSTVLTGLRPGVEYTVQVWAQKGARESKKADTKAL
TDIDPPKNLRPSAITQSGGVLTWTSPSAQIDGYILTYQFPDGTIKEKQLGRGDERLELQG
LEQGITYPVSLIAFKGDRRSRSVSTTLSTVGARFPHPSDCSQVQQNSNVVSGLYTIYLHG
DASRPLQVYCDMDTDGGGWIVFQRRNTGQLDFFKRWRTYVEGFGDPMKEFWLGLDKLHNL
TTGTPTRYEVRVDLQTANESAYAIYDLFQVASSKERYRLTVGKYRGTAGDALTYHNGWKF
TTFDRDNDIALSNCALTHHGGWWYKNCHLANPNGRYGETKHSEGVNWEPWKGHEFSIPYV
ELKIRPHGYSGEHVLDRKKRTLGENSRTF
NT seq 4230 nt   +upstreamnt  +downstreamnt
atgggtctccaggggacattctgcttccccctggggctcctacttggctctgtgcttttg
gtggcgtcagccccagccactctcgagcctcagggctgcagtgacaaggagcaacaggtc
acggtcagtcacacctacaagatcgatgtgcccaagtctgctctggtccaggtggaaact
gaccctcagccccttagtgatgatggggcctcgctcctggtccccggggaggctgaggaa
cagaacatcatctttaggcacaacatccgcctgcagacaccacagaaggactgtgagctg
gcaggcagcgtccaagacctcctggcccgggtgaagaagctggaggaagagatggcggag
gtgaaggagcagtgtaacgtccagcgctgctgccaaggagctcggcccgcctgccccggg
gcctgcagcggccacggcgtgtgcgtgcgcggcgtgtgcaggtgccacgaggacttcacg
tccgaggactgcagcgagcggcgctgccccggcgactgcagcggccacggcttctgcgac
acgggcgagtgctactgcgaggagggcttcggcggcctggactgcgcgcagggtgcgagc
ccccagggcttgcagctgctcaagagcaccgagaattccctgctggtgagctgggagccc
tccagcgaggtggaccactacctcctcagctactaccctctggggcaggagctctctggg
aagcagatccaggtgcccaaggagcagcacagctatgagatccttggtttgcagcctgga
accaagtacatagttaccctgcgcaacgttaagaaagaagtttccagcagcccacagcat
ctgcttgccaccacagatcttgctgtgcttggcaccgcatgggtgacagatgagactgag
aactctctggatgtggaatgggagaaccccccgactgaggtagactactacaagctgcag
tatggccccctgacaggacaggaggtggccgaggtcaccgtgcccaagagcagtgacccc
aagagccgatatgacatcactggtctgcagcctgggacagagtataggatcaccgtggtg
cccatgaaaggagaactggagggcaagccgattctcctgaatggcaggacagaaattgat
agtccaaccaatgtggtcactgatcgtgtgacagaagacacagcggtggtctcctgggcc
ccagtccaggccaccatagataagtacgtggtgcgctatacctccactgatggggatacc
agggacatggcggtacccaaggagcagagcagcactgtcctgacgggcttgaagccggga
gaggcatacagggtctacgtgtgggctgagaggggcaaccaggagagcaagaaggccaac
actgacgccctcacagaaattgatagcccaacaaacctggccactgaccgggtgacagag
gacacggccaccgtctcctgggacccagtgcaggccatcatcgacaagtacatggtgcgc
tatacgtctgctgatggggacaccagggaggttccagtggggaaggagcagagcagcact
gtcctgacgggcctgaggccgggtgtagagtacacggtccaggtgtgggcccagaagggg
gcccgggagagcaagaaggctgacaccaaggccccaacagaaattgacagccccaaaaac
ctggtgactgaccgggtgacagaggacacagccaccatctcctgggacccggtgcgagcg
gtcatcgacaagtacatggtgcgctacacgtctgctgatggggacaccagggaggttcca
gtggggaaggagcagagcagcactgtcctgacgggcctgaggccaggtgtggagtacacg
gtccaggtgtgggctcagaagggggcccgggagagtaagaaggctgacaccaaggcccca
acagacattgacagcccaacaaacctggtgactgaccgggtgacagagaacacggccacc
atctcctgggacccagtgcaagcaatcattgacaagtacatggtgcgctatacatctgct
gatggggatatgaaggaggttccagtggggaaggaggagagcagtactgtcctgatgggc
ctaaggccaggtgtggagtacacagtccaggtgtgggccaagaagggggcccaggagagt
aagaaggccgacaccaaggccccaacagacattgacagcccaacaaacctggtgaccgac
cgggtaacagaggacacggccaccatctcctggactcccgtgcaggccatcatcgacaag
tacatggtgcgctatacgtctgctgatggggacaccagggaggttccagtggggaaggag
cagagcagcactgtcctgacgggcctgaggccaggtgtggagtacacggtccaggtgtgg
gcccagaagggggcccgggagagcaagaaggctgacaccaaggccccaacagaaattgac
agccccaaaaacctggtgactgaccgggtgacagaggacacagccaccatctcctgggac
ccggtgcgagcggtcatcgacaagtacatggtgcgctacacgtctgctgatggggacacc
agggaggttccagtggggaaggagcagagcagtactgtcctgacgggcctgaggccaggt
gtggagtacacggtccaggtgtgggctcagaagggggcccgggagagtaagaaggctgac
accaaggccccaacagacattgacagccccaaaaacctggtgaccaaccaggtgacagag
aacacggccaccatctcctgggacccggtgcaggccatcatcgacaagtacatggtgcgc
tacacgtctgctgatggggacaccagggaggttccagtggggaaggagcagagaagcacc
gtcttgacgggcctgaggccaggtgtggagtacacggtccaggtgtgggctcagaagggg
gcccgagagagtaagaaggctgacaccaaggcaccaacagaaattgacagcccccaaaac
ctggtgaccaaccgggtgacagaggacatggccaccatctcctgggacccggtgcgagca
gtcatcgacaagtacatggtgcgctacacgtctgctgatggggacaccagggaggttcca
gtagggaaggagcagagcagcactgtcctgacgggcctgaggccaggtgtggagtacacg
gtccaggtgtgggcccagaagggggcccgggagagcaagaaggctgacaccaaggccctg
acagacatcgaccctcccaaaaaccttcgtccatctgctataacacagtctggaggggtg
ttgacctggacatccccctctgctcagattgatggctacattctcacctaccaattccca
gatggcaccattaaggagaaacagcttggaagaggggatgagaggctcgagctgcaaggc
cttgagcagggcatcacctaccctgtctccttgatcgcctttaagggtgatcgccggagc
aggagtgtctccaccaccctttccacagttggtgcccgctttccacatccttcagactgc
agtcaagttcaacagaacagcaatgttgtcagcggtctatacaccatctacctgcatggt
gacgccagccggcccctgcaggtgtactgcgacatggacacggatggaggcggctggatt
gtcttccagaggcgcaacactgggcagctggatttcttcaaacgctggcgcacctacgtg
gaaggtttcggggaccccatgaaggagttctggcttggacttgacaagctacacaatctc
accactggcaccccgacccggtatgaagtaagagtggacctacagactgccaacgaatct
gcctatgccatatatgatttattccaagtggcttccagcaaggagaggtacaggctcaca
gtcgggaaatacagaggcacagcaggggatgctcttacttaccacaatggatggaagttt
acaacttttgacagagacaatgatattgccctcagcaactgtgccctgacacatcatggt
ggctggtggtacaagaactgccacttggccaaccccaatggcagatatggggagaccaaa
cacagtgagggggtgaactgggagccatggaaaggacatgaattctccattccttacgtg
gagctgaaaatccgccctcatggctacagcggggagcatgtcctggacagaaagaagcgg
acactgggagaaaattcgagaacgttctga

KEGG   Vulpes vulpes (red fox): 112921807
Entry
112921807         CDS       T05911                                 

Gene name
LAMC2
Definition
(RefSeq) laminin subunit gamma-2 isoform X1
  KO
K06246  laminin, gamma 2
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp05145  Toxoplasmosis
vvp05146  Amoebiasis
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112921807 (LAMC2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112921807 (LAMC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112921807 (LAMC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112921807 (LAMC2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112921807 (LAMC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112921807 (LAMC2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112921807 (LAMC2)
   05145 Toxoplasmosis
    112921807 (LAMC2)
SSDB
Motif
Pfam: Laminin_EGF Laminin_B Alanine_zipper
Other DBs
NCBI-GeneID: 112921807
NCBI-ProteinID: XP_025856941
UniProt: A0A3Q7SN19
LinkDB
Position
Unknown
AA seq 1194 aa
MPALWLRCGLCLALLLPAARASSGSQVCDCNGKSRQCVFDQELHRQTGNGFRCLNCNDNT
DGPRCEHCKDGFYRQRERDRCLPCNCHTKGSLSARCDNSGRCSCKPGVTGDRCDRCLPGF
HTLTDAGCTQDQRLLDPKCDCDPAGISGPCDEGRCVCKPAVTGERCDRCRPGYYHLDGGN
PEGCTQCFCYGHSANCHSSGDYSVHKITSTFHQDVDGWKAIQRNGSPAKLQWSQRHRDVF
SSARRSDPVYFVAPAKFLGNQQVSYGQTLSFDYRVDRGGRHPSAHDVILEGAGLRVTAPL
MPRGKTLPCGITKTYTFRLNERPSSQWSPQLSYFEYRRLLRNLTALRIRATYGEYSTGYL
DNVTLISARPVSGAPAPWVEQCVCPVGYKGQFCQDCASGYKRDSAQLGPFGTCIPCNCQG
GGACDPDTGDCYSGDENLDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVV
CNNCPHGVTGARCELCADGYFGDPFGERGPVRPCQPCQCNNNVDPSASGNCDRLTGRCLK
CIYNTAGVHCDQCKAGYFGDPLAPNPADKCRACNCNPAGSEPGECRSDGSCVCKPGFGGL
NCEHAALTSCPACYNQVKIQMDQFMQQLQSLEALVSRVQGGGGAAPDAELEGRMQQAEQA
LQELLREAQISEGASKSLSLQLVKARREEESYRNRLDDLKMMVERIRVLDSQYQNRVQDT
RRLVTQMQLSLEESTASLRNTNIPSSDHYVGPNGFKSLAQEAVRLADSHVASASNMERLV
RETEDYSKQALALAHKALREGGGGGGGGGLDGSAAQGLMGRLEKARSLAQQLSAEAAQTD
VEADRSYRQGLRLLDSASRLQQVSGRAVQVEMKRIRQNVDSLSSLVTRRMDEFKHVQSNL
GNWEEETQQLLRNGKSGRQKADQLLSRANLAKSRAQEALSMGNATFYEVENILKNLREFD
LQVEDRKAEAEEAMKRLPYISQKVADASDKTRQAETALGGAAADAQRAKTAAREALEITD
KIEQEIGSLNLEANVTADGALAMEKGLATLKSDMREVEGELARKEQEFDLDMDAVQMVIT
EAQRVDNRAKNAGATIQDTLNTLDSILHLINQPGSVDEEKLILLEQNLFRAKTQINSRLR
PLMSELEERARRQQGHLHLLETSIDGILADVKNLENIRDNLPPGCYNTQALEQQ
NT seq 3585 nt   +upstreamnt  +downstreamnt
atgcctgcgctctggctgcgctgcggcctgtgcctggcgctgctgctgcctgcggcccgg
gcctcctccgggagccaagtctgtgattgcaatgggaagtccaggcagtgcgtcttcgat
caggagcttcacagacaaacaggaaatggattccgctgtctcaactgcaatgacaacaca
gatggccctcgctgtgagcactgcaaggacgggttctaccgacagagggagagggatcgc
tgcttgccctgcaactgtcacaccaaaggttctcttagcgcccgatgtgacaactctgga
cggtgcagctgtaagccaggggtaacaggagacaggtgcgaccgctgcctgccaggcttc
cacacactcaccgatgccggctgcacccaagaccagaggctactagaccccaagtgtgac
tgtgacccagctggcatctcggggccctgtgacgagggccgctgtgtctgcaagccagct
gtcaccggcgagcgctgtgacaggtgtcgaccaggttactatcatctggatgggggaaac
ccggagggctgtacccagtgtttttgctatgggcattcagccaactgccacagctctgga
gattacagtgtccataaaatcacctcaactttccatcaagatgttgatggctggaaagct
atccaaagaaatgggtctcctgcaaagctccagtggtcacagcgccatcgggacgtgttc
agctcagcacgacgatcagaccctgtctattttgtagctcctgccaaatttcttgggaat
caacaggtgagctatgggcaaaccctgtcttttgactaccgcgtggacaggggaggcaga
cacccatctgcccacgatgtgatcctggaaggtgctgggctacgagtcacagctcccttg
atgccacgtggcaagacgctaccttgtgggatcaccaagacgtacacattcagattaaat
gaacgtccaagcagtcagtggagccctcagctaagttacttcgagtatcggaggttactg
cggaacctcacggccctgcggatccgagctacttacggagaatacagcactgggtacctc
gacaacgtgaccctgatttcagcccgccccgtctctggagcccccgcaccctgggtcgaa
caatgcgtatgtcccgttggctacaagggacagttctgtcaggattgtgcttctggctac
aaaagagattccgcccaactgggaccttttggcacctgtattccatgtaattgccagggg
ggaggagcctgtgatccggacacaggagactgttattcaggggatgaaaatcttgacatc
gagtgtgccgactgccccattggtttctacaacgatccacacgaccctcgcagctgcaag
ccgtgtccctgccacaatgggttcagctgctctgttatgccggagacagaagaggtggtg
tgcaataactgtccccacggggtcaccggggcccgctgtgagctctgtgccgatggctac
tttggggacccctttggagaacgtggcccagtgcggccttgtcagccctgtcagtgcaac
aacaacgtggaccccagtgcctctgggaactgcgaccggctgacaggcaggtgtctgaag
tgcatctacaacacagcaggcgtccactgtgaccagtgcaaagcgggctactttggggac
cccttggctcccaacccagcggacaagtgtcgagcttgcaactgcaacccagcagggtca
gagcctggggaatgtagaagtgatggcagctgtgtctgcaagccaggatttggtggcctc
aactgtgagcatgcagcactaaccagctgtccagcttgctataatcaagtgaagattcag
atggatcagtttatgcagcagctccagagcctggaggccctggtttccagggtgcagggt
ggtggtggagcggcgccggacgcagagctggaaggcaggatgcaacaggccgagcaggcc
cttcaggagcttctgagagaagcccagatttcagaaggtgctagtaaatctctcagtctc
cagttggtgaaggccagaagggaagaagagagctaccggaaccgcctggatgacctcaag
atgatggtggaaagaatccgggtcctggacagtcagtatcagaaccgagttcaggatact
cgaagactggtcacacagatgcagctaagcctggaggagagcacggcctccctgagaaac
actaacattccttcctcagatcactacgtggggccaaatggttttaaaagtctggctcag
gaggccgtaagattggcagacagccacgtggcgtccgccagtaacatggagcggctggta
agggaaaccgaggactattccaaacaggcgctggcgctggcgcacaaggccctgcgggaa
ggcggcggcggcggcggcggcggcggcttggacggctcagcggcgcaagggctgatggga
aggttggagaaggccaggtcgctggcccagcagctgtcggcggaggcggcgcagaccgac
gttgaggcagacaggtcctatcggcaaggcctgcgccttctcgattccgcgtctcggctg
cagcaagtcagcggccgggctgttcaggtggaaatgaagaggattagacaaaacgttgat
tctctctcaagccttgtgaccaggcgtatggatgagttcaagcatgtgcaaagcaacctg
ggaaactgggaagaagaaacccagcagctcttacggaatggaaagagtggaagacagaaa
gcagatcagctgctttcccgtgccaaccttgctaaaagcagagcccaagaagcactaagt
atgggcaatgccactttttatgaagttgagaacatcctaaagaacctcagagagtttgac
ttgcaggttgaagacagaaaagcagaagcagaagaggccatgaaaagactcccttacatc
agccagaaggtcgcagatgccagtgacaagaccaggcaagcagaaacagccctgggcggt
gctgctgccgacgcccagagggcaaagaccgcagccagggaggccctggagatcaccgac
aagatagaacaggaaatagggagtctgaacttggaagccaatgtgacagcagatggagcc
ttggccatggagaagggactggctactctgaagagcgacatgagggaagtggaaggagaa
ctggcaaggaaggagcaagagtttgacctggatatggatgcagtgcagatggtaattaca
gaagcccaaagagttgataacagagccaagaatgctggagctacaatccaagacacactc
aacacattggacagcatcctacacctaataaatcagcctggcagtgtggatgaagagaag
ctgatcttattggagcagaacctcttccgggccaagactcagatcaacagccggctgagg
cccttgatgtcagagctggaagagagagcacgccgacagcagggccacctccatttgcta
gagacgagcatagatggcattctggctgacgtgaagaacctggagaacataagggacaac
ctgcccccaggctgctacaatacccaggctcttgagcaacagtga

KEGG   Vulpes vulpes (red fox): 112921850
Entry
112921850         CDS       T05911                                 

Gene name
TNR
Definition
(RefSeq) tenascin-R
  KO
K06252  tenascin
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp05165  Human papillomavirus infection
vvp05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112921850 (TNR)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112921850 (TNR)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112921850 (TNR)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    112921850 (TNR)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112921850 (TNR)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112921850 (TNR)
SSDB
Motif
Pfam: fn3 Fibrinogen_C EGF_Tenascin EGF_2 Pur_ac_phosph_N
Other DBs
NCBI-GeneID: 112921850
NCBI-ProteinID: XP_025857034
UniProt: A0A3Q7SAU6
LinkDB
Position
Unknown
AA seq 1361 aa
MGVDGETVVLKNMLIGVNLILLGSLLKPSECQLEVTTERVQGQAVEEEGGAASYNASGKE
QPVVFNHVYNINVPLDSLCSSGLEASAEQDVSAEDEALAQYTGQTSDRESQVTFTHKINL
PKKACPCASSARVLQELLNRIEMLEREVSLLRDQCTTNCCPLTFSLTVPGQLDYIPHCSG
HGNFSLQSCGCICNEGWFGKNCSEPYCPLGCSSRGVCVDGQCVCDSEYSGGDCSELRCPT
DCSSRGLCVDGECVCEEPYTGEDCSELRCPGDCSGQGRCANGTCFCQEGYMGEDCSQRQC
LNACSGRGHCQEGLCFCEDGYLGPDCSAVAPPEDLRVAGISDRSIELEWDRPMAVTEYVI
SYQPMALGGLQLQQRVPGDWSGVTITELEPGLTYNISVYAVISNILSLPITAKVATHLST
PQGLHFKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQLPSDVTSFNQTGLKPG
EEYIVNVVALKEQARSPPTSASVSTVIDGPTQILVRDVSDTVAFVEWTPPRAKVDFILLK
YGLVGGEGGKTTFRLQPPLSQYSVQALRPGSRYEVWVSAVRGANESQSTTTQFTTEIDAP
KNLRVGSHTATSLDLEWDNSEAEVQEYKVVYSTLAGEQYHELLVPKSVGPTTRATLTDLV
PGTEYGVGISAVMNSQQSVPATMNARTELDSPRDLMVTASSETSISLIWTKASGPIDHYR
ITFTPSSGIASEVTVPKDRTSYTLTDLEPGAEYIISITAERGRQQSFESTVDAFTGFRPI
SHLHFSHVTSSSVNITWSDPSPPADRLILNYSPRDEEEEMTEVSLDATKRHTVLMGLQPA
TEYIVNLVAVHGTVTSEPIVGSITTGIDPPKDITISNVTKDSVMVSWSPPVAPFDYYRVS
YRPTQVGRLDSSVVPNTVTEFTITKLYPATEYEISLNSVRGREESERICTLIHTAMDNPV
DLTATNITPTEALLQWKAPVGEVENYVIILTHFAVAGETILVDGGSEEFQLVGLLPSTHY
TVSMYAASGPLTSGTISTNFSTLLDPPANLTASEVTRQSALISWQPPRAEIENYILTYKS
TDGSRKELIVDAEDTWIRLEGLSESTDYTVLLQAAQDTARSSLTSATFTTGGRVFPHPQD
CAQHLMNGDTLSGVYTIFLNGELSRKLQVYCDMTTDGGGWIVFQRRQNGQTDFFRKWAEY
RVGFGNLEDEFWLGLDNIHRITSQGRYELRVDMRDGQEAAFAYYDKFSVEDARSLYKLRL
GGYNGTAGDSLSYHQGRPFSTEDRDNDVAVTNCAMSYKGAWWYKNCHRTNLNGKYGESRH
SQGINWYHWKGHEFSIPFVEMKMRPYNHRLPAGRKRRSLQF
NT seq 4086 nt   +upstreamnt  +downstreamnt
atgggggtggacggggaaacggtggtcctgaagaacatgctcattggcgtcaaccttatc
ctcctgggctctctgctcaagccctccgagtgtcagctggaggtcaccaccgaaagggtc
cagggacaggcggtggaggaggaaggaggggcggccagctacaacgcctcgggcaaagag
cagccggtggtcttcaaccacgtgtacaacatcaacgtgcccctggacagcctctgctcc
tcggggctggaggcctcggccgagcaggacgtgagcgccgaagatgaggcgctggcgcag
tacacgggccagacgtccgaccgcgagagccaggtcaccttcacccacaagatcaacctc
cccaaaaaggcctgcccgtgcgccagctcggcccgggtgctgcaggagctgctgaatcgg
atcgagatgctggagagggaggtgtcgctgctgcgggaccagtgcaccaccaactgctgc
cctttgaccttctccttgactgttccaggacaactggactacatccctcactgtagtggc
cacggcaactttagcctccagtcctgcggctgcatctgcaatgaaggctggttcggcaag
aactgctccgagccctactgcccgctgggctgctccagccggggcgtatgtgtggacggc
cagtgcgtctgtgacagcgagtacagcgggggcgactgctctgagctccggtgcccgaca
gactgcagctcccgggggctctgcgtagatggagagtgtgtctgtgaagagccctacaca
ggcgaggactgcagtgagctgaggtgccccggggactgttcggggcaggggagatgcgcc
aatggcacctgcttctgccaggagggctacatgggggaggactgcagtcaacggcagtgt
ctgaacgcctgcagcgggcgaggacactgccaggaggggctttgcttctgtgaagacggc
tacctgggccctgactgttcggcagttgcccctccagaggacttgcgagtggctggtatc
agcgacaggtccattgagctggaatgggacaggccgatggcagtgacggaatatgtgatc
tcttaccagccgatggccctggggggcctccagctccagcagcgggtacctggagattgg
agtggtgtcaccatcacggagctggagccaggtctcacctacaacatcagcgtctacgct
gtcattagcaacatcctcagccttcccatcactgccaaggtggccacccatctctccact
cctcaagggctacacttcaagacgatcacagagactaccgtggaagtgcagtgggagccc
ttttcattctcctttgatgggtgggagatcagcttcattccaaagaataatgaaggaggg
gtgattgctcagctccccagtgatgttacatccttcaatcagacgggactaaagcctggg
gaggaatacattgtcaatgtggtggctctgaaagagcaagcccggagcccccctacctcg
gccagcgtctctactgtcattgatggacccacacagatcctggttcgagatgtctcagac
actgtggccttcgtggagtggaccccacctcgagccaaagtcgatttcattctcttgaag
tacggcttggtgggtggggaaggtgggaagaccaccttccggctacagcctcccctgagt
caatactcagtgcaggccctacggccagggtcccgctatgaggtgtgggtcagcgctgtc
cgtggtgccaacgagagccagtccacgaccacccagttcaccacagagattgatgccccc
aagaacctgagagtgggctcccacacggcaaccagccttgacctcgagtgggacaacagc
gaagcagaggtccaggaatacaaagttgtgtatagcaccctggcgggtgagcagtaccac
gagctgctggtccccaagagcgtgggtcccaccacccgagccacactcacagatctggtg
cctggcacggagtatggagttggaatatctgctgtcatgaactcacagcaaagtgtgcca
gccaccatgaatgccaggactgaacttgacagtccccgggacctcatggtgactgcctcc
tcggaaacctccatctccctcatctggaccaaggccagtggccccattgatcactaccga
attacctttaccccatcctccgggattgcctcagaagtcactgtgcccaaggacaggacc
tcatacacactgacagatctggagcctggagcagaatacatcatttcaatcactgctgag
aggggtcggcagcaaagcttcgagtccactgtggatgccttcacaggcttccgccccatc
tcccatttgcacttttctcacgtgacctcctccagtgtaaacataacctggagtgaccca
tcccctccagcagacagactcattctgaactacagccctcgcgatgaagaagaagagatg
acagaggtctctctggatgctaccaagaggcatactgtcctgatgggtctgcagccagct
actgagtacattgtgaacctggtagcagtccacggaacagtgacctctgagcccatcgtg
ggctccatcaccacaggaattgatcctcccaaagacatcacaattagcaatgtgacgaag
gactcagttatggtctcctggagccctcctgttgcaccttttgattactaccgagtatca
tatcggccaacacaagttggacgactggacagttcagtggtgcccaacacagtgacggaa
ttcaccatcaccaaactgtatccagccactgagtatgaaatcagtctcaacagtgtgcgg
ggcagggaggagagtgagcgcatctgtaccctcattcacacagccatggacaaccctgtg
gatctgactgctaccaacattactccaacagaagccctgctgcagtggaaggcgccagtg
ggtgaagtggagaactatgtcattattctcacacactttgcagttgctggggagaccatc
ctggttgatggaggcagtgaggaattccagcttgttggcctgcttcctagcacccactat
actgtcagcatgtatgccgccagtgggcctctcaccagtggtaccatcagcaccaacttc
tctaccctcctggaccctcctgcaaacctgacagccagtgaagtcaccagacaaagtgcc
ctgatctcctggcagcctcccagagcagagattgaaaactacatcttaacttacaaatcc
actgatggaagccgcaaggagctgattgtggatgcagaggacacgtggatccgattggag
ggcctgtctgagagcacagattacacagtgctcttgcaggcagcgcaggacaccgcccgg
agcagcctcacctctgccaccttcaccacagggggccgagtgtttcctcatcctcaagac
tgtgcccagcatttgatgaatggagacactctgagtggggtttacaccatttttctcaat
ggagagctaagccggaagttacaggtgtactgcgacatgaccacggatgggggtggatgg
attgtgttccagagacgacagaatggccaaactgactttttccggaaatgggctgagtac
cgtgttggcttcgggaacctggaggatgagttttggctggggctggacaacatacacagg
atcacatcccagggccgctacgagctgcgcgtggacatgcgggacggccaggaggctgcc
ttcgcctactacgacaagttctccgtggaggatgctagaagcctgtacaagctgcgtcta
ggaggctacaatggcactgcaggggactccctcagctatcatcaggggcgccctttctcc
acagaggacagagacaatgatgttgctgttaccaactgtgccatgtcttacaagggggcc
tggtggtacaagaactgccaccggaccaacctcaatgggaaatatggagagtccaggcac
agtcaggggatcaactggtaccactggaaaggccacgagttctccatccctttcgtggag
atgaagatgcgcccctataaccaccgtctcccagcggggcggaaacggcggtccttgcag
ttctga

KEGG   Vulpes vulpes (red fox): 112922455
Entry
112922455         CDS       T05911                                 

Gene name
FN1
Definition
(RefSeq) fibronectin
  KO
K05717  fibronectin 1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04810  Regulation of actin cytoskeleton
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp05100  Bacterial invasion of epithelial cells
vvp05135  Yersinia infection
vvp05146  Amoebiasis
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112922455 (FN1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112922455 (FN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112922455 (FN1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112922455 (FN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112922455 (FN1)
   05205 Proteoglycans in cancer
    112922455 (FN1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112922455 (FN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112922455 (FN1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112922455 (FN1)
   05100 Bacterial invasion of epithelial cells
    112922455 (FN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112922455 (FN1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112922455 (FN1)
Membrane trafficking [BR:vvp04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    112922455 (FN1)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   112922455 (FN1)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112922455 (FN1)
Domain-containing proteins not elsewhere classified [BR:vvp04990]
 Fibronectin (FN) domain-containing proteins
  Fibronectin type I domain-containing proteins
   112922455 (FN1)
SSDB
Motif
Pfam: fn3 fn1 Pur_ac_phosph_N fn2 DUF2369 DUF1410
Other DBs
NCBI-GeneID: 112922455
NCBI-ProteinID: XP_025857818
UniProt: A0A3Q7SMN1
LinkDB
Position
Unknown
AA seq 2447 aa
RRQAQQIVQPQGPAAGGQSKPGCYDNGKHYQINQQWERTYLGNALVCTCYGGSRGFNCES
KPEPEETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYK
IGDTWRRPHETGGYMLECVCLGNGKGEWTCKPIAEKCFDHAAGTSYVVGETWEKPYQGWM
MVDCTCLGEGSGRITCTSRNRCNDQDTRTSYRIGDTWSKKDNRGNLLQCICTGNGRGEWK
CERHASLQTTSTGSGPFTDVRTAIYQPQPHPQPAPYGHCVTDSGVVYSVGMQWLKTQGNK
QMLCTCLGNGVSCQETAVTQTYGGNSNGEPCVLPFTYNGRTFYSCTTEGRQDGHLWCSTT
SNYEQDQKYSFCTDHTVLVQTRGGNSNGALCHFPFLYNNHNYTDCTSEGRRDNMKWCGTT
PNYDADQKFGFCPMAAHEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCV
AYSQLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPIDQCQDSETRTF
YQIGDSWEKYVHGVRYQCYCYGRGIGEWHCQPLQTYPGTTGPVQVIITETPSQPNSHPIQ
WNAPEPSHISKYILRWKPKNSPGRWKEATIPGHLNSYTIKGLTPGVVYEGQLISVQHYGH
REVTRFDFTTTSTSPAVTSNTVTGETTPLSPVVATSESVTEITASSFVVSWVSASDTVSG
FRVEYELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEEGEQSLILSTSQTT
APDAPPDPAVDRVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSD
LQPGVQYNITIYAVEENQESTPVFIQQETTGVPRSDKVPPPRDLQFVEVTDVKITIMWTP
PESTVTGYRVDVIPVNLPGEHGQRLPINRNTFAEVTGLSPGVTYHFKVFAVNQGRESRPL
TAEQTTKLDAPTNLQFVNETDSTVLVFWTPPRARIAGYRLTVGPTRGGHPKQYNVGPSAS
QYPLRNLQPATEYTVSLVAVKGNQQSPKATGVFTTLQPLSSIPPYNTEVTETTIVITWTP
APRIGFKLGVRPSQGGEAPREVTSDSGSIVVSGLTPGVEYVYTISVLRDGQERDTPIVKK
VVTPLSPPTNLHLETNPDTGVLTVSWERSTTPDITGYRITTTPTNGQQGYSLEEVVHADQ
SSCTFENLSPGLEYNVSVYTVKDDKESVPISDTIIPEVPQLTDLSFVDITDSSIGLRWTP
LNSSTIIGYRITVVAAGEGIPIFEDFVDSSVGYYTVTGLEPGIDYDISVITLINGGESAP
TTLTQQTAVPPPTDLRFTNIGPDTMRVTWAPPPSIELTNFLVRYSPVKNEEDVAELSISP
SDNVVVLTNLLPGTEYLVSVSSVYEQHESTPLRGRQKTGLDSPSGIDFSDITANSFTVHW
IAPRATITGYRIRHHPEHTSGRPREDRVPPSRNSITLTNLNPGTEYVVSIIALNGREESP
PLIGQQSTVSDVPRDLEVIAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPG
SKSTATISGLKPGADYTITVYAVTGRGDSPASSKPVSIDYRTEIDKPSQMQVTDVQDNSI
SVRWLPSSSPVTGYRVTTTPKNGPGPSKTKTAGPDQTEMTIEGLQPTVEYVVSVYAQNRN
GESQPLVQTAVTNIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFP
APDGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQSTAIPAPADLKFTQVTPTSL
TAQWTAPNVQLTGYRVRVTPKEKTGPMKEINLAPDSSSVVVSGLMVATKYEVSVYALKDT
LTSRPAQGIVTTLENVSPPRRARVTDATETTITISWRTKTETITGFQVDAIPANGQNPIQ
RTIRPDIRSYTITGLQPGTDYKIYLYTLNDNARSSPVVIDASTAIDAPSNLRFLATTPNS
LLVSWQPPRARITGYIIKYEKPGSPPREVVPRPRPGVTEATITGLEPGTEYTIQVIALKN
NQKSEPLIGRKKTDELPQLVTLPHPNLHGPEILDVPSTVQKTPFITNPGYDTGNGIQLPG
TSGQQPSVGQQMIFEEHGFRRTTPPTTATPVRHRPRPYPPNVNEEIQVGHVPRGDVDHHL
YPHVMGLNPNASTGQEALSQTTISWTPFQESSEYIISCHPVGIDEEPLQFRVPGTSASAT
LTGLTRGATYNIIVEALKDQKRHKVREEVVTVGNSVDQGLNQPTDDSCFDPYTVSHYAIG
EEWERLSESGFKLSCQCLGFGSGHFRCDSSKWCHDNGVNYKIGEKWDRQGENGQMMSCTC
LGNGKGEFKCDPHEATCYDDGKTYHVGEQWQKEYLGAICSCTCFGGQRGWRCDNCRRPGA
EPGHEGSTGHYNQYSQRYHQRTNTNVNCPIECFMPLDVQADREDSRE
NT seq 7344 nt   +upstreamnt  +downstreamnt
cggcggcaggcgcagcagatcgtgcagccccagggccccgcggccggcggccagagcaag
cctggctgttacgacaatgggaaacactatcagataaaccaacaatgggagcgcacctac
ctgggaaatgccttggtttgtacctgttacggagggagccgaggctttaactgcgagagt
aaacctgaacctgaagagacttgctttgacaagtacacggggaacacctaccgcgtgggt
gacacttatgagcgccctaaggactccatgatctgggactgtacgtgcatcggagctggg
cgtggaagaattagctgcaccattgcaaaccggtgccatgaaggtggtcagtcctacaag
atcggtgacacctggaggagaccacatgagactggtggttacatgttagagtgtgtctgt
cttggtaatgggaaaggagaatggacctgcaagcccatagcggagaaatgttttgatcac
gctgctgggacttcctacgttgttggagagacctgggaaaagccgtatcaaggctggatg
atggtggattgtacttgtctgggagaaggcagtggacgtatcacctgtacttctagaaac
agatgcaatgatcaggacaccaggacgtcctacagaatcggagatacctggagcaagaag
gataaccgggggaacctgcttcagtgcatttgtaccggcaacggcagaggggagtggaag
tgtgaaaggcacgcgtctctgcagaccacttccactggatctggccccttcacagatgtc
cggacggccatttaccagccccagcctcacccgcagccggctccctatggtcactgcgtc
acggacagtggcgtggtttactctgtggggatgcagtggctgaagacacaaggaaataag
caaatgctttgcacttgcctgggcaatggagtcagctgccaagagacagccgtcacccaa
acttacggtggcaattcaaacggggaaccctgtgtcttaccattcacctacaacggcagg
actttctactcttgcaccacagaagggcggcaggatggacatctgtggtgcagcacaact
tccaattacgagcaagaccagaaatactccttctgtacagaccatactgttttggttcag
actcgaggtggaaattccaatggtgccttgtgccacttccccttcctgtacaacaaccac
aactacacggactgtacttctgagggcaggagagacaacatgaagtggtgcggaaccacg
ccgaactacgatgctgaccagaagtttggattttgccccatggccgcccatgaggaaatc
tgcacaaccaatgaaggggtcatgtatcgcattggagatcagtgggacaaacagcacgat
atgggccacatgatgaggtgcacatgcgttgggaatggtcgtggagaatggacttgtgtt
gcctactcccagctccgagatcagtgcattgttgatgacatcacgtacaatgtgaacgac
acattccacaagcgtcatgaagaggggcacatgctgaattgtacctgctttggtcagggc
cggggcagatggaagtgcgatcccattgaccaatgccaggattcagaaacccgaacattt
tatcaaattggagactcatgggagaagtatgtgcatggtgtccggtaccagtgctactgc
tatggccgtggcattggggagtggcattgccagcctttgcagacctatccaggcacaact
ggccccgtccaagtaatcatcactgagacccccagtcaacccaattctcaccccatccag
tggaatgccccagaaccatctcacatttccaagtacattctcagatggaagcctaaaaac
tctccaggccgttggaaggaagccaccattcctggccacctgaattcatacaccatcaaa
ggcctgacgccaggcgtggtctatgagggccagctcatcagcgtccagcactacggccac
agagaggtgacacgcttcgacttcaccaccaccagcaccagcccggcggtgaccagtaac
accgtgacgggagagacgacgcccctttctcccgtcgtggccacttctgaatccgtgact
gaaatcacggccagcagcttcgtggtctcgtgggtctcggcttcggacaccgtgtcaggg
ttccgtgtggaatacgagctgagcgaggagggagatgaaccacagtatctcgatcttcca
agcacggccacttctgtgaacatccctgacctgcttcctggccgaaaatacattgtaaat
gtctatcagatatctgaagagggagagcagagtctgatcctgtctacttcgcagacaaca
gcacctgatgctcctcctgaccctgctgtggacagagttgatgacacctcgattgtcgtt
cgctggagcagaccccaggcgcccataacaggatacagaatagtgtattcgccatcagta
gaagggagcagcacagaactcaaccttcctgaaactgcaaactccgtcaccctcagtgac
ttgcaacctggcgttcagtataacatcactatctatgcggtggaagaaaaccaagaaagt
acccctgttttcatccaacaagaaaccactggcgtcccgcgttcagataaagttccccct
cctcgggacctgcagtttgtagaagtgacagacgtgaagatcaccatcatgtggaccccc
cctgagagcacagtgactggttaccgcgtagacgtgatccccgtcaacctgcccggagaa
cacgggcagaggctgcccatcaacaggaacaccttcgcggaagtcaccggactgtccccc
ggggtcacctatcacttcaaagtcttcgccgtgaaccaaggaagggagagcaggcctctg
acagcggaacaaacgaccaaattggatgctcccactaacctccagtttgtcaacgaaact
gactcaactgtcttagtgttctggactccacctcgggcccggatagctgggtaccgactg
accgtgggtccaacccgaggaggccaccccaagcagtacaacgtgggaccctctgcctcg
cagtaccccttgaggaatctgcagcctgcaacagagtacactgtctcccttgtggctgtc
aaaggcaaccagcagagccccaaagccactggagtcttcaccactctgcagcctctcagc
tccattccaccttacaacacggaggtcaccgagaccaccattgtgatcacatggacccct
gctccaaggattggttttaagctgggtgtacgaccaagccagggaggggaagcaccacga
gaagtgacttcagactcgggaagcattgttgtgtctggcctgactcccggtgtggaatat
gtttacaccatctcagtcctgagggacggacaggagagagatactccaattgtaaagaaa
gtggtgacaccattgtctccaccaacaaacttgcacctggagacaaaccctgacactgga
gtgctcaccgtctcctgggagaggagcactactccagacattactggttatagaattacc
accacccctacaaatggccaacagggatattctttggaagaagtggtccatgcagatcag
agctcttgcacttttgaaaacctgagtcctggcctggagtacaatgtcagtgtttacact
gttaaagatgacaaggaaagtgtccctatctctgataccatcatcccagaggtgccccaa
ctcactgacctaagctttgttgatataaccgattcaagcatcggcctgaggtggaccccg
ctaaactcttccaccattattgggtaccgcatcacagtagttgcggcaggagaaggtatc
cctatttttgaagattttgtggactcctcggtaggatactacacagttacagggctggaa
ccgggcattgactatgacatcagcgttatcactctcattaatggcggagagagtgcccct
actacactgacacagcaaacggctgtcccgcctcctactgacctgcgattcaccaatatt
ggtccagacactatgcgtgtcacctgggccccacctccatccattgaattgaccaacttc
ctggtgcgctactcgcctgtgaaaaacgaggaagacgttgcggagttgtcaatctctcct
tcagacaacgtagtggtcttaacaaatctcctgcctggcacggaatatttggtcagtgtc
tccagtgtgtacgaacagcacgagagcacaccccttagaggaaggcagaaaacaggtctt
gattccccctctggcattgacttttctgatatcactgccaactctttcactgtccattgg
attgctcctcgagccacgatcactggctatcggattcgccatcatccagagcacaccagt
ggaagacctcgggaggatcgagtgcctccctctcggaattccatcaccctcaccaacctc
aatcccggcacagaatatgtggtcagcatcattgctcttaatggcagagaagagagtcct
cccttgattggccaacagtcaacagtttctgatgttccaagggacctagaggtcatcgct
gcaacccccaccagcctattgattagctgggatgctcctgctgtcacagtgagatattac
aggatcacctatggagaaacaggaggaaatagccctgtccaggagttcactgtgcctggg
agcaagtccacagctaccatcagcggcctcaaacctggagcagactacactatcaccgtg
tatgctgtcactggccgtggagacagcccggcaagcagcaagccagtttccattgattac
cgaacagaaattgacaagccatcccagatgcaagtgactgatgttcaggacaacagtatt
agtgtcaggtggctgccttccagttctcccgtcactggttatagagtgaccactactccc
aaaaatggccccggaccatcaaaaactaagactgcaggtccagatcaaacagaaatgacc
attgaaggtttgcagcccacagtggagtatgtggtcagtgtctatgctcagaatcgaaac
ggagagagtcagcctctggtccaaactgcagtaaccaacattgatcgccctaaaggactg
gcattcactgatgtggatgtcgattccatcaaaattgcttgggaaagcccacaggggcaa
gtttccaggtacagggtgacctactcaagccctgaggatggaatccatgagctattccct
gcacctgatggtgaagaagacactgcagagctgcaaggcctcaggccgggttctgagtac
acagtcagtgtggttgccttgcacgatgatatggagagccagcccctgattggaacccag
tccacagccattcccgcgccagctgacttgaagttcactcaggttacaccaacaagcctg
accgcccagtggacagcacccaatgttcagctcactgggtatcgagtgcgggtgaccccc
aaggagaagacaggaccgatgaaagaaatcaaccttgctcctgacagctcctctgtggtt
gtgtcaggactcatggtggccaccaaatatgaagtgagcgtctatgcccttaaggacacg
ttgacaagcagaccggctcagggaattgtcactactctggagaatgtcagccctccaaga
agggcccgggtgacagatgctaccgagaccaccatcaccattagctggagaaccaagacc
gagacaatcaccggcttccaagttgatgccatcccagcaaatggccagaatccgattcag
agaaccatcaggccagatatcagaagctacaccatcacaggtttacaacccggcactgac
tacaagatctacttgtacaccctgaatgacaatgcccggagctcccctgtggtcattgac
gcctccactgccattgatgcaccatccaacctgcgtttcctggccaccacacctaactcc
ttgctggtatcatggcagccaccccgtgccaggattactggttacatcatcaagtatgag
aagcccgggtcccctcccagagaagtggtccctcgtccccgccctggcgtcacagaggct
actatcactggtctggaaccaggcaccgagtacaccatccaagtcattgccctcaagaac
aaccagaagagtgagcctctgattggaaggaaaaagacagatgagcttccccaactggta
acccttccacaccccaatcttcacggaccagagatcttggatgttccctccacagttcaa
aagacccctttcatcaccaaccctgggtatgacactggaaacggtattcagcttcctggc
acttctggtcagcagcccagtgttgggcaacaaatgatctttgaggagcatggttttagg
cgcaccacaccgcccacaacggccacccctgtaaggcataggccaagaccatatccgccg
aatgtaaatgaggagatccaagttggtcatgtccccaggggagacgtagaccatcacctc
taccctcacgttatgggactcaatccaaatgcctctacaggacaagaagctctctctcag
acaaccatctcttggactccattccaagaaagctctgagtatatcatttcatgtcatcca
gttggcattgatgaagaacctttacagttccgagttcctggcacttctgctagtgccacc
ctgacaggccttaccagaggggccacctacaacatcatagtcgaggcactgaaagaccag
aagaggcacaaggttcgggaggaggttgttaccgtgggcaactctgtggaccaaggccta
aaccaacctacagatgactcgtgcttcgacccctacacggtttcccattatgccattgga
gaggagtgggagcggttgtctgaatctggctttaagctctcgtgccagtgcttaggcttt
ggcagtggtcatttcagatgtgactcatctaaatggtgccatgataacggtgtgaactac
aagattggcgagaagtgggatcgtcagggggagaatggccagatgatgagctgcacatgt
cttggaaatggaaaaggagaattcaagtgtgatcctcatgaggcaacatgttacgacgat
gggaagacataccatgtgggagaacagtggcagaaggaatatctcggtgctatttgctcc
tgcacatgctttggaggccagcggggctggcgctgtgacaactgccgcagaccgggggcc
gaacccggtcacgaaggctccaccggccactacaatcagtactcgcaaagataccatcag
agaacaaacactaatgtcaactgcccaattgagtgcttcatgcctttagatgtacaggct
gacagagaagattcccgggagtaa

KEGG   Vulpes vulpes (red fox): 112922696
Entry
112922696         CDS       T05911                                 

Gene name
THBS2
Definition
(RefSeq) thrombospondin-2
  KO
K04659  thrombospondin 2/3/4/5
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04145  Phagosome
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp05144  Malaria
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112922696 (THBS2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112922696 (THBS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112922696 (THBS2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112922696 (THBS2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112922696 (THBS2)
  09174 Infectious disease: parasitic
   05144 Malaria
    112922696 (THBS2)
Membrane trafficking [BR:vvp04131]
 Endocytosis
  Phagocytosis
   Opsonins
    112922696 (THBS2)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112922696 (THBS2)
  Exosomal proteins of colorectal cancer cells
   112922696 (THBS2)
  Exosomal proteins of bladder cancer cells
   112922696 (THBS2)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112922696 (THBS2)
Domain-containing proteins not elsewhere classified [BR:vvp04990]
 Thrombospondin domain-containing proteins
  Thrombospondins
   112922696 (THBS2)
SSDB
Motif
Pfam: TSP_3 TSP_1 TSP_C TSP1_spondin VWC EGF_3 EGF_CA TSP1_ADAMTS EGF cEGF Laminin_G_3 Laminin_G_2
Other DBs
NCBI-GeneID: 112922696
NCBI-ProteinID: XP_025858101
UniProt: A0A3Q7SR22
LinkDB
Position
Unknown
AA seq 1002 aa
MLGALVLLALWASSSAQAGDQDEDMAFDLFRISNINRKTIGAKQFRGPDPSVPAYRFVRF
DYIPPVSTDYLSRIAKIMRQKEGFFLTASLKQDPKSRGTLLALEGPGAQRQFEIVSNGPA
DTLDLTYWIDGTQHVISLEDVGLADSQWKNVTVQVTGDTYSLYVGCDLIDSFTLDEPFYE
QLRTEKTRMYVAKGSARDSHFRGLLQNVHLVFENSVEDVLSKKGCQQSQGAEANAISENT
ETLHLSPQGGPEYGGPGAQRRPEVCERSCEELSTMITELSGLHVIVNQLHENLRKVSNDN
QFLWELIGGPPKTRNMSACWQDGRFFAENETWVVDSCTKCTCKKFKTVCHQITCPPATCA
NPSFVEGECCPSCFHSLDGEEGWSPWAEWTECSTTCGSGTQQRGRSCDVTSNTCLGPSIQ
TRACSLGKCDNRIRQDGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGKNCKGSGR
ETKGCQGVPCPIDGRWSPWSPWSACTVTCAGGIRERTRVCNSPEPQHGGKDCVGDVKEQQ
MCNKRSCPIDGCLSNPCFPGAQCSSFPDGSWSCGSCPVGFLGNGTHCEDLDECAVVTDVC
FTTSKAHRCVNTNPGFHCLPCPPRYKGSQPFGVGLEAARTEKQVCEPENPCKDKTHACHR
HAECIYLGHFSDPMYKCECQTGYAGDGLICGEDSDLDGWPNKNLVCATNATYHCIKDNCP
LLPNSGQEDFDKDGTGDACDDDDDNDGVDDEKDNCQLLFNPRQFDYDKDEVGDRCDNCPY
VHNPAQIDTDNNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCPLV
HNPDQTDVDNDLVGDQCDNNEDIDEDGHQNNQDNCPYISNANQADHDHDGQGDACDSDDD
NDGVPDDRDNCRLVFNPGQEDSDAGDWRALCLKLEVHLQVGWVLERWPVYCCQLVLVHEG
KQVMADSGPIYDQTYAGGRLGLFVFSQEMVYFSDLKYECRDV
NT seq 3009 nt   +upstreamnt  +downstreamnt
atgctcggggcgctcgtgctgcttgccctctgggcctcctccagcgctcaagctggtgac
caggacgaggacatggccttcgaccttttcaggatcagcaacataaaccgaaagaccatc
ggggccaagcagttccgggggcccgaccccagcgtgccagcgtaccgtttcgtccggttt
gactacatcccgccggtgagcacagattacctcagcaggatcgccaagatcatgcggcag
aaggaggggttctttctcacggccagcctgaagcaggaccccaagtcccggggcacgctc
ctggcgctggagggccccggtgcccagcggcaattcgagattgtctccaacggcccggca
gacacgctggacctcacctactggatagacggcacccagcacgtcatctccctggaggac
gtgggcctggctgactcgcagtggaagaatgtcactgtgcaggtgacaggggacacctac
agcctgtacgtgggctgtgacctgatcgatagcttcacactggacgagcctttctacgag
cagctgcggacagaaaagaccaggatgtatgtggccaagggctctgctcgggacagtcac
ttcaggggtctgctgcagaatgtccacctagtgtttgaaaactcagtggaagatgtcctg
agcaagaaaggttgtcagcaaagtcagggagccgaagccaacgccatcagtgagaacacg
gagacgcttcacctgagcccccaggggggccccgagtacgggggcccgggcgcccaacgg
aggccggaggtgtgcgagcgctcctgcgaggagctgagcaccatgatcaccgagctgtcc
gggctgcacgtcatcgtgaaccagctgcatgagaacctgcggaaagtgtccaatgataac
cagtttctctgggagctcatcggtggcccgcccaagacgaggaacatgtccgcgtgctgg
caggacggccggttcttcgcggaaaacgagacctgggtggtggacagctgcacgaagtgt
acgtgcaagaaatttaagaccgtttgccaccaaatcacctgcccaccggcaacctgcgcc
aacccgtccttcgtggaaggagaatgctgtccgtcctgcttccactcgctggacggcgag
gaaggctggtccccgtgggccgagtggaccgagtgctccaccacctgcggctccggcact
cagcagagagggcggtcctgtgacgtcaccagcaacacctgcttggggccgtccatccag
acgcgggcctgcagcctgggcaagtgcgacaatcgcatccggcaggacgggggctggagc
cactggtcgccatggtcttcctgctctgtgacctgcggtgtcggcaacatcacgcgcatc
cggctctgcaactcgcctgtcccccagatggggggcaagaattgcaaagggagcggccgt
gagacgaaaggctgccagggcgtcccctgtccgatcgatggccggtggagcccctggtcc
ccgtggtccgcctgcactgtcacctgtgccggggggatccgggagcggacacgcgtctgc
aacagccccgagccccagcacggcggcaaggactgcgtgggtgatgtcaaggagcaacag
atgtgcaataagaggagctgccccatagacggctgcttatccaacccctgcttccccggc
gcccagtgcagcagcttccccgacgggtcctggtcctgcggctcctgccccgtgggcttc
ctgggcaacggcacgcactgtgaggacctggatgagtgcgccgtggtcacggacgtctgc
ttcaccacgagcaaggcccaccgctgcgtcaacacaaatccaggcttccactgcctgccg
tgcccccctcgatacaaagggagccagcccttcggcgtcggcctggaggcagccaggacc
gagaagcaggtgtgtgaacctgagaacccgtgcaaggacaagactcacgcctgccacagg
cacgcggagtgcatctacctggggcatttcagcgaccccatgtacaagtgtgagtgccag
acgggctacgcgggcgacgggctcatctgtggggaggactcggacctggacggctggccc
aacaagaacctggtctgcgccaccaacgccacctaccactgcatcaaggacaactgcccc
ctgctgcctaactctgggcaggaagactttgacaaggacggcactggggacgcctgtgac
gatgatgacgacaacgacggcgtggacgatgagaaggacaactgccagcttctcttcaac
ccccggcaatttgactatgacaaggatgaggttggagaccgctgtgacaactgcccgtac
gtgcacaaccccgcgcagatcgacacggacaacaacggcgagggggacgcgtgctccgtg
gacattgacggagacgatgtgttcaacgagagggacaactgtccgtacgtctacaacacc
gaccagagagacaccgacggggacggtgtgggtgaccactgcgacaactgccccctggtg
cacaaccccgaccagactgacgtggataatgacctcgtgggagaccagtgtgacaacaat
gaggacatcgatgaggacggacaccagaacaaccaggacaactgcccctacatctccaat
gccaaccaggccgaccacgaccatgatggccagggtgatgcctgtgactcggacgatgac
aatgatggtgtccccgacgacagggacaactgccggcttgtgttcaaccctggccaggag
gactcggatgctggggactggagggcactctgcctgaagctggaggtccacttacaggtc
ggctgggtcttggagcgctggcctgtttattgctgccagctggtcttggtgcatgaagga
aaacaggtcatggccgactcgggacccatctatgaccaaacctacgccggtggtcgactg
ggtctgtttgtcttctctcaagagatggtctatttctcggacctcaaatatgaatgcaga
gatgtctaa

KEGG   Vulpes vulpes (red fox): 112923095
Entry
112923095         CDS       T05911                                 

Gene name
TNC
Definition
(RefSeq) tenascin isoform X1
  KO
K06252  tenascin
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp05165  Human papillomavirus infection
vvp05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112923095 (TNC)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112923095 (TNC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112923095 (TNC)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    112923095 (TNC)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112923095 (TNC)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112923095 (TNC)
SSDB
Motif
Pfam: fn3 Fibrinogen_C EGF_2 EGF_Tenascin Pur_ac_phosph_N fn3_2 DUF2369 EGF
Other DBs
NCBI-GeneID: 112923095
NCBI-ProteinID: XP_025858609
UniProt: A0A3Q7SDT4
LinkDB
Position
Unknown
AA seq 2384 aa
MGAATRLLAGILLALLTLTTEGGVLKKVIRHKRESGVNVTLPEEHQPVVFNHVYNIKLPV
GSQCSVDLESASGEKELAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVK
ELLSRLEELENLVSSLREQCTTGAGCCLQPAEGRLDTRPLCSGRGNFSTEGCGCVCEPGW
KGPNCSEPECPGNCHLRGQCLDGQCVCDEGFTGEDCSQLACPSDCNDQGKCVSGVCVCFE
GYTGADCGDEVCPVPCNEEHGRCVEGRCVCQDGFAGEDCSEPLCLNSCHNRGRCVENECV
CDEGFTGEDCSELICPNDCFDRGRCVNGTCYCEQGFSGEDCGQLSCPNACTGRGRCEQGQ
CVCEPGFAGPDCSDRSCPNDCHHRGRCVHGRCECDAGFGGPDCGQLQCPRGCSGHGHCVN
GQCVCDEGHTGEDCGQLRCPNDCHSRGRCVQGQCVCEPGFQGYDCSDMSCPNDCHQHGRC
VNGMCVCDDGYTGEDCRDLRCPRDCSDRGRCVAGRCECEHGFTGPDCADLACPADCHGQG
RCVNGQCVCHEGFTGAACQERRCPGDCQGRGRCEDGRCTCQEGFTGPDCGQRSCPNGCSG
WGQCVEGRCVCSEGHAGEDCAQVSPPKDLIVTEVTEETVNLAWDNEMRVTEYLVTYTPTH
EDGLEMQFRVPGDQTSTTIRELEPGVEYFIRVFAILENKKSIPVSARVATYLPAPEGLKF
KSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETTYRQTGLAPGQEYE
ISLHIVKNNTRGPGLKRVTTTRLDAPSQIEVKDVTDTTALITWFKPLAEIDGIELSYGIK
DVPGDRTTIDLTHDENQYSIGSLKPDTEYEVSLISRRGDMSSNPAKETFTTGLDAPRNLR
RVSQTDNSITLEWRNGKAAVDSYRIKYAPISGGDHAEVEVPRSPQATTKTTLTGLRPGTE
YGIGVSAVKADKESDPATINAATDLDAPKDLRVSETAETHLTLHWRKPSAKFDHYRLNYS
LPSGQPVEVKLPRDTTSYDLRGLEPGKGYSILLTAEKGRHKSKPARLNASTDHAPELENL
TVTEAGWDGLRLNWTAADQAYEHFVIQVQEADTMEAPQNLTVPGSLRALEVPGLKAATPY
RVTIYGVIRGYRTPVLSAEASTGETPNLGEVMVSEVGWNALKLNWTAPEGAYEQFFIQVQ
ETDSVEAAQNLTVPGGLRSVDLPGLKAATHYSVTIRGLTRDFSTTPLSVEVLTEEVPDLG
NLTVPEVRWDGLTLDWTAPDGFYEQFVIEIQEADQAKEAHSLTVPGNLRSVEIPGLRPGT
PYTVTLHGEVGGRSTRPLVVEAITEELPQLGDLAVTEAGWDGLRLNWTAADPAYEHFVIQ
VQEANLVEAPQNFTVPGSLRAVEVPGLKAATPYRVTIYGVIQGYRTPVLSAEASTATGPE
VGNLTVSDITPESFNLSWTATDGVFETFTIEIVDSNRFLETMEYNISGTERTAHISGLHP
NNHFVIYLSGLAPSIRTKIISATATTVAEPLLSHLTVSNVTWASVSLSWKAQEATFDSFL
IEVRNSVHRQETVVRSVPAAARSSVITNLKASSNYTAHLHGLIGGHPAQTLTVQATTEPE
PQLGTLILSNITPDSFNVSWTTQAGPFAKIVVNVSDSHSLYEPQQFTVSGDTQHAHITGL
VENTGYDVSVAGTTWAGDPTRPLTAFVVTEALPLLENLTISDINPYGFTVSWMASENAFD
SFLVTVVDSGKLLDPQEFTLSGTQRKLELRGLITGIGYEVMVSGFSQGHQTKPLRAEIVT
EAEPEVDNLLVSDATPDGFRLSWTADEGVFDSFVLKIRDTKKQSEPLEITLLAPERTRDI
TGLREATEYEIELYGISSGRRSQPVSAIATTAMGSPKEISFSDITEDSATVSWMAPSAQV
ESFRITYVPIAGGTSSVVNVDGTKTQTRLMKLLPGAEYLVSVIAMKGFEESEPVSGSFTT
ALDGPSGLVTANVTDTEALAMWQPAIAPVDSYVISYTGERVPEITRTVSGNTVEYALADL
EPATEYTLRIFAEKGPQKSSIITTKFTTDLDSPRDLTATEVQSETALLTWRPPRASVTGY
LLVYESVDGTVKEVILGPETTSYNLAELSPSTHYTAKIQALNGPLRSKLVQTIFTTIGLL
YPFPRDCSQAMLNGDTTSGLYTIYLNGDKAQALEVYCDMTSDGGGWIVFLRRKNGREDFY
RNWKAYAAGFGDRREEFWLGLDNLHKITAQGQYELRVDLRDHGKTAYAVYDRFSVGDAKT
RYKLKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYKNCHRVNLMGR
YGDNNHSQGVNWFHWKGHEYSIQFAEMKLRPSNFRNLEGRRKRA
NT seq 7155 nt   +upstreamnt  +downstreamnt
atgggggccgcgactcggctgttggcgggcatcctgctagctttgctcaccctcacaacc
gaaggtggggtcctcaagaaagtcatccggcacaagcgagagagtggagtgaatgtcact
ttgcccgaggaacaccagccagtggtgtttaaccacgtctacaacatcaagctgcccgta
ggttcccagtgctcggtggacctggagtcagccagtggggagaaagagctggccccacct
tcagagcccagcgagagcttccaggagcacacggtcgacggggaaaaccaaattgtcttc
acacaccgcatcaacatcccccgccgggcctgtggttgcgcggcagctcctgatgtcaag
gagcttctgagcagattggaggagctggagaatcttgtgtcttccctgcgggagcagtgc
accacgggagctggctgctgtctccagcctgccgaaggccgcctggacaccaggcccttg
tgcagcggccgcggaaacttcagcacggaaggctgtggctgtgtgtgtgagccgggctgg
aaaggccccaactgctcggagcccgaatgtcccggcaactgtcacctgcgaggccagtgc
ctggacggccagtgtgtctgcgacgagggtttcacgggggaggactgcagccagctggcc
tgtcccagcgactgcaacgaccagggcaagtgcgtgagcggggtctgcgtgtgcttcgaa
gggtacacgggcgccgactgcggcgacgaggtgtgcccggtgccctgcaacgaggagcac
ggcaggtgcgtggagggccgctgcgtgtgccaggacggcttcgcgggcgaggactgcagc
gagcccctgtgcctcaacagctgccacaaccgcgggcggtgcgtggagaacgagtgcgtg
tgcgacgagggcttcacgggcgaggactgcagcgagctcatctgccccaacgactgcttc
gaccgcggccgctgcgtcaacggcacctgctactgcgagcagggcttctcgggcgaggac
tgcggccagctcagctgccccaacgcctgcacgggccgcggccgctgcgagcagggccag
tgcgtgtgcgagccgggcttcgccgggcccgactgcagcgacaggagctgccccaacgac
tgccaccaccgcggccgctgcgtgcacggcaggtgcgagtgcgacgccggcttcggcggg
cccgactgcggccagctccagtgtcccaggggctgcagcggccacggccactgtgtcaac
gggcagtgcgtgtgcgacgagggccacaccggggaggactgcggccagctgcggtgcccc
aacgactgtcacagccgtggccgctgcgtgcagggccagtgcgtgtgcgagccgggcttc
cagggctacgactgcagcgacatgagctgccccaacgactgccaccagcacggccgctgc
gtgaacggcatgtgtgtctgcgacgacggctacaccggggaggactgccgcgacctgcgg
tgccccagggactgcagcgaccggggccgctgcgtggccgggcggtgcgagtgtgagcac
ggcttcacgggccccgactgcgccgacctcgcgtgccccgcggactgccacggccagggc
cgctgtgtgaacgggcagtgcgtgtgccacgagggcttcacgggcgccgcgtgccaggag
cggaggtgccccggcgactgtcagggccggggccgctgcgaggacggtcggtgcacctgc
caggagggcttcacgggcccggactgcgggcagcgctcgtgccccaacggctgcagcggc
tgggggcagtgcgtggagggccgctgcgtgtgcagcgagggccacgccggggaggactgc
gcccaggtgtcccctccgaaagacctcatcgtgacagaggtgacggaagagaccgtaaac
ctggcctgggacaacgagatgcgggtcacggagtacctcgtcacctacacacccacccac
gaggacggcctggagatgcagttccgcgtgcccggggaccagacatccaccaccatccgg
gagctggagcccggcgtggagtacttcatccgcgtgttcgccatcctggaaaacaagaag
agcattcccgtcagcgcccgagtggccacttacttgccggcacctgaaggcctaaagttc
aagtccatcaaggagacgtctgtggaagtggagtgggatcctctggacattgcttttgaa
acctgggagatcatcttccggaatatgaataaagaagatgagggagagatcaccaaaagc
ctgaggaggccagagaccacataccggcagactggcctggcgcccgggcaagagtatgag
atctctctgcacatcgtgaagaataatacccggggcccaggcctgaagagggtgaccacc
acccgcttggatgcccccagccaaatcgaggtgaaagatgtcacggacaccactgctctg
atcacttggttcaagcccctggctgagattgacggcattgaactctcctacggaatcaaa
gatgtgcctggtgaccgtaccaccatcgatctcacacatgatgagaaccagtactccatt
gggagcctgaagccagacaccgagtatgaggtgtctctcatctcccgtaggggtgacatg
tccagcaacccggccaaagagaccttcacaacaggcctggatgctcctagaaatctccgt
cgtgtctcccagacagacaacagcatcaccctggaatggaggaatggcaaggcagctgtt
gacagttacagaattaagtacgctcccatctctggaggtgaccatgccgaggtcgaagtc
ccaaggagcccgcaagccaccaccaaaaccacactcacaggtctgaggccaggaactgaa
tatgggatcggagtgtctgctgtgaaggcagacaaggagagcgatccagccaccatcaac
gcggccacagacctggacgcacccaaggaccttcgggtgtctgaaactgctgagacccac
ctgaccctacactggaggaagccttcagccaagtttgaccattaccgcctcaactacagc
ctgccctcaggccagccagtggaggtgaagctccccagagataccacctcctatgacctg
agaggcctggagcctgggaagggatactccatcctcctgacagcagagaagggcaggcac
aagagcaagcctgcacggctaaatgcatccacagaccatgcccctgaactggaaaacctc
accgtgaccgaggctggctgggacggcctcagactcaactggaccgcagctgaccaggcc
tatgagcactttgtcattcaggtgcaggaggccgacacgatggaggcacctcagaacctc
acggtgccgggcagcctgcgggccctggaggtcccgggcctcaaggccgccaccccttac
agagtcaccatctacggggtgatccggggctatagaacaccggtgctctctgccgaggcc
tccacaggggaaactcccaatttgggagaggtcatggtgtccgaggtgggctggaacgcc
ctcaaactcaactggaccgctccggaaggggcctatgaacagtttttcattcaggtgcag
gagactgactcggtagaggcagcccagaacctcacggtccctggaggactgaggtccgtg
gacctgcctgggctcaaagcagccactcattatagcgtcaccatccgtgggctcacacgg
gacttcagcacgactcctctctctgttgaagtcttgacagaggaggttccagatctggga
aacctcacagtgcctgaggttcgctgggatggcctcactctggactggaccgcccccgat
gggttctatgagcagtttgtcattgagatccaggaggctgaccaggccaaggaagctcac
agtcttacggttcctggcaacctgcgctctgtggaaatcccaggcctcaggcccgggacc
ccttacaccgtcactctgcacggcgaggtggggggccgcagcactcgaccccttgtggtg
gaggccatcacagaggagctcccccagctaggagacttagccgtgaccgaggctggctgg
gacggcctcagactcaactggaccgcagctgacccggcctatgagcactttgtcattcag
gtgcaggaggccaacctggtggaggcacctcagaacttcacagtgccgggcagcctgcgg
gccgtggaggtcccgggcctcaaggccgccaccccttacagagtcaccatctacggggtg
atccagggctatagaacaccggtgctctctgccgaggcctccacagccacaggacctgaa
gtgggaaacttaactgtttctgacataacccctgagagcttcaatctctcctggacagcc
accgatggggtcttcgagacctttaccattgaaattgttgattccaataggtttttggag
acgatggaatacaatatctctggcactgaacgaactgcccacatctcagggctacaccct
aataatcattttgttatctacctctcggggctcgctcccagcatccggaccaaaatcatc
agtgccacggccaccacagtagccgaacctctccttagccacctcactgtctcgaatgtg
acctgggccagtgtgtccctctcgtggaaagcccaggaggctacctttgatagctttctt
atagaagttaggaattccgtccaccgccaggagacggtggtgcgttctgtgcctgcagcg
gctcgcagctctgtcatcaccaacctcaaagcttcttctaattacactgcccaccttcat
gggctgattggcgggcaccctgctcagactctgacggtccaggcaaccacagagccagag
ccacagttgggcacgctaatccttagcaatattactcccgacagcttcaacgtgtcctgg
accactcaagccgggccttttgcaaagattgttgtcaatgttagcgattctcactcgctg
tatgagccccagcaattcacggtctcaggagacacacagcacgctcacatcacgggcttg
gtggagaacactggctatgacgttagtgtggcagggaccacctgggctggggaccccacc
agacccctcactgcctttgtcgtgacagaggccctgccccttctggaaaacctaaccatt
tccgacattaatccctacgggttcacagtttcctggatggcatcggagaatgcctttgac
agcttcctagtaacggtggtggattctgggaagctgctggacccccaagaattcacactt
tcaggaacccagaggaaattggagcttagaggcctcataactggcattggctatgaggtt
atggtctctggcttcagccaagggcaccaaaccaagcccttgagggctgagattgttaca
gaagccgagccagaggttgacaaccttttggtttcagacgccaccccagatggtttccgt
ctgtcctggacagctgatgagggggtcttcgacagttttgttctcaaaatcagagatacc
aaaaagcagtctgagccactggaaataaccctacttgcccccgaacgaaccagggacata
actggtctcagagaggccactgagtatgaaattgaactctatggaataagcagtggaagg
cgatcccaaccagtcagtgccatagcaacaacagccatgggctctcccaaggagatcagt
ttctcagacatcactgaagattcggccactgtcagctggatggcgccctcggcccaggtg
gagagcttccggattacctacgtgcccattgcaggagggacatcctcagtggtaaatgtg
gatggaaccaagacccagaccaggctgatgaagctcttgcccggagcagagtaccttgtc
agtgtcatcgccatgaagggcttcgaggaaagtgaaccagtctcaggatcgttcaccaca
gctctggatggcccatctggcctggtgacagccaacgtcaccgacacggaagccttggcc
atgtggcagccagccattgccccggtggacagttatgtcatctcctacacaggggagaga
gtgccagaaattacacgcacagtgtccgggaacacggtggagtatgccctggccgacctc
gagcctgccacggagtacacgctgaggatctttgcagagaaagggccccagaagagctca
atcatcaccaccaagttcacaacagaccttgactctccaagagacttgactgccactgag
gttcagtcagaaactgccctcctcacctggagacccccccgggcatctgtcaccggttac
ctattggtgtatgaatctgtggatgggacagtcaaggaagtcattttgggtccagaaacc
acctcctataacctggcagagctgagcccatccacccactacacggccaagatccaagcg
ttgaatgggcccctgaggagcaagctggtccagaccatctttaccacaattggactcctg
tacccattccccagggactgctcccaagcaatgctgaatggagacacaacctccggcctc
tacacgatttatctgaatggtgataaggcccaggctctggaagtctactgtgacatgacc
tccgatgggggtggatggatcgtgttcctgaggcgcaagaacggacgtgaggatttctat
cgcaactggaaagcctacgctgctgggttcggggaccgcagagaagaattctggcttggg
ctggacaatctacacaaaatcacagcccaagggcagtacgagctccgggtagacctgcgg
gaccacgggaagacagcctacgccgtctatgacaggttcagcgtgggggatgccaagact
cgctacaagctgaaggtggaggggtacagtggaactgcaggtgactccatggcttaccac
aatggcagatccttctctaccttcgacaaggacacggactcagccatcaccaactgtgcc
ctgtcctataagggggctttctggtacaagaactgtcaccgtgtcaacctgatggggaga
tatggggacaacaaccacagtcagggcgttaactggttccactggaagggccacgaatat
tcaatccagtttgctgagatgaagttgagacccagcaacttccgaaatctcgaaggcagg
cgcaaacgggcgtaa

KEGG   Vulpes vulpes (red fox): 112923896
Entry
112923896         CDS       T05911                                 

Gene name
COL1A2
Definition
(RefSeq) collagen alpha-2(I) chain
  KO
K06236  collagen type I alpha
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04611  Platelet activation
vvp04926  Relaxin signaling pathway
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04974  Protein digestion and absorption
vvp05146  Amoebiasis
vvp05165  Human papillomavirus infection
vvp05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112923896 (COL1A2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112923896 (COL1A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112923896 (COL1A2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112923896 (COL1A2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112923896 (COL1A2)
  09154 Digestive system
   04974 Protein digestion and absorption
    112923896 (COL1A2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    112923896 (COL1A2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112923896 (COL1A2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112923896 (COL1A2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112923896 (COL1A2)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112923896 (COL1A2)
SSDB
Motif
Pfam: Collagen COLFI
Other DBs
NCBI-GeneID: 112923896
NCBI-ProteinID: XP_025859557
UniProt: A0A3Q7TDV2
LinkDB
Position
Unknown
AA seq 1366 aa
MLSFVDTRTLLLLAVASCLATCQSLQEATARKGPTGDRGPRGERGPPGPPGRDGDDGIPG
PPGPPGPPGPPGLGGNFAAQYDGKGVGLGPGPMGLMGPRGPPGASGAPGPQGFQGPAGEP
GEPGQTGPAGARGPPGPPGKAGEDGHPGKPGRPGERGVVGPQGARGFPGTPGLPGFKGIR
GHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSV
GPVGPAGPIGSAGPPGFPGAPGPKGEIGPVGNPGPAGPAGPRGEVGLPGVSGPVGPPGNP
GANGLTGAKGAAGLPGVAGAPGLPGPRGIPGPVGAAGATGARGLVGEPGPAGSKGESGNK
GEPGSAGAQGPPGPSGEEGKRGPNGEAGSAGPSGPPGLRGSPGSRGLPGADGRAGVMGPP
GPRGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGAPGNVGPAGKEGPMGLPGIDGRPGPI
GPAGARGEPGNIGFPGPKGPTGDPGKNGDKGHAGLAGARGAPGPDGNNGAQGPPGPQGVQ
GGKGEQGPAGPPGFQGLPGPAGTAGEVGKPGERGPPGEFGLPGPAGPRGERGPPGESGAA
GPSGPIGSRGPSGPPGPDGNKGEPGVLGAPGTAGASGPGGLPGERGAAGIPGGKGEKGET
GLRGEIGNPGRDGARGAPGAMGAPGPAGATGDRGEAGPAGPAGPAGPRGSPGERGEVGPA
GPNGFAGPAGAAGQPGAKGERGTKGPKGENGPVGPTGPIGSAGPSGPNGPPGPAGSRGDG
GPPGATGFPGAAGRTGPPGPSGITGPPGPPGAAGKEGLRGPRGDQGPVGRTGETGASGPP
GFTGEKGPSGEPGTAGPPGTPGPQGLLGAPGILGLPGSRGERGLPGVAGSVGEPGPLGIA
GPPGARGPPGAVGAPGVNGAPGEAGRDGNPGNDGPPGRDGQAGHKGERGYPGNIGPVGAV
GAPGPHGPVGPAGKHGNRGEPGPAGSVGPAGAVGPRGPSGPQGIRGDKGEPGEKGPRGLP
GLKGHNGLQGLPGLAGQHGDQGAPGSVGPAGPRGPAGPSGPAGKDGRTGQPGTVGPAGIR
GSQGSQGPAGPPGPPGPPGPPGPSGGGYDFGYEGDFYRADQPRSPPSLRPKDYEVDATLK
SLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTG
ETCIRAQPENIPAKNWYRNSKVKKHIWLGETINGGTQFEYNVEGVTTKEMATQLAFMRLL
ANHASQNITYHCKNSIAYMDEETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKK
TNEWRKTIIEYKTNKPSRLPILDIAPLDIGDADQEFRVDVGPVCFK
NT seq 4101 nt   +upstreamnt  +downstreamnt
atgctcagctttgtggatacgcggactttgttgctgcttgcagtagcttcgtgcctagca
acatgccaatctttacaagaggcaactgcaagaaagggcccaactggagatagaggacca
cgtggagaaaggggtccaccaggaccaccaggcagagatggtgacgatggtatcccaggc
cctcctggtccacctggtcctcctggcccccctggtcttggcgggaactttgcagcccag
tatgatggaaaaggagttggccttggccctggaccaatgggtttgatgggacctagaggt
ccacctggtgcatctggtgctcctggccctcaaggtttccaaggacctgctggtgagcct
ggtgaacctggtcaaactggtccagcgggtgctcgtggtccacctgggcctcctggcaag
gctggtgaggatggtcaccctggaaaacctggacgacccggtgagagaggagttgttgga
ccacagggtgctcgtggtttccctgggactcctggacttcctggcttcaagggcattagg
ggacacaatggtctggatggattgaagggacagcccggtgctccaggtgtgaagggtgaa
cctggtgcccctggtgaaaatggaacgccaggtcaaacaggagcccgtgggcttcctggt
gagagaggacgtgtcggtgcccctggtccagctggtgcccgtggaagtgatggaagtgtg
ggccctgtgggtcctgctggtcctattgggtctgctggccctccaggcttcccaggtgct
cctggccccaagggtgaaatcggacctgttggtaaccccggtcctgctggtcccgcgggt
ccccgtggtgaagtgggtcttccaggtgtttccggccctgttggaccccctggtaaccct
ggagccaacggcctgactggtgctaagggtgctgctggcctgcccggtgtcgctggggct
cctggcctccctggaccccgtgggattcctggtcctgttggtgccgctggtgctactggt
gccagaggacttgttggtgagcctgggccagctggttccaaaggagaaagtggcaacaag
ggtgagcctggctctgctggtgcccaaggtcctcctggtcccagtggtgaagaaggaaag
agaggccccaatggtgaagctggatctgctgggccctctggacctcctgggctgagagga
agtcctggttctcgtggtcttcctggagctgatggcagagctggtgtcatgggtcctccc
ggccctcggggtgccaccggccctgctggtgtccgcggtcccaatggagattctggtcgc
cctggagagcctggcctcatgggaccccgaggttttcctggtgcccctggtaatgttggc
ccagctggtaaagaaggtcccatgggtctccctggtattgatggcaggcctggaccaatt
ggcccagcgggagcaagaggagagcccggcaacatcggattccctggacccaaaggcccc
actggtgatcctggcaaaaatggtgataaaggtcatgctggtcttgctggtgctcggggt
gctccaggtcctgatggaaacaatggtgctcagggacctcctggaccacaaggtgtccaa
ggtggaaaaggtgaacagggtcctgctggtcctccaggcttccagggtctgcctggcccc
gcaggtacagctggtgaagttggcaaaccaggagaaaggggtccccctggtgaatttggt
cttcctggtcctgctggtccaagaggggagcgtggtccccctggagaaagtggtgctgct
ggtccttctggtcctattggaagccgaggtccttctggaccccctgggcccgatggaaac
aagggtgaacctggcgtgcttggcgccccgggcactgctggcgcgtccggtcccggtgga
ctcccaggagagaggggtgctgccggcattcctggaggcaagggagaaaagggtgaaacc
ggtctcagaggcgaaattggtaacccaggcagagatggcgcccgtggagctcctggtgcc
atgggtgcccctggtcctgccggagccactggtgaccggggtgaagctggtcctgccggt
cccgctggccctgctggtcctcgtggtagccctggtgaacgtggtgaggttggtcccgct
ggccccaatggatttgctggtcctgctggtgctgctggtcaacctggtgctaagggagag
agaggaaccaaagggcccaagggtgaaaatggccccgttggtcccacaggccccattgga
tctgccggcccatctggtccaaatggtccccctggtcctgctggaagtcgtggtgatggt
ggcccccctggtgctactggtttccctggtgctgctgggcggactggtcctcctggaccc
tctggtatcactggccctcctggtccccctggtgctgctggtaaagaaggactccgtggg
cctcgaggtgaccaaggtccagttggccgaacgggagaaacaggtgcatctggtccccct
ggctttactggtgagaagggtccctctggagagcctggtaccgctggacctcctggcaca
ccaggtcctcaaggtctccttggtgctcctggcattctgggtctcccaggctctcggggt
gagcgtggtctaccaggtgttgctggatccgtgggtgaacccggacctcttggcattgct
ggtccacctggggctcgtggtcctcctggagctgtgggtgcgcctggagtcaacggtgct
cctggtgaagctggtcgtgatggcaaccctgggaatgatggtcctccaggccgcgatggt
caagccggacacaagggagagcgtggttaccctggcaacattggtcccgttggcgctgtg
ggtgcacctggtcctcatggccctgtgggtcccgctggcaaacacggaaaccgtggtgaa
cctggtcctgctggttctgttggtcccgccggcgctgttggtccaagaggtcctagtggc
ccacaaggcattcgaggtgataagggagagcctggtgagaaggggcccagaggtcttcct
ggcttaaagggacacaatggactgcaaggtcttcctggtcttgctggtcaacatggcgat
caaggtgcacctggttctgtgggtcctgctggtcctaggggtcctgctggtccttctggc
cctgctggcaaagatggtcgcactgggcaacctggtacagtcggacctgctggcattcgt
ggctctcagggtagccaaggtcctgctggccctcctggtccccctggccctcctggccct
cctggcccaagtggtggtggctatgactttggttatgaaggggacttctacagggctgac
cagcctcgctcaccaccttctctcagacccaaggactatgaagttgatgctactctgaaa
tccctcaacaaccagattgagacccttcttactcctgaaggctctaggaagaacccagct
cgcacatgccgagacctgagactcagccacccagagtggagcagtggttactactggatt
gaccctaaccaaggatgcactatggatgctatcaaagtatactgtgatttctctactggt
gaaacctgcattcgggctcaacctgaaaacatcccagccaagaactggtacagaaactcc
aaggtcaagaagcacatctggttaggagaaactatcaatggtggtacccagtttgaatat
aatgttgaaggagtaaccaccaaggaaatggctactcaactcgccttcatgcgcctgctg
gccaaccatgcctctcaaaacatcacctaccactgcaagaacagcattgcctatatggat
gaggagactggcaacctgaaaaaggctgtcattctgcaaggttccaatgatgttgaactg
gttgccgagggcaacagcaggttcacctacactgttcttgtagacggctgctctaaaaag
acaaatgaatggagaaagacaatcattgaatacaaaacaaataagccatcccgcctgcct
atccttgatattgcacctttggacatcggtgatgctgaccaagaattcagggtggacgtt
ggcccagtctgtttcaaataa

KEGG   Vulpes vulpes (red fox): 112925190
Entry
112925190         CDS       T05911                                 

Gene name
LAMA4
Definition
(RefSeq) laminin subunit alpha-4
  KO
K06241  laminin, alpha 4
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp05143  African trypanosomiasis
vvp05145  Toxoplasmosis
vvp05146  Amoebiasis
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112925190 (LAMA4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112925190 (LAMA4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112925190 (LAMA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112925190 (LAMA4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112925190 (LAMA4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112925190 (LAMA4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112925190 (LAMA4)
   05145 Toxoplasmosis
    112925190 (LAMA4)
   05143 African trypanosomiasis
    112925190 (LAMA4)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_G_1 Laminin_I Laminin_II Laminin_EGF Laminin_G_3
Other DBs
NCBI-GeneID: 112925190
NCBI-ProteinID: XP_025861615
UniProt: A0A3Q7U2Z4
LinkDB
Position
Unknown
AA seq 1767 aa
MFLLCLFQRCGAGFFLAQSGECTPCVCNGNSDECLDGSGFCVHCQRNTTGEHCEKCLDGY
IGDSIRGPPRFCQPCPCPLPYMANFAESCYRKNGAVRCICKENYAGPNCERCAPGYYGNP
LLIGSTCKKCDCSGNSDPNLIFEDCDEVTGQCRNCLRNTTGFKCERCAPGYYGDARIAKN
CAVCNCGGGPCDSVTGECLEEGFEPPTGTDCPTISCDKCIWDLIDDLRLAALSIEESKSG
LLSVSSGAAAHRHVNELNSTIYLLKTKLSERENQYVLRKIQINNAENTMKSFLSDVEELA
ERENQALRRGKLAQKESMDTINHATQLVEQAHDMRDKIQEINNKMLYYGEEHELTSEEIS
EKLVLAQKMLEEIRRRQPFFTQRELVDEEVDEAHELLNQAESWQRLSNDTRSLFPVVLEQ
LDDYNAKLSDLQESLDQALDHVRDAEDMNRATAARQRDHEKQHERVREQVEGVNVSLKTS
LDSLTTPRLTLSELDDTVKNASGIYAEIDGAKNELQGKLANLSNLRHDLVQEAVDHAQNL
QQEADELSRNLHSSDMNGLVQKALDASNVYENIANYVNEANETAAWALNITDRIYDAVSG
IDTQIIYHKDESENLLNQARELQAKTDPSNDEAVADTNRRVDGALARKSALRNRLNDAIK
RLQATERGDAHQRLGQSKLITEEASKTTVEVQQAAAPMADNLTNWSQNLQSFDSSAYNTA
VDSAQDAVRNLTEVVPQLLDQLRTVEQKRPASNVSASIQRIRELIAQTRSVASKIQVSMM
FDGQSAVEVHPKTSLDDLKTFTSLSLYMKPPPVKQPEPAGAADRFVLYLGSKHAKKEYMG
LAIKNDNLVYVYNLGNKDVEIPLDSKPVSSWPAYFSIVKIERVGKHGKVFLTVPSLSSTA
EEKFIKKGEFAGDDSLLDLDPEDTVFYVGGVPANFKLPASLNLPGFVGCLELATLNNDVI
SLYNFKHIYNMDPSKSVPCARDKLAFTQSRAASYFFDGSSYAVVRDITRRGKFGQVTRFD
IEVRTPADNGLILLMVNGSMFFSLEMRNGYLHVFYDFGFSNGPVHLEDTSKRAQINDAKY
HEISVIYHNDKKMILVVDRRHVKSMDNEKMKIPFTDIYIGGAPPEILQSRTLRAHLPLDI
NFRGCMKGFQFQKKDFNLLEQTETLGVGYGCPEDSLISRRAYFNGQSFIASVQKISFFDG
FEGGFNFRTLQPNGLLFYYASGADVFSISLDNGTVVLDVKGIKVQSADKQYNDGLSHLVI
TSVSPARYELIVDKSRLGSKNPTKGKGEQTQAGEKKFYFGGSPISPQYANFTGCISNAYF
TRLDRDVEVEDFQRYSEKVHTSLYECPIESSPLFLLYKKGKNSSKPKASQNKKGEKSKDA
PSGDPAGLKFPEGNAPRDAYCHLSNSPRAIEHAYQYGGTANSRQEFEHLKRDFGEKSQFS
IRLKTRSSHGMIFYVSDQEENDFMTLFLAHGRLVFMFNVGHKKLKIRSQEKYNDGVWHDV
IFIREKSSGRLIIDGLRVLEESLPPTGAAWNIKGPIYLGGVAPGRAVKNVQINSVYSFSG
CLGNLQLNGASITSASQTFSVTPCFEGPMETGTYFSTEGGYVVLDESFNIGLKFEIAFEV
RPRSSSGTLVHGHSVNGEYLNVHMKKGQVVVKVNNGIRDFSTSVTPKQSLCDGRWHRITV
IRDSNVVQLDVDSEVNHVVGPLNPKPVDHREPVFVGGVPESLLTPRLAPGRPFTGCIRHF
VIDGRPVSFSKAALVSGAVSINSCPAA
NT seq 5304 nt   +upstreamnt  +downstreamnt
atgtttctgttgtgtctgtttcagagatgtggtgctggattctttctcgcccagtcagga
gaatgtacgccctgtgtctgcaacgggaactctgacgagtgcttggatggctctggattc
tgtgtgcactgccagcggaacacaacaggagagcactgtgagaaatgtctagatggttat
attggagattccatcagggggccaccccggttctgccagccgtgtccctgtcccctaccc
tacatggccaattttgcagaatcctgctatagaaaaaatggagctgttcggtgtatttgt
aaagaaaactatgctggacctaactgtgaaagatgtgcccctggttactatggaaacccc
ttgctgattggaagcacctgtaagaaatgtgactgcagtggaaattcagatcccaacctg
atctttgaagattgtgatgaggtcaccggccagtgtaggaactgcctccgcaacaccacg
ggattcaagtgtgaacgctgtgcccctggctactatggggatgccaggatagccaagaac
tgtgcagtgtgcaattgcgggggaggcccgtgtgacagcgtaacgggagaatgcttggaa
gaaggttttgaaccccctacaggcacggactgcccaaccataagctgtgataagtgcatc
tgggatctgattgatgaccttcggttagccgcgctgtcgattgaagaaagcaaatctggt
ctgttgagtgtatcgtccggtgcggctgctcataggcatgtgaatgaactcaactccacc
atctacctcctcaaaacaaaattgtcagaaagagaaaaccagtacgtcctaagaaagata
caaatcaacaatgctgagaacacgatgaaaagctttctgtctgacgtggaggagttagct
gaaagggaaaatcaagccttgagaaggggcaagctggctcagaaggaaagcatggatacc
attaaccacgcaactcaactcgtggagcaagctcatgacatgagggataaaattcaagag
atcaacaacaagatgctctattacggggaggagcacgaactgacctctgaggaaatctct
gagaagctggtgttggcccagaaaatgctggaggagatcagacgccgtcaaccgttcttc
acacaaagggagctagttgatgaagaagtagatgaagcccatgagctgctgaaccaggcc
gagagttggcagcggctgtccaatgacacccgctctctgtttcctgtcgtcctggagcag
ctggatgactacaatgctaagttgtcagacctccaggaatcacttgaccaggctcttgac
cacgtcagggatgccgaagacatgaacagagccacggcagccaggcagcgggaccacgag
aaacaacacgagagagtgagggaacaggtggaaggggtgaacgtttctctgaagacatcc
ttggattctctgacaacacctcggctgaccctttcagaacttgatgacacagtaaagaat
gcttcggggatttatgcggaaatagacggagccaaaaatgaactacaaggcaaactagcc
aatctcagcaaccttcgtcatgatttagtccaagaagctgttgaccatgcacagaacctt
caacaagaggctgatgaattgagcaggaatctgcacagttcagatatgaatgggctggta
cagaaggctttggatgcttcaaatgtctatgaaaacatcgccaattacgtcaatgaagcc
aatgaaacggcagcatgggctctgaacatcactgaccgaatttatgatgctgtgagtggg
attgatactcaaatcatttaccataaggatgagagcgagaacctcctcaatcaagccaga
gagctgcaagcaaagacagatcctagcaatgatgaggcagtagccgacaccaacaggcgc
gtggatggagctctagcaaggaagagtgctctcagaaacagattgaatgatgccattaag
cgactgcaggccacagagagaggtgacgctcaccagcgcctggggcagtcgaagctgatc
acggaggaggcaagcaagaccacagtggaagtccagcaggcagccgccccgatggctgac
aatctaaccaactggtcgcaaaatcttcagagttttgactcttccgcctacaacaccgca
gtggactctgcccaagatgcagtacgaaatctgacagaagttgtccctcagctgctggat
cagcttcgcaccgtagaacagaagcggcccgcaagcaacgtctccgccagcatccagagg
atccgggagctcatcgcccagaccaggagcgtcgccagcaagatccaagtatccatgatg
tttgatggccagtcagcagtcgaggtgcaccccaaaaccagtttggatgacttaaagacc
ttcacatccctgagcctgtacatgaaacctcctcccgtgaagcagccagagccagctggg
gctgcggaccgctttgtcctgtacctcggaagcaaacatgccaaaaaagaatacatgggt
cttgcaatcaaaaatgataacctggtgtacgtttataatctgggaaataaggatgtagag
attcccctggactccaagcccgtcagttcctggcctgcttacttcagcattgtcaagatt
gaaagggtaggaaaacacggaaaggtgtttttaacagtcccgagtctaagtagcactgca
gaagaaaagtttattaaaaaaggcgaatttgcgggagatgactccttgttggatctggac
cctgaggacactgtgttttatgttggtggcgtgcctgcaaactttaagctccctgcaagc
ctcaacctgcctggcttcgtgggctgcctggaactggccactttgaataatgacgtgatc
agcttgtacaactttaagcacatctataacatggatccctccaagtcagtaccctgtgcc
agagataaactggcgttcactcagagtcgggctgccagctatttcttcgatggctctagt
tatgccgtggtgagggatatcacaaggagagggaaattcggtcaggtgactcgctttgac
atagaagttcgaacaccagctgacaatggcctcatactcctgatggtcaatggaagtatg
tttttcagcttggaaatgcgcaacggttacctacatgtgttctatgactttggatttagc
aatggccctgtgcatcttgaggacacatcgaagagagctcaaattaatgatgcaaaatac
catgagatctcagtcatttaccacaatgataagaaaatgattttggtggttgacagacga
catgtcaagagcatggacaatgaaaagatgaaaataccttttacagacatatacattgga
ggggctcccccagaaattttacaatccaggaccctcagagcacatcttcccctagatatc
aacttcagaggatgcatgaagggtttccagttccaaaagaaagatttcaatttattggag
cagacggaaactctgggggttggttatggatgcccagaagactctcttatatctcgcaga
gcatatttcaatggacagagtttcattgcttcagttcagaaaatatctttcttcgatggc
tttgaaggaggttttaatttccgaacgttacagccaaatgggttgctattctattatgct
tcaggggctgacgtgttctccatttctctggataacggcaccgtggtcctggacgtaaag
ggcatcaaggtgcagtcggcagacaagcagtacaatgatgggctgtcccacctggtcatt
acctctgtctcacccgcaagatatgaactgatagtagataaaagcagacttgggagtaag
aacccgaccaaagggaaaggagaacagacccaagcaggtgaaaagaagttttactttggc
ggctcccccatcagtccccagtatgctaacttcactggctgtataagtaatgcctacttc
accaggttggatagagatgtggaggtcgaagatttccagcggtattcggagaaggtccac
acctctctttatgagtgtcccatcgagtcttcgccgttgttccttctctacaaaaaaggg
aaaaattcctcaaagcctaaagcaagccagaataagaagggagagaaaagtaaagatgca
ccttccggggaccctgcaggcctcaagttcccagaggggaatgctccaagagatgcttac
tgccacctttccaacagtcctagggccatagagcacgcctatcagtacggagggaccgcc
aacagccgccaggagtttgaacacctaaaaagagattttggtgaaaaatctcagttctcc
attcgtctgaaaactcgctcctcccatgggatgattttctatgtctccgatcaagaagag
aatgacttcatgactctattcttagcccacggccgcttggttttcatgtttaatgttggc
cacaagaaactaaagattagaagccaagagaaatacaatgatggagtgtggcatgatgtg
atatttattcgggagaagagcagcggccgactgatcattgatggccttcgagtcctagaa
gagagtcttcctcctactggagctgcctggaacatcaagggtcctatttatttgggaggt
gtagctcctggaagggctgtgaaaaatgtccagataaactcggtctacagcttcagtggc
tgcctcggcaatcttcagctcaacggggcctccatcacctccgcttctcagacgtttagc
gtgacgccttgctttgagggtccgatggaaacagggacatacttttcaacagaaggaggc
tacgtggttctagatgagtccttcaatatcggactgaagtttgagattgccttcgaagtg
cggccccggagcagttcggggaccctcgttcacggccacagcgtcaacggggagtacctg
aatgttcacatgaagaagggccaggtcgtagtgaaggtcaacaacggcatcagggacttt
tccacctccgtgacgcccaagcagagtctctgcgacggcaggtggcacagaattacagtt
attagagattcaaatgtggttcagttggatgtagactctgaagtgaaccatgtggttgga
cccctgaatccaaaaccggttgatcacagggagccggtgtttgttgggggtgttccagag
tctctgctgaccccacgcctggcccccggccggcccttcactggctgcatccgtcacttt
gtgattgacgggcgcccggtgagcttcagcaaggcggccctggtcagcggcgccgtgagc
atcaactcctgcccggcagcctga

KEGG   Vulpes vulpes (red fox): 112925240
Entry
112925240         CDS       T05911                                 

Gene name
LAMA1
Definition
(RefSeq) laminin subunit alpha-1
  KO
K05637  laminin, alpha 1/2
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp05145  Toxoplasmosis
vvp05146  Amoebiasis
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05222  Small cell lung cancer
vvp05410  Hypertrophic cardiomyopathy
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
vvp05414  Dilated cardiomyopathy
vvp05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112925240 (LAMA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112925240 (LAMA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112925240 (LAMA1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112925240 (LAMA1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112925240 (LAMA1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112925240 (LAMA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112925240 (LAMA1)
   05414 Dilated cardiomyopathy
    112925240 (LAMA1)
   05416 Viral myocarditis
    112925240 (LAMA1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112925240 (LAMA1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112925240 (LAMA1)
   05145 Toxoplasmosis
    112925240 (LAMA1)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_B Laminin_N Laminin_I Laminin_II Hepar_II_III
Other DBs
NCBI-GeneID: 112925240
NCBI-ProteinID: XP_025861651
UniProt: A0A3Q7T023
LinkDB
Position
Unknown
AA seq 3133 aa
MRENSEKCSPREESSTTFKEALDWQPRRVASEINEAPELANFFGVRARGKCKTQRQDCAA
VQEGRAEEDRKLRLFPAILNLASNAHISTNATCGEQGPEMSCKLVEHVPGRPVRNAQCRI
CDASSANPKERHPISNAIDGTNNWWQSPSIQNGREYHWVTITLDLRQVFQVAYVIIKAAN
APRPGNWILERSLDGTTFSPWQYYAVSDTECLTRYNITPRRGPPTYRADDEVICTSYYSR
LVPLEHGEIHTSLINGRPSADDLSPKLLEFTSARYIRLRLQRIRTLNADLMTLSHRDPID
LDPIVTRRYYYSIKDISVGGMCICYGHASSCPWDETTKKLQCQCEHNTCGESCSRCCPGY
HQQPWRPGTVSAGNTCEKCNCHNKAQDCYYDESVAHQRRSLNTAGQFQGGGVCINCLQNT
MGINCETCIDGYYRPHKVSPYEDNPCRPCDCDPFGSLSSVCIKDELQSGLHKGKQPGQCP
CKEGYAGEKCDRCQFGYKAYPACIRCECSRAGSVNEDPCSEPCLCKENVEGDNCDLCKPG
FYNLKERNPEGCSECFCFGVSDVCDSLSWSLSQVKDMSGWLVTDLISSSKIRSQQDALGG
RHQISINNSVVMQRLTSKYYWSAPEAYLGNKLTAFGGFLKYTVSYDIPVETVDGDPMSYA
DVIIKGNGLTLSTQAEGLSLQPYEEYLNVVRLVPENFRDFNNKREIDRDQLMTVLANVTH
LLIRANYNSAKMALYRLDSVSLDTASPNVIDLALATEVEHCECPQGYAGISCESCLPGYY
RVDGILFGGICQPCECHGHAAECDIHGVCFACKHNTTGDHCEQCAPGFYGLPSRGTPGDC
QRCACPLSTASNNFSPTCHLEAGDEVVCDQCAPGYSGSWCERCADGYYGNPTVPGESCVP
CNCSGNVDPFEAGHCDSVTGECLKCIGNTDGAHCERCADGFYGDAVTAKNCRACECHGKG
SVSDVCHLDTGLCDCKPHVTGQQCDQCLPGYYGLHTGLGCLPCNCSASGSMSDDCTEDGQ
CHCLPGVAGEKCDRCARGFYAYQDGGCTPCDCAHTQHTCDPESGECICPPHTRGATCDQC
EDGYWGHDLELGCQACNCSAVGSASHGCDALTGHCPCKPAFGGLSCHQCSLGYRDFPDCV
ACDCDPRGTLADTCDEEQGLCSCAEDTGTCSCKENVLGLQCSECRAGTYALHADDPLGCI
PCFCFGLSQACSELEGYVRMPVTLDSEQPLLRVVSQSNLKGTTEGVYYQAPDVLLDAVTV
RQYVHAEPFYWRLPEQFQGDQLLAYGGRLKYSVAFYSSDGIGTFNLEPQVLIKGGRTRKQ
VIYVDVPAPENGIRQEQQVGMKENFWKYFNSVSEKPVTRSDFMSVLSNIEYILIKASYGQ
GLQQSRISNISMEVGRKAGELHPGREVASLLEKCLCPPGTAGFSCQDCAPGYHRGKLPQG
GSRGPRPLLAPCVPCNCNNHSDACDPETGKCLNCSHSTTGEHCDVCAPGYYGKVTGSASD
CSPCACPRSHPASFSPTCVLEGDADFRCDACVLGYEGQYCERCSSGYHGNPRALGGTCQR
CDCSPSGSVHGDCDRRSGQCVCRPGATGLRCEQCEPRHILLESDCVSCDDECVGVLLNDL
GNVGDTILAVNLTGVIPVPYGILSNLENTTKHLREALLKENPQKELARDQLEDVAEQTDN
LLRELTSVLTRSQNVTRMTERILKKSQDLMTFTEKLQMNIQEIIEKAATLNQTLDEDFQQ
PSSTLQNMQKNITSLLEIIQKRHFTQLHQNAMLELKAAEDLLLQIQKNCQEPQRELEVLK
AAASSLLSKHNSELQAAGDLVTEAEVKTQESNRLVHLAQANLQEFNDKKLRVQEEQNLTS
MLIARGRRLLDAVTTHSEVARDALAQLEHHRDELLLWTAKIRHHVDDLVMQMSKRRVLDL
VYRAEDHAAELQRLAGALDSGLGSVRHVSLNATSATHVHSNIRSLIEESEKVAKDALKTV
TTASLFSESLVSNGKVALQRSSRFLKEGNSLSRKHQGITLKLNELKNTANRFQEDVDTIT
RQTNESLLLLRAIPGGVRDKGTKIKELAISVNQSAANTLRNVVGLSQKLSNTSTDLSRVN
ATLQETNQLLQDSSMTTLLARRRVKDAETQASLLFDRLKPLKILEENLNRNLSEIKLLIN
QARKQAASIKVAVSADRDCIRAYQPPISSTNYNTLTLNVKTSEPDNLLFYLGSSTSADFM
AVEMRRGKVAFLWDMGSGSTRLEFPDFPIDDNRWHSIYVTRFGNVGSLSVKEMSAIEKPP
MKTSKSPGAANVLDINNSTLMFVGGLGGQIKKSPAVKVTHFKGCMGEAFLNGQSIGLWNY
IEREGRCHGCFGSPQNEDSSFHFDGSGYSVVEKTLRVTVTQIIMLFSTFSPNGLLLYLAS
NGTKDFLSIELVHGRVRVVVDLGSGPLALITDRRYNNGTWYKISFQRNRKQGFLAVIDAY
NTSYKETKQGETPGASSDLNRLDKDPIYVGGLPRSRIVRKGVTSKSYVGCIKNLEISRST
FDLLRHSYGVRKGCILEPIRSVSFLKGGYIELSPKSLSPESELLATFATKNSSGIILAAL
GRHGEKQGHLQAHGQPSQPFFSIMLIEGHVEVHVNSGDGTSLRRALLRAPKGTYSDGQEH
SISLKRTRRVITVQMDETNPVEMKLVPSAESRAINVSNLYVGGIPEGEGTSVLKMRKSFH
GCIKNLIFNMEHLDFTHVADYEQVDLDTCLLSERPKLALHKEDTELPPEPQPLPSLGQCA
VDRAPEYIPNAHQFGLMQGSHFVLPFNQLAVRKRLSVQLSIRTFASSGLIYYMAHQNQVD
YATLQLHGGYLHFMFDLGKGRTKVSHPAPISDGKWHTVKTEHFKRKGFMTVDGQESPTVI
AVGDGTMLDVEGKLYLGGLPSEYKARNIGNITHSVPACIGEVTVNGKQLDKDSPVSAFAV
TRCYAVAQEGTFFEGSGYAALVKEGYKVGSDVNITLEFRTTSENGVLLGISSAKVDAIGL
EIVNGKILFHVNNGAGRITAIYKPKAATTLCDGKWHTLQAQKSKHRLVLIVDGDAVRAES
PHTQSTSADTIDPIYVGGYPADIKQNCLSSQTSFRGCLRKLTLIKDSHVQSYDFSRAFDL
QGVFPHSCPGSEP
NT seq 9402 nt   +upstreamnt  +downstreamnt
atgagagagaactctgagaaatgcagtccccgtgaggaaagcagcaccacatttaaagaa
gcgctggactggcagcccaggagagtggcctcagaaataaatgaggcccctgaacttgcc
aacttcttcggggtgagagccagaggaaagtgcaaaacacagaggcaggactgtgctgcg
gtgcaggaagggagggctgaggaagatcggaaactgcggctgtttcctgccattctcaat
cttgccagcaatgcgcacatcagcaccaatgccacctgtggtgagcaggggcctgagatg
tcctgcaagcttgtagagcacgtgcccggtcgccccgtgcgcaatgcgcagtgccggatc
tgtgatgccagcagtgccaaccccaaagaacgccatccaatctcaaatgcaattgatggg
accaataactggtggcaaagtcccagtattcaaaatgggagagaatatcactgggtcaca
atcactctggacttaagacaggtctttcaagttgcctatgtcattatcaaagccgctaac
gcccctcgacctggaaactggattttggagcgttctctggatggcaccacatttagcccc
tggcagtactatgcagtcagtgacacagagtgtttgactcgttacaatatcactccaaga
cgggggccacccacctacagggccgatgatgaagtgatctgcacctcctactattctaga
ctggtgccacttgagcatggagagattcatacatcactaatcaatggcagaccgagtgct
gatgacctttcacccaagctgttggagtttacttctgcacgatacattcgccttcgctta
cagcgcattagaaccctcaatgccgatctcatgaccctgagccaccgtgaccctatagac
cttgatcctattgttacaagacgatattactattccatcaaagacatttctgttggagga
atgtgtatttgttatggccatgctagtagctgcccatgggatgaaactacaaagaaacta
cagtgtcagtgtgaacataacacctgtggagagagctgcagtaggtgttgtccggggtac
caccagcagccctggcggcccggcactgtttctgctggcaacacgtgtgaaaaatgtaat
tgtcacaataaagcccaagactgttactatgatgaaagtgttgcacatcagaggagaagt
ttgaatactgctggacagttccaaggaggaggggtttgcatcaattgcctgcagaacacc
atgggaatcaattgtgaaacctgtattgatggatactatagaccacacaaggtgtctcct
tatgaggacaacccttgtcgtccctgtgactgtgaccctttcgggtctctcagttctgtc
tgtattaaagatgagctccaatctggcttacataaagggaagcagccaggtcaatgtcca
tgcaaggaaggctatgcaggagaaaaatgtgatcgctgccaatttggttacaaggcttat
ccagcctgcatccgctgtgagtgtagtcgggctgggagtgtgaacgaggacccgtgctca
gagccttgtctctgtaaggaaaatgttgagggagacaattgtgacctctgcaagccagga
ttctataacttgaaggagagaaaccctgagggctgctcagagtgcttctgctttggcgtc
tctgatgtctgtgacagcctttcttggtccctcagtcaggtgaaagatatgtctgggtgg
ctggtcactgatctgatcagttcaagcaagatccggtctcagcaagacgcactgggtggg
cgtcatcagattagcatcaacaactcggtggtcatgcagaggctgacttccaagtattac
tggtcggccccggaggcctacctcggaaacaagctgactgcatttggtggcttcctgaag
tacacggtgtcttatgacatcccagtggagaccgtggatggcgaccccatgtcctatgcc
gacgttatcattaagggaaatggactcactttgagcacccaggccgagggcctgtcatta
cagccctatgaagagtacctgaacgtggtcagactagtgcctgagaacttccgagatttt
aataacaaaagggagatagatcgtgaccagctgatgactgtcctcgccaacgtgacacat
ctcttgatcagagccaactacaattctgcaaaaatggctctttacaggttggattctgtc
tctttggatacagccagccctaacgttatagacctggccctggccactgaggtggagcac
tgtgaatgcccccaaggctacgcagggatctcctgtgagtcctgcctccctggctattat
cgagtggatggaatactctttggaggaatttgtcagccctgtgaatgccacggccatgca
gctgaatgtgatattcacggcgtttgctttgcgtgcaagcacaacaccacgggggaccac
tgtgagcagtgcgcgcctggcttctatgggctgccttcccgagggacgcctggggactgc
cagcggtgtgcctgccccctctccacggcctccaacaatttcagccccacctgccaccta
gaggctggggatgaagtggtgtgtgaccaatgtgccccaggatactccggatcttggtgt
gagagatgcgcagacggttactatggaaacccaacagtgcccggggaatcctgtgttcct
tgcaactgcagtggcaatgtggaccccttcgaggcgggtcactgtgactctgtcaccgga
gagtgcctgaaatgcattgggaacacggatggtgcccactgtgagaggtgtgccgatggc
ttctatggggacgctgtgacagccaaaaattgccgcgcctgtgaatgccatggaaaaggc
tccgtttctgatgtctgccatctcgacactggactctgtgactgcaaacctcatgtgacc
ggacagcagtgtgaccagtgcttgcctggctattacgggttgcacacagggcttgggtgc
ctgccctgtaactgcagcgcgtcaggctccatgtccgatgactgcacagaggatggccag
tgtcactgcctaccaggcgtagctggggaaaagtgcgacaggtgtgcgcggggcttctat
gcataccaggacggtggctgtacaccctgtgactgtgctcacacgcagcacacttgtgac
ccggaatcgggggagtgtatctgccctcctcatactcggggcgccacctgtgaccaatgt
gaggacggatactggggccatgacctagagctcggatgccaggcctgcaattgcagtgct
gtggggtcagccagtcatggatgcgatgcactcacaggccattgcccatgtaagcctgca
tttggtggactgagctgccatcagtgctccctggggtacagagactttccagactgtgtg
gcctgtgactgtgacccgcgagggacattggcagacacctgtgatgaggaacagggtctt
tgcagctgtgcggaggacaccggtacctgctcttgcaaggaaaatgtgcttggccttcag
tgcagtgagtgtcgagctggcacctacgccctccacgctgatgaccctctgggatgtatt
ccctgcttctgcttcgggctgtcacaagcctgctcagagctggagggttatgtgaggatg
ccggtgacgctggactcagagcaacccctcctgcgcgtggtttctcagagcaacctcaag
ggcacgactgagggggtgtattaccaggcccctgatgtcctcctggacgccgtgactgtc
cggcagtacgtccatgcagagccgttttactggcggctgccggagcagttccagggagac
cagctcctggcctacggcggccgactgaaatacagcgtggccttctactcttccgatggc
attggcaccttcaacctcgagccccaagtgctgatcaaaggcggccggaccagaaagcag
gtcatttatgtggacgtgcctgcaccggagaatggaatacgacaagagcagcaagtggga
atgaaagagaatttctggaaatattttaactctgtttctgaaaaacctgtcacacgctcc
gattttatgtctgttcttagcaacattgagtatatcctcatcaaagcatcttacggccaa
ggattacagcaaagcagaatctcaaatatttcaatggaggttggcagaaaggctggagag
ttgcacccaggacgggaggtggcatccttattagagaagtgtctctgtcctcctgggacg
gctggattctcatgtcaggactgtgcacctgggtaccacagagggaagctcccacaaggt
gggagccgaggaccccgccctctgcttgctccgtgtgtgccctgcaactgcaacaaccac
agtgatgcctgcgaccccgaaactgggaagtgtctgaactgcagccatagcaccaccggt
gagcactgtgatgtgtgtgcccctgggtactacgggaaggtgaccggctcagccagcgac
tgctctccgtgtgcctgtcctcgcagccatcctgccagctttagtcccacttgtgtcttg
gaaggtgatgctgatttccgctgtgacgcctgtgtcctagggtacgaaggacagtactgt
gaaaggtgctcctcaggctaccatgggaaccctcgagcgctgggtggcacttgccagagg
tgtgactgcagcccgagtggctccgttcatggggactgtgaccgcaggtccgggcagtgc
gtgtgcaggccgggtgccacggggctccggtgtgagcagtgtgagccaaggcacattctc
ctggaaagcgattgtgtttcctgtgatgatgagtgtgtaggcgtgctgctgaatgactta
ggtaatgtgggtgacaccatccttgctgtgaacctcaccggcgttatccctgtcccctat
ggaattttgtcgaacctggaaaacacaacgaaacacctccgggaagctttattaaaagaa
aatccacagaaggaactggcaagagatcagcttgaagatgttgcagaacaaacagacaat
ctgctaagggagctcaccagtgtgttaacaaggagccaaaatgtaaccaggatgactgaa
agaatcctcaaaaagagtcaagacctcatgacatttactgagaagctgcaaatgaatatc
caagagattattgaaaaagcagcaactctaaatcagaccttggatgaagacttccagcaa
cccagttctactcttcagaatatgcaaaagaatattacatctttgctggaaatcatacag
aagaggcatttcactcagttgcaccaaaatgccatgctggaactcaaggctgctgaagat
ttattgttacaaattcagaagaattgccaagagccacagagagagttggaggtattaaaa
gcagcagcaagcagcctcctttcaaaacacaacagtgagctgcaggcagccggagacctc
gtgacggaggcagaggtgaagacccaggagagcaaccgcctggtgcaccttgcccaggcc
aacctgcaagagttcaatgataagaagctacgtgttcaagaagaacaaaatttgacctcg
atgctaattgccagagggagaagattgctagatgctgtcactactcattcagaggtggca
cgagatgccctggcacagttagagcaccaccgggatgagctacttctgtggactgccaaa
atcaggcaccatgtagacgatctggtcatgcagatgtccaaaaggagagtgcttgatctt
gtctacagagcagaggaccacgcagctgagctccagagactagcaggtgccctggacagt
ggccttggcagcgttagacatgtgtccctgaatgccaccagcgcaacccacgtccattcc
aacatccggagcctgattgaagagtcagagaaagtggcaaaagatgctctcaagactgtg
actacggcgagcctgttctcagaatcccttgtttctaatgggaaagtggctcttcagcgc
agttccagatttctaaaagaaggcaacagcctgagcagaaagcatcaaggtatcacattg
aaactgaatgaattgaaaaatacagcaaacagatttcaagaggatgtggatacaattact
aggcagaccaatgaatcactcttattactcagagcaattcctggaggtgtcagagacaaa
ggaaccaaaatcaaagagctggccatatctgtaaatcagagcgcggcaaacactctgagg
aacgtggtaggattaagccagaagctgtcgaacacatcaactgacctgtccagggttaat
gccaccttacaagaaaccaaccaacttctacaggactcctcaatgaccactctgctagct
agaagaagagttaaagatgcagaaacacaagccagccttttatttgatcggttgaagcct
ttgaagatattagaagagaacctgaacagaaacctttcagaaatcaagttgctcatcaac
caggcccggaagcaagcagcttctattaaagtcgccgtgtcagcagacagagattgtatc
cgggcctaccagcctccgatttcttctactaactataacaccttaacactgaatgtcaag
acaagtgaacctgataaccttctcttttacctcgggagcagcaccagtgctgatttcatg
gcggtggagatgcggcgagggaaggtggcctttctctgggatatgggctccgggtcaaca
cggttggaatttccagacttccccattgatgacaacagatggcacagtatctatgtaacc
agatttggaaacgttggctccctgagtgtaaaggaaatgagcgcaattgaaaagccacca
atgaaaacaagtaaatcccccggagcagcaaacgtcctagatataaacaactccacgcta
atgtttgtgggagggctcggaggacagatcaagaagtctcctgctgtgaaggtcacccat
tttaaaggctgcatgggggaggctttcctgaacggacagtccatcggcctgtggaactac
attgaacgggagggcaggtgccacggctgcttcggaagcccccagaatgaagactcttcg
ttccatttcgatgggagtgggtattcggtcgtggagaagacgctccgggtgactgtgact
cagattattatgctttttagtaccttttcacccaatgggcttcttctctaccttgcttca
aatggcactaaagactttttatccatcgaactggtgcatggcagagttagagttgtggtt
gacctgggttcagggcctcttgctcttattacagacagacgctataacaatggaacctgg
tacaaaatctccttccagagaaaccggaagcaaggattcctagcagttattgatgcatat
aataccagttataaagaaaccaagcaaggtgaaactccaggagcatcttctgatctcaat
cgtctagataaagatccaatttatgtgggtggattacctaggtcaagaattgtaaggaaa
ggtgtcaccagcaaaagctatgtgggctgtataaaaaacttggaaatatccagatcaacc
tttgatttactcagacattcctatggagtgagaaaaggctgtatactggagcctatccga
agtgttagcttcttgaaaggcggctacattgaattgtcacccaagtctttgtcaccagaa
tcagaattgttggcaacctttgccaccaagaacagcagtggcatcatcctggctgccctg
ggcagacatggggagaagcagggtcatctacaggcccatgggcaaccttcccagcccttc
ttttccatcatgctgattgaaggccatgttgaagtgcatgttaattctggggatggaaca
agcctgagaagagctctcctgcgtgctcccaagggcacatatagtgatggacaagaacat
tccatttccttgaaaaggaccaggagagttatcactgtccaaatggatgagacaaatcct
gtagaaatgaagttggtcccctcagcagaaagcagagcaataaatgtatccaacctgtat
gtaggggggattccagagggtgagggcacatcagtgctcaagatgagaaaatcattccat
ggctgtatcaaaaacctgatctttaacatggaacatttggatttcacacacgtggctgac
tatgagcaagtggacttggacacctgcttgctttcagaaaggccaaagctggctcttcac
aaagaggacaccgagctcccaccagagccccagcctttaccaagtctgggacagtgtgct
gtggacagagccccggagtatatccccaatgctcaccagtttggcctcatgcaaggcagc
catttcgtgctgcctttcaatcagctggcggtcagaaagaggctctcagttcagctgagt
atccgaacatttgcctccagtggtttaatttactacatggctcaccagaaccaagtggat
tatgccacactccagctgcacgggggctaccttcacttcatgtttgatcttggaaaaggc
agaactaaggtctcccaccctgcaccgatcagtgatggcaagtggcacacggtcaagaca
gagcactttaaaagaaaaggtttcatgacagttgatggccaggaatcccccacagtgatc
gctgtgggagatggtaccatgttggatgtagaaggaaagctgtacctgggaggccttccc
tctgagtacaaggccaggaacattggaaacatcacccacagtgttcctgcctgcattggg
gaagtgacagtgaatggcaaacagctggacaaggacagcccagtgtctgcatttgcagta
accaggtgctatgcagtggcccaggaaggaactttctttgaaggaagtggatatgcagct
cttgtcaaagagggctacaaagtcggatcagatgtaaacatcacactggaatttcgtacc
acttctgagaatggtgtcctcttggggatcagcagtgccaaagtagatgccattggatta
gagattgtgaatggcaagatcttatttcatgttaacaatggtgctggtaggataacagcc
atatacaagcccaaagctgccactactctctgtgatggaaaatggcacacacttcaagct
cagaagagcaaacaccgcttggttctgattgttgatggggatgcagttcgtgctgaaagt
ccacacactcagtccacctcagcagacaccattgatcccatttatgtcggtggctatcct
gctgatataaagcaaaactgcttgagcagccagacgtccttccgggggtgtttgagaaag
ctcactttgattaaggactcacacgtacaatcctatgacttcagcagagcttttgaccta
caaggagttttccctcattcctgtcctgggtctgaaccctga

KEGG   Vulpes vulpes (red fox): 112925377
Entry
112925377         CDS       T05911                                 

Gene name
RELN
Definition
(RefSeq) LOW QUALITY PROTEIN: reelin
  KO
K06249  reelin [EC:3.4.21.-]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp05017  Spinocerebellar ataxia
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112925377 (RELN)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112925377 (RELN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112925377 (RELN)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    112925377 (RELN)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112925377 (RELN)
Enzymes [BR:vvp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     112925377 (RELN)
SSDB
Motif
Pfam: BNR EGF_2 EGF_Tenascin Reeler hEGF EB
Other DBs
NCBI-GeneID: 112925377
NCBI-ProteinID: XP_025861867
UniProt: A0A3Q7TKP1
LinkDB
Position
Unknown
AA seq 3346 aa
MSDHQFGNQFMCSVVASHVSHLPTTNLSFVWIAPPAGTGCVNFMATATHRGQIIFKDALA
QQLCEQGAPTEATMHPHLAEVHSESIILRDDFDSYHQLELNPNIWVECKNCETGEQCGAI
MHGNAVTFCEPYGPRELITTGLNTTTASVLQFSIGSGSCRFSYSDPSITMSYAKNNTADW
IQLERIRAPSNTSTTIHILYLPEDAKGENVQFQWKQESLHVGEVYEACWALDNILIINSA
HKQVILEDTLDPVDTGNWLFFPGATVKHSCQSEGNSIYFHGNEGSEFNFATTRDVDLSTE
DIQEQWSEEFESQPTGWDILGAVIGTECGTVESGLSAVFLKDGERKLCTPYMDTTGYGNL
RFYFVMGGMCDPGDSHENDISLYAKIEGRKEHITLDTLSYSSYKVPSLVSVVINPELQTP
ATRFCLRQKNHQGHNRNVWAVDFFHVLPVLPSTMSHMIQFSINLGCGTHQPGNSISLEFS
TNHGRSWSLLHTECLPEICAGPHLPHSTIYSSENYSGWNRITIPLPNAALTRDTRIRWRQ
TGPILGNMWAIDNVYIGPSCLKFCSGRGQCTRHGCKCDPGFSGPACEMASQTFPMFISES
FGSSRLSSYHNFYSIRGAEVSFGCGVLASGKALVFNKDGRRQLITSFLDSSQSRFLQFTL
RLGSKSVLSTCRAPDQPGEGVLLHYSYDNGITWKLLEHYSYLNYHEPRIISVELPDDARQ
FGIQFRWWQPYHSSQGEDVWAIDEIIMTSVLFNSISLDFTNLVEVTQSLGFYLGNVQPYC
SHDWTLCFTGDSKLASSMRYVETQSMQIGASYMIQFSLVMGCGQKYTPHMDNQVKLEYST
NHGLTWHLVQEECLPSMPSCQEFTSASIYHASEFMQWRRVIVLLPQKTWSSATRFRWSQS
YYTAQDEWALDNIYIGQQCPNMCSGHGSCDHGVCRCDQGYQGTECHPEAALPSTIMSDFE
NQNGWESDWQEVIGGEIVKPEQGCGVISSGSSLYFSKAGKRQLVSWDLDTSWVDFVQFYI
QIGGESAACNKPDSREEGVLLQYSNNGGIQWHLLAEMYFSDFSKPRFVYLELPAAAKTPC
TRFRWWQPVFSGEGYDQWALDDIIILSEKQKQVIPIVNPTLPQNFYEKPAFDYPMNQMSV
WLMLANEGMVKNETFCSATPSAMVFGKSDGDRFAVTRDLTLKPGYVLQFKLNIGCANQFS
SAAPVLLQYSHDAGMSWFLVKEGCYPASAGKGCEGNSRELSEPTMYHTGDFEEWTRITII
IPRSLASSKTRFRWIQESSSQKNVPPFGLDGVYISEPCPSYCSGHGDCVSGVCFCDLGYT
AAQGTCVSNVPNHSEMFDRFEGKLSPLWYKITGGQVGTGCGTLNDGKSLYFNGPGKREAR
TVPLDTRNIRLVQFYIQIGSKTSGITCIKPRARNEGLVVQYSNDNGILWHLLRELDFMSF
LEPQIISIDLPREAKTPATAFRWWQPQHGKHSAQWALDDVLIGMNDSSQTGFQDKFDGSI
DLQASWYRIQGGQVGIDCLSMDTALIFTENIGKPRYAETWDFHVSASTFLQFEMSMGCSK
PFSDSHSVQLQYSLNNGRDWHLVTEECVPPTIGCLHYTESSTYTSERFQNWKRITVYLPL
STISPRTRFRWIQSNYTMGADSWAIDNVLLASGCPWLCSGRGICDDGRCVCDRGFGGAYC
VPVVPLPSILKDDFNGNLHPDLWPEVYGAERGNLNGETIKSGTSLIFKGEGLRMLISRDL
DCTNTMYVQFSLRFIAKGTPERSHSILLQFSINGGITWHLMDEFYFPQTTNILFINVPLP
YTAQTNATRFRLWQPYNNGKKEEIWIIDDFIIDGNNLNNPLMLLDTFDFGPREDNWFFYP
GGNIGLYCPYSSKGAPEEDSAMVFVSNEVGEHSITTRDLDVNENTIIQFEINVGCSTDSS
STDPVRLEFSRDFGATWHLLLPLCYHSSSHISSLCSTEHHPSSAYYPGTTQGWRREVVHF
GKLHLCGSVRFRWYQGFYPAGSQPVTWAIDNVYIGPQCEEMCNGHGSCINGTKCICDPGY
SGPTCKISTKNPDFLKDDFEGQLESDRFLLMSGGKPSRKCGILSSGNNLFFNEDGLRMLM
TRDLDLSHARFVQFFMRLGCGKGVPDPRSQPVLLQYSLNGGLSWSLLQEFLFSNSSNVGR
YIALEIPLKARSASTRLRWWQPSENGHFYSPWVIDQILIGGNISGNTVLEDDFTTLDSRK
WLLHPGGTKMPVCGSTGDALVFIEKASTRYVVTTDIAVNEDSFLQIDFAASCSVTDSCYA
IELEYSVDLGLSWHPLVRDCLPTNVECSRYHLQRILVSDTFNKWTRITLPLPHYTRSQAT
RFRWHQPAPFDKQQTWAIDNVYIGDGCIDMCSGHGRCIQGSCVCDEQWGGLYCDEPEISL
PTQLKDNFNRAPSNQNWLTVNGGKLSTVCGAVASGMALHFSGGCSRLLVTVDLNLTNAEF
IQFYFMYGCLITPNNRNQGVLLEYSVNGGITWNLLMEIFYDQYSKPGFVNILLPPDAKEI
ATRFRWWQPRHDGLDQNDWAIDNVLISGSADQRTVMLDTFSSAPVPQHERSPADAGPVGR
IAFDMFMEDKTSVNEHWLFHDDCTVERFCDSPDGVMICGSHDGREVYAVTHDLTPTEGWI
MQFKISVGCKVSEKVAQNQIHVQYSTDFGVSWNYLVPQCLPADPKCSGSVSQPSVFFPTK
GWKRITYPLPESLVGNPVRLRFYQKYSDMQWAIDNFYLGPGCVDNCRGHGDCLKEQCICD
PGYSGPNCYLTHTLKTFLKERFDSEEIKPDLWMSLEGGSTCTECGILAEDTALYFGGSTV
RQAITQDLDLRGAKFLQYWGRIGSENNMTSCHRPICRKEGVLLDYSTDGGITWTLLHEMD
YQKYISVRHDYILLPEDALTNTTRLRWWQPFVISNGLVVSGVXACPVGSRQHTDWRSRNN
PSQLVDTFDDEGTSHEENWSFYPNAVRTAGFCGNPSFHLYWPNKKKDKTHNALSSRELII
QPGYMMQFKIVVGCEATSCGDLHSVMLEYTKDARSDSWQLVQTQCLPSSSNSIGCSPFQF
HEATIYNAVNSSSWKRITIQLPDHVSSSATQFRWIQKGEETEKQSWAIDHVYIGEACPKL
CSGHGYCTTGAVCICDESFQGDDCSVFSHDLPSYIKDNFESARVTEANWETIQGGVIGSG
CGQLAPYAHGDSLYFNGCQIRQAATKPLDLTRASKIMFVLQIGSTSQTDSCNSDVSGPHA
VDKAVLLQYSVNNGITWHVIAQHQPKDFTQAQRVSYNVPLEARMKGVLLRWWQPRHNGTG
HDQWALDHVEVVLVSTRKQNYMMNFSRQHGLRHFYNRRRRSLRRYP
NT seq 10041 nt   +upstreamnt  +downstreamnt
atgtctgaccaccagtttggtaaccagtttatgtgcagtgtggtggcctctcatgtgagt
catctacccacaaccaacctcagcttcgtctggattgctccacctgcaggcactggctgc
gtgaatttcatggctacggcgacacacaggggccagattattttcaaagatgcgttagcc
cagcagttgtgtgaacaaggagctccaacagaagctacgatgcacccacatctagctgaa
gtacatagcgaaagcattatcctacgagatgactttgactcctaccaccaactagagttg
aatccaaatatatgggttgaatgtaagaactgtgagaccggagaacagtgtggtgcaatt
atgcatggcaatgctgtcaccttctgtgagccatatggtccgagagaattgattaccaca
ggccttaatacaacaactgcctctgtcctccaattttccattggctcgggttcatgtcgc
tttagttattcggaccccagcatcaccatgtcctatgccaagaataataccgcagactgg
attcagcttgagagaattagagccccctccaataccagcacaaccatccatatcctctac
cttcctgaagacgccaaaggggagaacgtccagtttcagtggaagcaagaaagtctccat
gtaggcgaagtgtatgaagcctgctgggccttagataacatcctgatcatcaactcagct
cacaaacaagtcattttagaagacactcttgatccagtagacacaggcaactggcttttt
ttcccaggagctacagttaagcatagctgtcagtcagaaggcaactctatttatttccac
ggaaatgaaggcagtgagttcaattttgccaccacccgggatgtagatctttctacagag
gatattcaagagcagtggtcagaagaatttgaaagccagcctacagggtgggacatcctg
ggagctgtcattggtacagaatgtggaacagtagaatcaggtttatcagcagtcttcctc
aaagatggagagaggaaattatgcaccccgtatatggataccaccggttatgggaacttg
agattttactttgtcatgggaggaatgtgtgaccctggagattctcatgaaaatgatatc
tccctgtatgccaagattgaaggaagaaaagagcacattacactggatacactttcctat
tcctcatataaggttccatctttagtttccgtcgtcatcaatcctgaacttcagactcct
gctaccagattttgtctcaggcaaaaaaaccaccaagggcataacaggaacgtctgggct
gtcgattttttccacgtcttacctgttctcccttctacgatgtctcacatgatacagttt
tccattaatctgggatgtggaacacatcaacctggtaacagcatcagcttagagttttcc
accaaccatgggcgttcctggtcgctcctgcacactgagtgtttacctgagatctgtgct
ggaccccacctcccccacagcactatctactcctccgaaaactatagcgggtggaaccga
ataacgattccccttcctaacgcagcactaaccagggacaccagaattcgctggagacaa
acgggaccaatccttggaaacatgtgggcaattgataatgtttatattggtccgtcgtgt
ctcaagttctgttccggcagaggacagtgcactcgacatggttgcaagtgtgaccctgga
ttttctggcccagcctgtgagatggcatcccagacattcccaatgtttatttccgaaagc
tttggcagttccaggctctcctcctaccataacttttactctatccgtggtgctgaagtc
agctttggttgtggtgtcttggccagtggtaaggccctggttttcaacaaggatgggagg
cgtcagctaattacatctttccttgacagctcacagtccaggtttctgcagttcacattg
aggctggggagcaagtctgttctgagcacatgcagagcccctgaccagcctggtgaagga
gttttattgcattattcttatgataatgggataacttggaaactcttggagcactattca
tatctcaactatcatgagcccagaatcatctctgtagagttaccagatgatgcaagacag
tttggaattcagttcagatggtggcaaccatatcattcttcccagggagaagatgtatgg
gccattgatgagattatcatgacatctgtccttttcaacagcattagccttgactttacc
aatcttgtggaggtcactcaatctctaggattctaccttggaaatgttcagccatactgt
agccatgactggacactttgtttcacaggagattctaaacttgcctcaagtatgcgctat
gtggaaacacaatcaatgcagataggagcatcctatatgattcagttcagtttggtgatg
ggctgtggccagaaatacactccgcacatggacaaccaggtgaaactggagtactccacc
aaccatggcctcacctggcacctggtccaagaggaatgtcttccaagtatgccaagttgt
caagaattcacatcggcaagtatttaccacgccagtgagttcatgcagtggcgaagagtc
atagtgcttcttccccagaaaacttggtccagtgccacccgcttccgctggagtcagagc
tactacacagcccaggatgagtgggctttggacaacatttacattgggcagcagtgtcca
aacatgtgcagcgggcacggctcctgtgaccacggcgtatgcaggtgcgaccagggatac
caaggcactgagtgccacccggaagctgctcttccttccacgattatgtcagactttgag
aaccagaatggttgggagtctgactggcaagaagtcatcgggggagaaattgtaaagcca
gaacaaggatgtggggtcatctcatctggatcatctctgtatttcagcaaggctgggaaa
agacagctggtgagctgggatctggacacttcttgggtggactttgtccagttctacatt
cagattggtggagagagtgctgcgtgtaacaagccagacagcagagaggagggtgtcctc
cttcagtacagcaacaatggaggcatccagtggcacctgctggcagaaatgtacttctca
gacttcagcaaacccagattcgtctacctggagctcccagctgctgctaagaccccttgt
accaggttccgctggtggcagcctgtgttctcaggggagggctatgaccagtgggcgttg
gatgacatcatcatcctgtcagagaagcaaaagcaggtcatcccaattgtgaacccaact
ttaccccagaacttttatgagaagccagcttttgattacccaatgaatcaaatgagtgtt
tggttgatgttggctaatgaaggaatggttaaaaatgagactttctgctctgccacacca
tcggccatggtatttggaaaatcagatggggatcgatttgcagtaactcgagatttgact
ttgaaacctggatacgtactacagttcaagctaaacatagggtgtgccaatcagttcagc
agtgctgccccggttcttcttcagtactctcacgatgctggtatgtcctggtttctggtg
aaagaaggctgttacccagcttctgcaggcaaaggatgtgaaggaaactccagggaacta
agtgagcccaccatgtatcacacgggggactttgaagaatggacaagaatcaccatcatt
atcccaaggtctcttgcgtccagtaaaaccagattccgatggattcaggagagcagctca
cagaagaatgtgcctccctttggtctggatggagtgtacatatctgagccttgtcccagt
tactgcagtggccacggggactgtgtctcaggggtgtgtttctgtgacctgggatatact
gctgcacaagggacctgtgtgtctaatgtccctaatcacagtgagatgttcgataggttt
gaggggaagctcagccctctatggtacaagataactggaggccaggttggaaccggctgt
ggaacacttaatgatggcaaatctctctacttcaatggccccggcaaaagggaagcgagg
actgtccccctggacaccaggaatatccgacttgttcagttttatatacaaattggaagt
aaaacttcaggaattacctgtatcaaaccaagagctagaaatgaagggcttgttgttcag
tattcaaatgacaacgggatactctggcatttgcttcgagagttggacttcatgtcattt
ctggagccacagatcatttccattgacctaccacgggaggcgaaaacccccgctacagct
tttcgatggtggcagccccaacatgggaaacattcagcccagtgggccttggatgatgtc
cttataggaatgaatgacagctctcaaactgggtttcaagacaaatttgatggctccatt
gatttgcaagccagctggtaccgaatccagggaggtcaagttggtattgactgtctctct
atggacaccgctctcatattcactgaaaacataggaaaacctcgttatgcagagacctgg
gattttcatgtgtcagcatcaaccttcttgcagtttgaaatgagcatgggctgcagcaag
cccttcagcgactcccacagtgtacagctccagtattctctaaacaacggcagggactgg
cacctggtcactgaagagtgtgtgcctccaaccattggctgcctgcactacacggaaagt
tcaacttacacctccgaacgattccagaattggaagcggatcaccgtctaccttccactc
tccaccatatctcccaggacccgcttccgatggattcagtccaactacaccatgggggcc
gactcctgggctattgataacgttctgctggcctcggggtgcccctggctgtgctcagga
cgagggatttgcgatgacggacgctgtgtgtgtgaccggggctttggtggagcctactgt
gtgccagttgttcctctgccctccattcttaaggatgatttcaatgggaacctacatccc
gatctttggcctgaagtgtatggtgctgagaggggaaatctgaatggtgaaaccatcaaa
tctggaacatcgcttatttttaaaggggaaggactgaggatgcttatttcaagagatcta
gactgtaccaatactatgtatgtccagttttcacttagatttatagcaaaaggtacccca
gagaggtctcactctattctattacaattctccatcaatgggggaatcacttggcacctg
atggacgaattttacttccctcaaacaaccaacatacttttcattaatgttcccttgcca
tatactgcccagaccaacgctacaaggttcagactctggcaaccttataataatggtaag
aaagaagaaatctggattattgatgacttcattattgatgggaataatctaaacaaccct
ctgatgctactggatacatttgactttggacccagagaagacaattggtttttctatcct
ggtggtaacattggtctttattgcccatattcttcaaaaggagcacccgaggaagattca
gctatggtatttgtttcaaatgaagttggtgagcattccattaccactcgtgacctggat
gtgaatgagaacaccatcatacaatttgagatcaatgttggatgctccactgatagctca
tctactgatccggtcagacttgagttttcaagggacttcggggccacttggcacctgctg
ctccccctctgctaccacagcagcagccacatcagctccctgtgctccactgagcaccac
ccaagcagcgcctactacccagggaccacccagggctggagaagggaagtcgtgcacttt
gggaagttgcacctttgcggatctgtgcgtttcagatggtaccaaggattttaccctgct
ggctctcagccagtgacatgggccattgataatgtctatatcggtccccaatgtgaagag
atgtgcaacggacatgggagttgtatcaatggaaccaagtgtatatgtgaccctggctac
tcaggtccaacctgtaaaataagcaccaaaaatcctgactttctcaaggatgattttgaa
ggtcagctagaatctgatagattcttattaatgagtggtggaaagccatctcggaagtgt
ggaatcctttccagtggaaacaacctctttttcaatgaagatggcttacgcatgttgatg
acacgtgatctagatttatcacatgctagatttgtgcagttcttcatgagactaggatgt
ggtaagggtgttcctgaccccaggagccagcctgtgcttctacagtattcactcaatggc
ggcctctcatggagtctccttcaagagttccttttcagcaactcgagcaacgtgggcagg
tacattgccctggagatacccttgaaagcacgttcggcttctactcgcctccgctggtgg
caaccatctgaaaatgggcacttctacagtccctgggtaatcgaccagattcttattgga
ggaaacatttctggcaatacagtcttggaggatgatttcacaaccctggacagtaggaaa
tggctacttcacccaggaggcaccaagatgcctgtgtgtggctctactggtgatgccctg
gtcttcattgaaaaggccagtacccgctatgtggtcaccacagacattgctgtgaatgag
gattcatttctacagatagattttgctgcctcctgctcagtcaccgactcctgttatgct
attgaattggaatactcagtagatcttggattatcatggcacccattggtaagggactgt
ctacctaccaatgttgaatgcagtcgatatcacctacagcggatcctggtgtcagacacc
ttcaacaaatggaccagaatcaccctgcctctccctcattataccaggtcccaagcaact
cgtttccgttggcatcaaccagctccttttgacaagcagcagacgtgggcgatagataac
gtctacatcggggacggctgtatagatatgtgcagtggccatggacggtgcatccaagga
agctgtgtctgtgatgagcagtggggtggcctctactgtgatgagcccgagatctccctt
ccaacccaactcaaagacaacttcaatagagcgccatccaaccagaactggttgaccgtg
aatggagggaaactcagtaccgtgtgcggcgctgtggcttcaggaatggctctgcatttc
agcgggggctgcagccgactgttggtcacggtggatctgaacctcactaatgctgagttt
atccaattttacttcatgtacggatgcctgattacacccaacaaccgcaaccaaggtgtt
ctcctggaatattctgtcaacggaggcattacctggaacctgctaatggaaattttctat
gatcagtacagtaaacctggattcgtaaatatccttctccctcctgatgcaaaagagatt
gctactcgcttccgctggtggcagccaaggcatgacggcctggatcagaacgattgggcc
atcgacaatgtcctcatctcgggctctgccgaccagaggaccgtcatgctggacaccttc
agcagcgcccctgtgccccagcatgagcgctcccccgcagacgctgggcctgtcgggaga
attgcctttgacatgtttatggaggataagacgtcagtgaatgagcattggctattccat
gatgattgcacagtagaaagattctgtgactcccctgatggtgtcatgatttgtggtagc
catgatggaagagaagtgtatgcagtgacccatgacctgactcccactgaaggctggatc
atgcaattcaagatctctgttggatgtaaagtatctgaaaaagttgcccagaatcaaatt
catgtgcagtattctactgactttggtgtgagctggaattatctggtcccccagtgctta
cctgcagacccaaaatgttctggaagtgtttctcagccatctgtattctttccaaccaaa
ggttggaaaaggatcacctacccactccctgaaagcttagtggggaatccagtaagatta
aggttctatcagaagtactcagatatgcagtgggcaatcgataatttctacctgggccct
ggatgcgtggacaactgtaggggccatggagattgcttaaaggaacagtgcatctgtgat
ccgggatactctgggcctaactgctacttgactcacactctgaagactttcctgaaggaa
cgctttgatagtgaagaaatcaagcctgatttatggatgtccctagaaggtggaagtact
tgtactgagtgtgggattcttgctgaggacactgcactctattttgggggatccactgtg
agacaagctattactcaagatttggatctcagaggggcaaaattcctacaatactggggg
cgcatcgggagtgaaaacaacatgacctcctgccatcggcccatctgccggaaggaaggc
gtgctgttggactactctaccgatggaggaattacttggactttgctccatgagatggac
taccagaaatacatttctgttagacatgactacatacttcttcctgaggacgccctcacc
aacacaactcgacttcgctggtggcagccttttgtgatcagcaatggacttgtggtctct
ggggtangagcgtgcccagtgggctctagacaacatactgattggaggagcagaaataat
cctagtcaactggtcgatacttttgatgatgaaggtacttcccatgaagaaaattggagt
ttttaccctaatgcagtgaggacagcaggattctgtggcaatccatccttccacctctac
tggccgaataaaaagaaggacaagacccacaatgctctctcctccagagaactcattata
cagccaggatatatgatgcagtttaaaattgttgtgggttgcgaagccacttcttgtggt
gaccttcattctgtaatgttggagtacactaaggatgcaaggtctgattcctggcagctc
gttcagacccagtgccttccttcctcttcaaacagcattggctgctcccccttccagttc
catgaagccaccatctacaatgctgtcaacagctcaagctggaagagaatcaccattcag
ctgcctgaccatgtctcctccagtgcaacacagttccgctggatccagaagggagaagaa
actgagaagcagagctgggcgattgaccatgtgtacatcggagaggcttgccccaagctc
tgcagtgggcacggatactgcaccactggcgccgtctgcatctgtgatgagagtttccaa
ggtgatgattgctctgttttcagtcatgatcttcccagttatattaaagataattttgag
tcagcaagagtcacagaagcaaactgggagaccattcaaggcggggtaataggaagtggc
tgtgggcagctggcaccctatgcccatggagactccctctattttaatggctgtcagata
aggcaggcggccaccaagcctctggatctcactcgagcaagcaaaatcatgtttgttttg
caaattggaagcacgtcacagacagacagttgcaacagtgacgtgagtggcccgcacgcc
gtagacaaggcggtgctgctgcagtacagcgtcaacaacgggatcacctggcacgtcatc
gcgcagcaccagcccaaggacttcacgcaggctcagagggtgtcttacaacgtccccctg
gaggcacggatgaaaggagttttattgcgctggtggcaaccacgccacaatggaacaggt
catgatcaatgggctttggaccatgtggaggtcgtcctagtaagcactcgcaaacaaaat
tacatgatgaatttttcacgacaacatgggctcaggcacttctacaacagaagacgaagg
tcacttagacgatacccctga

KEGG   Vulpes vulpes (red fox): 112925468
Entry
112925468         CDS       T05911                                 

Gene name
COL4A3
Definition
(RefSeq) collagen alpha-3(IV) chain
  KO
K06237  collagen type IV alpha
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04926  Relaxin signaling pathway
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04974  Protein digestion and absorption
vvp05146  Amoebiasis
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112925468 (COL4A3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112925468 (COL4A3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112925468 (COL4A3)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112925468 (COL4A3)
  09154 Digestive system
   04974 Protein digestion and absorption
    112925468 (COL4A3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112925468 (COL4A3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112925468 (COL4A3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112925468 (COL4A3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112925468 (COL4A3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112925468 (COL4A3)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   112925468 (COL4A3)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112925468 (COL4A3)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 112925468
NCBI-ProteinID: XP_025861983
UniProt: A0A3Q7SY55
LinkDB
Position
Unknown
AA seq 1712 aa
MPTDTAHLRPTGFFLVHWHMPTPLMEFYDCQELVVSASCPNWMLTNYQFSTYPWIHLINP
QAFVQDIFYIRGCVCKDKGQCFCDGLEGEKGERGFPGPAGFPGQKGFPGPEGLPGPQGPK
GSPGLPGLTGPKGVRGITGLPGFSGPPGLPGTPGHPGPYGPPGVPGCNGSKGEQGFPGLP
GTPGYPGIPGAVGLKGEKGAPATEGIELDGRGDPGLPGAPGFQGLPGLPGFPGPAGPPGP
PGFLGFPGAMGPPGPKGQMGDKVIGQKGERGVKGLTGPPGPPGTVIVTLTGPDNRTDLKG
EKGDKGAMGKPGPPGPSGPPGESYGSEKGAPGEPGPQGKPGKDGAPGFPGTEGPKGNRGF
PGLRGEDGIKGWKGDVGPPGFRGPTEYYDAYQEKGDEGIPGPPGPKGARGPQGPSGPPGV
LGSAGLSKPGLRGAPGSPGMKGRKGKQGPPGKNAVGPPGSPGCPGSPGPIGLPGYPGPPG
DIVFRKGPPGGGGLPGHVGFPGIPGVEGPKGEPGLLCVQCAYIPGRPGLPGLPGLDGIKG
IPGGQGAAGIKGSPGSPGSAGLPGFPGFPGAPGAPGLKGEKGETSEPEGQVGAPGDPGLR
GHPGRKGLDGIPGTPGIKGPPGPKGEPALSGEKGDQGPPGDPGIPGSPGPAGPPGPPNYG
PQGEPGPKGTQGVPGAPGPPGEAGPKGEFGISTPVPGPPGPPGPPGHAGPRGPPGIPGPI
GKCGDPGLPGPDGEPGIPGIGFPGPPGPKGDQGFPGAKGAPGCPGEMGKPGSPGEPGLPG
AKGEPGLAMPGEPGIPGFPGERGNSGENGEIGLPGLPGLPGIPGTGGLDGPPGDPGKPGL
PGEKGPPGSCTEGPRGAHGLPGLNGLEGQPGRRGETGPKGDPGIPGLDRSGFPGEPGPPG
VPGHRGEIGPPGQKGYPGNPGFLGPPGEKGMMGMMGYPGNTGPPGPPGIPGTPGQRGSFG
IPGAKGEKGPPGAKGEEGEKGPMGPCRITSSVGDKGEPGLKGFAGKPGEKGNRGIPGLPG
LKGFEGPPGPPGPPGSRGDPGSFGNPGEAGPRGSPGNMGNMGMPGPKGHRGPLGLPGVTG
RPGLPGVHGLRGDKGEPGYSAGTRPGPPGLKGDPGLPGAMGRKGERGLPGIPGHSGPAGT
EGAPGHPGSPGHPGKPGPDGDLGLKGIKGFPGSPGVKGPPGPPGFLGSPGPMGMRGNQGR
DGIPGPPGEKGETGLLGAHPGPGGSPGPPGAKGDRGAPGLPGPPGRKGAMGDAGPRGPTG
MTGLPGPPGFPGAVIPGQKGNRGPPGFRGNPGEPGPPGPPGSHVKGIKGDKGLMGEPGPR
GLPGTVGDKGPPGQPGAPGSPGLPGLRGDPGFYGFPGVKGEKGNPGFPGPAGPPGQIGPK
GPPGVRGDPGTVKIISLPGSPGPPGRAGGPGMPGEPGPPGPPGILGPCGPRGKPGMDGIP
GTPGPIGEKGNKGCKGEQGPPGLDGLPGLKGKPGDPGPPATGTMKRGFIFTRHSQTTVIP
SCPEGTAPLYSGFSLLFIQGNEQAHGQDLGTLGSCLQRFTTMPFLFCNINNVCNFASRND
YSYWLSTPALMPMDMAPITGRALEPYISRCTVCEGPTIAIAIHSQTTDIPSCPNGWISLW
KGFSFIMFTSAGSEGAGQALASPGSCLEEFRASPFIECHGRGTCNYYSNSYSFWLASLNP
QRMFRKPIPSTTKAGELEKIISRCRVCMKRRQ
NT seq 5139 nt   +upstreamnt  +downstreamnt
atgcccactgacactgcccacctgagacccacgggcttcttcttagtacactggcatatg
cctactccactgatggagttttacgattgccaggagttagttgtttctgccagttgtcca
aattggatgttaacaaattaccagttttccacctacccatggatccatttaatcaatcca
caagcatttgtccaggatatcttctacatcaggggctgtgtctgtaaagacaaaggccag
tgcttctgtgacgggctggaaggggagaagggggaaagaggctttcctggacctgctggt
tttcctggccagaagggattcccaggtcccgaaggcttgcctggaccacagggacccaag
ggctcaccaggacttccaggactcactggtcccaaaggtgtaaggggtataactggcttg
ccgggattttcaggtcctcctggacttccaggcaccccaggccatcctgggccttatggg
cctccaggtgtaccaggatgcaatggttctaagggtgagcaagggtttccaggccttcca
gggacaccaggctacccagggatcccgggtgctgttggcttgaaaggagaaaagggtgct
cctgccacagaaggtatagaacttgatggaagaggtgaccctgggttgccaggagctcca
ggattccagggtttaccaggccttccaggctttccgggacctgctggtccacctggccct
ccgggattcttaggctttccaggagccatgggacctccaggaccaaagggtcaaatgggc
gataaagtgataggacaaaaaggagagcggggtgtgaaaggattaacaggacctcctgga
ccaccaggaacagttattgtgacgctaaccggccctgataacagaacggacctcaagggg
gagaagggagacaagggagccatggggaagcctggacctcctgggccctcgggaccgcct
ggagaatcctatggatctgaaaaaggtgctcctggagaacctggcccacagggaaaacct
ggcaaagatggtgcccctggtttccctggcactgaggggcccaaaggcaacagaggcttc
cctgggttacggggtgaagacggcattaaggggtggaaaggggacgttggcccgccagga
tttcgtggtccaacagaatattatgatgcataccaggaaaagggtgatgaaggaattcca
ggcccaccaggccccaaaggagctcgtggaccccagggtcccagcggtcctcctggagtt
cttggaagtgctgggttatcaaagcctggcctcagaggagctcctggatctccaggcatg
aaaggacgtaaagggaaacaagggcccccgggaaagaatgcagtggggcctcctgggtcc
ccaggttgtcctggttcaccaggccccatagggctgccaggatatccaggaccaccaggt
gacatcgtgtttcgcaaaggtccacctgggggtggtggactccccggccatgttgggttt
ccaggcatcccaggagtcgaggggcccaaaggggaaccaggcctcttgtgcgtacagtgt
gcttatatcccagggcgtccaggtctcccaggactgcctgggttggatggcataaaagga
atcccaggaggacaaggggcagctggcattaaaggaagcccagggtccccaggaagtgcg
ggtcttccaggatttccaggattcccgggtgctccgggtgctccaggacttaaaggagaa
aaaggagaaacatctgagcctgagggacaggtgggtgctccaggggaccccgggctcaga
ggccatcctggaagaaagggcttggatggaattcctggaactcctggaatcaaaggacca
ccaggacccaaaggtgaaccggccctgagtggtgagaagggggaccagggtcctccaggg
gatcctgggatcccagggtccccaggacctgcaggaccacctggaccaccaaactatgga
ccacagggagagcctggtccaaagggcacccaaggagttcctggagcccctggaccacct
ggagaagccggtcctaagggagaattcggcatttcaacaccagtcccagggcccccagga
cctccagggccccctggtcatgctggcccccgaggtccacctggtatccctggacccata
ggaaaatgtggtgatccgggtcttcctgggcctgatggtgaaccaggaattccaggaatt
ggcttccctgggccccctggacctaagggagaccaaggttttccaggagcaaaaggagca
ccgggttgtccaggagaaatggggaagcccgggtcacctggagaaccaggtctcccagga
gccaagggagaaccaggactagccatgcctggagaaccaggaataccaggttttccagga
gaaagaggcaattctggggaaaatggagaaattggactccctggacttccaggtcttcct
ggaattccaggaactggagggcttgatggaccaccaggggatccagggaagcctggacta
cctggagaaaaaggacccccaggaagttgcacagagggtcccagaggagcccacggactt
ccaggtttaaatggattggaagggcaaccaggcagaagaggtgaaacagggccaaaagga
gacccaggtattccaggcttggatagatcaggctttcctggagaacctggaccaccagga
gtgccaggtcatcgaggtgagataggaccacctggccaaaaaggatatccaggaaatccg
ggatttttaggaccaccaggtgaaaaaggaatgatggggatgatgggctatccaggaaac
actggccctcctgggcctcccgggatcccaggcaccccaggacagaggggtagctttgga
attccaggtgcaaagggtgagaaagggcccccaggagccaagggggaagaaggagagaaa
ggacctatggggccttgtcgaataaccagctcagtgggggacaaaggagaaccaggcctc
aaagggtttgcaggaaagccgggtgagaaaggaaacagaggcattccagggttaccaggt
ttgaaaggattcgaagggccacctggaccaccaggcccaccaggctcccgaggagatcca
ggcagctttgggaatcctggagaagcaggaccacgtggaagtccaggaaacatggggaac
atggggatgccaggtcctaaaggacacaggggacctttgggactaccaggtgtcactgga
agaccaggcctcccaggtgttcacggtctccgaggagacaagggagagccaggttattca
gcaggtacaaggccaggaccaccgggactaaagggagatccaggattaccaggtgccatg
ggaaggaaaggagaaagagggctacctggcatccctggccattcggggcctgctggaact
gagggagcccctggacatcccggaagtcctggccacccaggaaagccaggccctgatgga
gatttggggttaaaaggcatcaaaggcttccctgggtccccaggagtcaaaggacctcca
ggacctccgggattcctaggatctcctggacctatgggcatgagaggcaaccagggccgt
gatggaatccctggtcccccaggagaaaagggagaaacaggtttgctgggggcacatccg
ggcccaggaggaagccctggtcctccaggagccaaaggagacaggggcgccccaggccta
ccagggcccccgggcaggaaaggggcaatgggagatgccgggccacggggacccactggc
atgacgggactcccagggccaccaggttttcctggtgcagtcatccctggccagaaagga
aatcgaggtccaccaggcttcagaggaaacccaggtgagcctggtcctccaggccctcca
gggagccacgtgaaaggcataaaaggagacaagggactcatgggtgagcctggccccaga
ggtctgcctggaactgtgggagacaaggggccaccgggtcaaccgggagcaccagggagc
ccaggtctgccagggctcagaggcgatcctggattctacggatttccaggtgttaaagga
gagaagggtaacccaggatttccgggaccagctggacctccagggcaaattgggccaaaa
ggaccacctggtgtccgtggagaccctggcacggttaagatcatctcccttccaggaagc
ccagggccacctggccgtgctggaggaccagggatgccaggagaaccagggccaccaggg
ccaccaggaatcctaggaccctgtgggccaagaggtaaaccaggcatggatggaatacca
ggaactcctgggccaattggagaaaaaggcaacaaaggttgtaaaggcgagcaaggacca
cctggattagatggactgccaggcttgaaggggaaacctggagaccctggaccacctgca
actgggaccatgaagaggggctttatcttcaccaggcatagtcagaccacagtgattcct
tcctgtccagaagggacagcaccactctatagtggcttttctcttcttttcatacaagga
aatgaacaagcccatggacaagacttgggaactctcggcagctgcctgcagcgatttacc
acaatgccattcttgttctgtaacatcaacaatgtctgtaattttgcatctcgaaatgac
tactcatactggctgtcaacaccagctctgatgccaatggacatggctccaattactggc
agggccctggagccttatattagcagatgcactgtctgtgaaggtcctacgattgccata
gccattcacagccaaaccactgacattccctcatgtcccaatggctggatttctctctgg
aaaggattttcgtttatcatgttcacaagtgcaggttctgagggtgctgggcaagcactg
gcctcccccggctcctgtctggaagagttccgagccagtccgtttatagaatgtcacgga
agaggcacgtgcaactactattcaaattcctacagtttctggttggcttcgttaaacccc
caaagaatgttcagaaaacctattccatcaactacgaaagctggggagttagaaaagata
ataagtcgctgtcgggtgtgcatgaagagaagacaatga

KEGG   Vulpes vulpes (red fox): 112925530
Entry
112925530         CDS       T05911                                 

Gene name
COL4A4
Definition
(RefSeq) collagen alpha-4(IV) chain isoform X1
  KO
K06237  collagen type IV alpha
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04926  Relaxin signaling pathway
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04974  Protein digestion and absorption
vvp05146  Amoebiasis
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112925530 (COL4A4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112925530 (COL4A4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112925530 (COL4A4)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112925530 (COL4A4)
  09154 Digestive system
   04974 Protein digestion and absorption
    112925530 (COL4A4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112925530 (COL4A4)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112925530 (COL4A4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112925530 (COL4A4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112925530 (COL4A4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112925530 (COL4A4)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   112925530 (COL4A4)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112925530 (COL4A4)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 112925530
NCBI-ProteinID: XP_025862120
UniProt: A0A3Q7U4B7
LinkDB
Position
Unknown
AA seq 1688 aa
MHMASVRCSFRWIKPLARDPWSLIFILFSVQHAYGSGKKFVGPCGGRDCSVCHCFPEKGS
RGQPGPPGPQGPIGPLGLPGPTGIPGEKGMRGDSGPPGAAGDKGDKGPTGVPGFPGLDGI
PGHPGPPGSRGKPGMHGYNGSRGDPGFPGERGVPGPGGLPGLPGERGEKGNSVFILGAIK
GIQGDRGDPGPPGLPGPKGARGPAGPRGQPGEPGLTGAPGHPGRPGLKGNPGVGVKGQMG
DPGEVGQQGSPGPTLLVQPPDSCLYKGEKGVKGMPGMIGPPGPPGPKGEPGIGPKGEKGI
PGFSGPRGDPGSYGFPGFPGLKGEPGLFGDPGSFGFVGPKGDPGDRGYPGPPGVLVTPSV
PLKGPPGDPGRPGRYGEMGSVGPPGPPGPPGPPGEACAGMMGPPGPRGFPGHPGFPGAAG
IPGRADFSPGKPGKPGPPGLPGAPGLQGPPGSDVIYCSVGHPGPQGIKGKMGPPGRRGSK
GEKGNAGLCACEPGPMGPPGPPGLPGRQGSKGDLGLPGWIGEKGHPGPPGAEGSPGSPGK
HGASGPPGSKGEKGDRVVSRVKGKKGERGPDGLPGFPGQQGQHGRDGLPGKKGDPGPPGG
HEDAAPGAKGSPGPPGPPGRTGPRGQPGLGFPGPPGERGQPGAPGRPGERGFEGLKGPKG
DTISCNVTYPGRPGPPGFDGPPGPKGFPGPRGAPGLRCLDGPKGQRGKPGMSKIPGPPGF
RGDMGDPGFEGEKGSSLLGPPGFPGSRGANGQKGMMGDIAYGPPGPPGKRGPSGVPGSKG
HRGDSGRPGFAGPAGKPGSPGLKGPRGREGSAGFQGIPGPPGHSCKRGAPGIPGQPGLPG
APGSPGAPGWKGQRGDVGPPGPAGMKGLPGVPGRPGAEGPLGFPGVPGPLGDDGLPGLPG
PKGPQGLPGFPGFPGERGKPGPEGRPGSKGEPGEDGRPGFFGDQGVKGAKGARGPSGDEG
EMAVFSQKGKTGEPGPPGDDGFPGEEGDKGNPGMPGRRGEPGRFGAPGFHRGEPGRTGQP
GLPGPPGPPGSPGLRGIIGFPGFPGDQGEPGFPGSPGLSGIDGMRGPKGSKGDPASQFGP
PGPKGEPGSPGCPGHPGAPGEHGLPGVQGLRGPPGRPGLPGSSGPPGCPGNQGMPGLTGP
PGETGDPGPRGMMGDPGPPGLPGIKGPSGSPGLNGLHGLKGQKGAKGASGLHEVGPPGPV
GVPGLKGEPGDPGSPGISPPGLSGERGPPGPPGRPGAPGPAGATGRAAEGHVPDPGPPGD
VGPPGPDGPRGAPGPPGPPGSVDLLRGEPGDCGPPGPPGPPGPPGPPGHQGFPGCDGKDG
QKGPIGFPGLQGPPGLPGLPGEKGLLGIPGRRGHPGPPGSRGEPGPPADVDSCPRIPGLP
GVPGPRGPEGAMGVPGRRGPPGPGCKGEPGPEGRRGEAGLPGPPGPPGSTGDAGEAGCPG
APGPPGPIGDPGPRGFGPGYLSGFLLVLHSQTDGEPACPAGMPRLWTGYSLLYLEGQEKA
HNQDLGLAGSCLPMFSTLPFAYCNIHQVCHYARRNDRSYWLASAAPLPMMPLSEEEIRPY
ISRCAVCEAPAPVVALHSQDRSIPPCPRSWRSLWIGYSFLMHTGAGDQGGGQALMSPGSC
LEDFRAAPFLECQGRQGTCHFFANEYSFWLTTVRPDLQFSSAPSPDTLKESQAQRQRISR
CQVCMKYG
NT seq 5067 nt   +upstreamnt  +downstreamnt
atgcacatggcatcagtaaggtgttcattcaggtggatcaagcccttggccagagatccc
tggtcacttatatttatcctcttttctgtacaacatgcatatgggagtggaaagaagttt
gtcggcccctgtggaggaagagattgctcggtgtgccattgctttcctgaaaaagggtct
cggggtcaaccaggaccgccggggccacagggtcccattggacccctgggactgccagga
cccacaggaattccaggagagaaagggatgagaggtgacagtggccctcctggagcagca
ggtgacaaaggtgacaagggtccaactggtgttcctggatttccagggttggatggcata
cctggccacccggggcctcctggatccagaggcaagcctggcatgcatggctacaatggt
tcacgaggtgatccagggtttccaggagaaagaggagttcctggcccaggaggcctccca
ggccttcctggtgaaaggggagaaaaaggaaattcagtgttcattttaggtgccattaaa
ggtattcagggtgacaggggggacccaggacctcctggcttgccgggaccgaagggggca
cgaggaccggcaggcccaaggggacagccaggagagcctgggttaacaggtgctccgggc
catcctgggagaccaggcttgaagggtaatcctggtgtgggagtaaaggggcaaatggga
gacccgggtgaggttggccagcagggttctcctgggcccaccttactggtacagccacct
gattcctgtctgtataaaggagaaaagggcgtaaaaggaatgcctggtatgattggacct
ccaggaccaccgggacccaagggagaacctggaattggaccaaaaggagagaagggtatt
cctgggttctcaggacctcggggtgatccgggttcctatggctttccaggttttccagga
ttaaagggggaaccaggactgtttggagatcctggatcatttggatttgttggcccaaag
ggggatcctggagaccgtgggtacccaggaccaccgggtgttctggtaactccatctgtt
ccactcaaaggccctccaggggatcccgggcgccctggccgctatggagaaatggggtcc
gttggaccacctggtccccctggtcccccaggtccaccaggggaagcctgtgcaggcatg
atgggaccccctggaccaagaggatttcctggtcatccaggatttccaggggcagctggt
atcccagggagagcggatttcagtccaggaaaaccagggaaaccgggacctcctgggttg
cccggagcaccagggctgcaaggacccccaggatcagatgttatatattgtagtgttggg
catcctggaccacaagggataaaaggcaaaatgggtcctccaggaagaagaggctcgaaa
ggagaaaaaggaaatgcggggctctgtgcctgtgagcctggtcccatgggcccaccaggc
cctccaggacttcctggaaggcagggtagtaagggagacttggggctccctgggtggatt
ggagagaaaggtcacccaggccctcctggtgctgaaggatctccaggatcaccaggaaaa
catggtgcctcaggaccacctggcagcaaaggagaaaagggcgacagggttgtatcaaga
gtgaaagggaaaaaaggagaaagaggtcctgatgggctcccaggatttccaggacaacag
ggacaacatggtcgggatggacttcctggaaaaaagggggatccaggccccccggggggt
catgaggatgcagccccaggtgctaaagggtctcctggaccaccggggcctccgggcaga
acaggaccaaggggacaaccaggtctgggatttcctggtccaccaggagagagaggacaa
ccaggagctccaggccgccctggcgagaggggcttcgagggcttgaagggcccgaaaggt
gatacaatttcttgtaacgtcacctaccctgggcggccggggcccccaggttttgatgga
cctccaggaccaaagggatttccaggtcctcgaggcgctccagggttgaggtgcttggat
gggccaaaaggtcagcgtggcaaaccaggaatgtcaaagatacccggtccacccggtttt
cgtggtgacatgggagatccgggttttgaaggtgaaaaggggtcctcccttcttgggccg
ccaggctttcctggttctcgaggagcaaatggtcagaaaggaatgatgggagacattgcc
tatggccccccaggccccccaggaaagagaggtccttccggagtgccagggtccaaagga
cacagaggtgattcaggacgtccagggtttgcagggccagccggcaagcccggatcccca
ggtctcaaaggtcccagaggcagagagggaagcgctgggtttcaaggtatcccgggtcca
cctggccattcctgcaaaagaggcgccccagggataccagggcaaccgggactccccggg
gccccaggcagtccaggtgccccaggttggaaaggacagagaggggatgtggggcctccg
ggtccagctggaatgaaaggcctccctggagtccctggacggccaggggcagagggaccc
ctaggattcccaggagtcccaggccccttaggggatgatggactgcctggtcttccaggc
ccgaagggaccccaggggctgcctggcttccccggttttccaggggagagaggaaagcct
ggcccagagggacgccctggcagcaagggggaaccgggagaggatggtcggcctggcttc
ttcggagaccaaggggtgaaaggtgccaaaggagccagaggaccctcaggagatgaagga
gagatggctgtcttttcccaaaaggggaaaaccggggaacccggacctccaggagatgat
ggattcccaggagaagaaggtgataaaggcaatccagggatgccggggaggagaggagag
cctggaagattcggagcacctggatttcacagaggggagcctgggagaaccgggcagcca
gggcttcctggccccccaggccccccaggctcacctgggctgagagggattattggtttt
ccgggatttccaggtgaccagggtgagccaggttttccagggtcccctggactttcagga
attgatggaatgagaggacctaaaggaagcaaaggtgaccctgcaagtcagttcggccca
cctggtccaaagggtgaaccaggtagccctggatgtccaggacatcctggagcacctgga
gagcacggcttgcccggtgttcaagggctcagaggaccacctggaaggccaggattacct
ggctcctccggaccaccagggtgtccaggtaatcaaggaatgcctgggctgacagggcct
ccaggagaaacaggggatcctgggccaagaggcatgatgggagatccagggccaccaggt
cttccaggaataaaaggtccctccgggtcaccgggtctgaatggcttgcatggtttaaag
ggtcagaaaggagccaaaggtgcttcaggtttgcacgaagtgggcccacccggtccagtg
ggcgtacctgggctgaaaggggagccgggagaccctgggagcccgggaatttctccccca
ggcctttctggagaaagaggcccccccggccccccagggagacctggagcccctggtcct
gcaggtgccacaggaagagctgctgaaggtcacgttcctgacccaggtccacccggagat
gtgggtcctcctggccccgatggtccgagaggagcgcccgggcccccaggcccccccggg
agcgttgaccttctgagaggggaaccaggagactgtgggccgccggggcctccaggtccc
ccgggcccacccggccctccaggacaccaaggcttcccaggatgtgatggaaaagacggc
cagaaaggaccaataggattcccggggctgcaggggcctccgggacttcctgggctccct
ggggagaagggtctgctgggcattccaggccggcgagggcaccccggtcctccaggttcc
agaggtgaaccagggccacctgcagatgtggattcgtgcccccgcatccccgggcttcct
ggggtaccaggcccaagaggaccagaaggagccatgggggtccctggaaggagagggccc
ccaggaccagggtgcaaaggagagccgggaccggagggcaggaggggcgaggccggcctc
ccagggcctcccgggcctcccggaagcacaggggacgcaggagaagccggttgccccgga
gcaccagggccccccgggcccattggggaccccgggcccagagggtttgggcctggatac
ctcagtggcttcctcctggttctccacagtcagacggatggggagcccgcctgccccgcg
ggcatgcccaggctctggacgggctacagtctgttatacctggaaggacaggagaaggcc
cacaatcaggacctcggtctggcagggtcttgccttcccatgttcagcaccctgcccttt
gcctactgcaacatccaccaagtgtgccactatgcccggaggaacgaccggtcctactgg
ctggccagtgccgcgcccctgcccatgatgccgctctcagaggaggagattcgcccctac
atcagccgctgtgccgtgtgcgaggccccggcccccgtggtggcactgcacagccaggac
cggtccatcccgccgtgtccacggagctggaggagcctctggatcgggtactcgttcctg
atgcacacaggggctggagaccaaggaggagggcaggccctcatgtcccccggcagctgt
ctggaagatttccgagccgcaccgttcctcgaatgccaaggccgacagggaacttgccac
ttttttgcaaatgagtatagcttctggctgacgacggtgaggcctgacttgcagttttcc
tcggcaccatcaccagacaccttgaaagaaagccaggcccagcgccagagaatcagcagg
tgccaggtctgcatgaagtacggctag

KEGG   Vulpes vulpes (red fox): 112925720
Entry
112925720         CDS       T05911                                 

Gene name
LAMA3
Definition
(RefSeq) laminin subunit alpha-3
  KO
K06240  laminin, alpha 3/5
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp05145  Toxoplasmosis
vvp05146  Amoebiasis
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112925720 (LAMA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112925720 (LAMA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112925720 (LAMA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112925720 (LAMA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112925720 (LAMA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112925720 (LAMA3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112925720 (LAMA3)
   05145 Toxoplasmosis
    112925720 (LAMA3)
SSDB
Motif
Pfam: Laminin_G_2 Laminin_I Laminin_G_1 Laminin_II Laminin_G_3 Laminin_EGF WXG100
Other DBs
NCBI-GeneID: 112925720
NCBI-ProteinID: XP_025862311
UniProt: A0A3Q7T200
LinkDB
Position
Unknown
AA seq 1725 aa
MPPAVRWSARSAGWLWIFGAALGQCLGYNSQQQRVAFLQPPGQSHLQSSYVDFKPSQGCS
PGYYRDNRGSYTGRCVPCNCNGHSNRCQDGSGICINCQHNTAGEHCERCKEGHYRNTIHG
SCSVCPCPHSNSFATGCVVTGGNVRCSCKPGYTGTQCERCAPGYFGNPQKFGGSCQPCNC
NSNGHLSSCHPLTGDCINQEPKDDSPGEECDDCDSCVMTLLNDLATMGNELHLVKSQLQG
LSASTGTLEQMKHLETQIKDLRNQLFNYRSAISNHGLKMDGLEKELGNLNREFETMQEKV
QINSRKAQTLHNNVDRTTQSAKELDTKIKNVIQNVHILLKQISGTDGEGNNLPSGDFSRE
LAEAERMMTELRNRNFGKHLREAEAEKTEAQLLLTRIRSRLEKHQVENGALVKNMRDSLN
DYEAKLSDLRALLQEASAQAKRATGLNRGNEKTLESLERQVKEMNSLQSDFSKYLTTADS
SLLQTNTLLQLMGKSQEEYEKLAATLNEKRHELNDKVRELSQSASKASLVVEAEKHAQSL
QELAKQLEEIKKNASGDELVRCAVDAATAYENILNAIKAAEDAADKATRASESALQTVIK
EDLPRKAKTLSSDSDKLLKQTKITQKKLQQEISPALNNLQQTLKVMTVRKGLIDTNITVI
RDDLRGIQRDDISGMISSAKSMVRNANDITDEVLDGLSPIQTDVARIKDTYGSKQSEDFN
KALADADNSVKKLTNKLPDLLSKIESINQQLLPLGNISDNVDRIRELIQQARDAANKVAV
PMRFNGKSGVEVRLPNDLEDLKGYTSLSFFLQRPESRESGRTENMFVMYLGNKDTSRDYI
GMAVVDGRLTCVYNLGEQESELQVDQSVIKSETQEAIMDRVKFQRIYQFASLNYTKKATS
SKPGSSQFHEMDSGNSHTLLDLDPENTVFYVGGYPSDFTLPARLRFPPYKGCIELDDLNE
NVLSLYNFKKTFNLNTTEVEPCRRRKEESDRNYFEGTGYARVPTQLNAPNPNFGLTIQTT
VDRGLLFFAENQDHFISLNIEDGKLLVQYKLNSEPPKEREIGHIVNDGKDHRILIIIGKF
QNRISISVNSQTSQIDGDIFDFSTYYLGGIPISIRERFNISTPAFRGCMKNLKKTTGVVR
LNDTVGVTKKCSEDWKLVRSASFSRDGQLRFTGLDLPLPSEFQASFGFQTFQPSGILFNL
QSQKHSLQVTLEDGRIELNTRENSLIIRSPQTYMDGELHYVSVIGDNSGLRLLIDDQTLK
SNQRLQDLSGSQHPLYLGGSQFEGCISNVFIQRPSKSPAVLDLASKTFKRDVSLGGCSLN
KPPFLMLLRGSTRLNKSHTFNINQPLQDTPVASPRSMEMWREAQSCLPPPQAPTSSGAFR
FGDSPTSHLQFTIPQELVKPRSRFAVDVQTASSRGLVFYTGTKNSYMALYLSKGRLIFAL
GAGGKKLRLKSKEKCNDGKWHTVVFGQDDKKGHLIVDGLRAREGSLPGNSTFSLTAPVYL
GSSPAGKPKSLPQNSFVGCLRNFQLDLKPLDTPSASVGVSPCLGGSLEKGIYFSQEGGHV
ILANSVLLGPEFKLVFSIRPRSLTGILMHVGSQPGRYLCVYMEDGKITASVDSEAGGILT
SITPKRSLCDGRWHSVTVTIKQHIVHLELDSENSYTTGRLPFPSASTQEPLHVGGIPANL
KTLKLPVWKSFFGCLKNVQVNHIPIPVTEALDVQGTVSLNGCPDH
NT seq 5178 nt   +upstreamnt  +downstreamnt
atgcccccagcagtgaggtggtcagccaggagcgccggatggctgtggatctttggggca
gccctggggcagtgtctgggatataattcacagcagcaaagggtagcatttcttcagcct
ccaggtcaaagccatctgcaatcaagttatgtggactttaaacccagccagggttgtagc
cctggatactatcgcgataacagaggctcgtatactggacgatgtgttccctgcaattgc
aatggacattcaaatcgatgtcaggatggctcgggaatatgtattaactgccagcacaac
acagctggagaacactgtgagcgctgcaaagagggtcactatagaaacaccatccatgga
tcctgtagtgtctgcccgtgtcctcattcaaacagttttgccactggctgtgttgtgacg
gggggaaatgtgaggtgctcctgcaaacccggatacacaggcacacagtgcgaaagatgt
gcaccaggatatttcgggaatccccagaagtttggaggtagctgccaaccatgcaattgt
aacagcaacggtcatttgagcagttgtcaccctctgactggagactgcataaaccaagag
cccaaagatgacagcccaggagaagaatgtgatgattgtgacagctgtgtgatgacactc
ttgaacgacctggctactatgggcaatgagctccacctagtcaagtctcagctgcagggc
ctgagtgccagcaccggcactctggagcagatgaagcacttggagacccagatcaaggac
ctgaggaatcagttattcaactatcgttctgccatttcaaatcatggattaaaaatggat
ggtctagaaaaggaactgggtaatttgaatcgtgaatttgaaaccatgcaagaaaaggtt
caaataaattccagaaaagcacaaacattacataacaatgttgatcggacaacccaaagt
gcaaaagagctggacacaaagattaaaaatgtcatccagaatgtgcacattctcttgaag
cagatctctgggacagatggggaaggaaacaacctgccttcaggggatttttctagagag
ttggctgaagcggagcgcatgatgacagaactacggaaccgcaactttggaaagcacctg
agagaagcagaagctgaaaaaacagaggctcagctcttgctgactcggataaggagccgg
ctggagaagcaccaagtagagaacggtgcacttgttaagaatatgcgggattctttaaat
gactacgaagccaaactcagtgacctccgtgccctgctacaagaagcatctgcccaagca
aagcgggccactggcctcaaccgaggaaacgagaagactttggaatccctcgagagacaa
gttaaagaaatgaattccctacagagtgatttctccaagtacctaaccactgcagactct
tccttactgcagaccaacacactgctgcagctgatggggaaaagccaggaggaatatgaa
aaattagctgccactttaaatgaaaaaagacatgaactaaatgacaaagtgagagaacta
tcccagtccgccagcaaagcgtccctggtggtggaggcagaaaagcacgcacagtcttta
caagagctggcaaagcagctggaggagatcaagaagaatgccagtggggatgagctggtg
cgctgtgcagtggatgccgccaccgcctatgagaacatcctcaatgccatcaaagcagct
gaggatgcggctgacaaggccaccagggcttccgagtctgccctccagacagtgataaag
gaagatcttccaagaaaagcgaaaaccctgagttccgacagtgataaactcttaaagcaa
accaagataacacagaagaagctccagcaagaaatcagtccggctctcaacaacctacag
caaactctgaaagttatgacagttcggaaagggttgatcgacaccaatatcactgtcatc
cgggatgaccttcgtgggatacagagagatgacatcagtggcatgatcagtagtgcaaag
agcatggtcagaaatgccaacgacatcacagatgaggttctagatgggctcagccccatt
cagacagatgtggcaagaattaaggatacctatgggagcaaacagagcgaagacttcaac
aaggctcttgctgacgcagataactcagtaaagaaattaaccaacaaactgcctgatctt
ctgagcaagattgaaagtatcaaccaacagctgttgccactgggcaacatttctgataat
gtggaccgtatcagggagttaattcagcaggccagagatgctgcaaataaggttgctgtc
ccaatgaggttcaatggtaaatctggagttgaagtccggctgccgaatgacctggaagat
ttgaaaggatacacatctctttctttttttctccaaagacctgaatcaagagaaagtggg
aggactgagaatatgtttgtgatgtaccttggaaataaagatacctctagggattacatt
ggcatggcagttgtagatggcaggctcacatgtgtctacaacctgggagaacaggagtct
gaactccaagtggaccagagcgtgatcaagagcgaaactcaggaggcaattatggaccgg
gtgaaatttcagagaatttatcagtttgcaagtctaaattacaccaaaaaagccacatcc
agtaaacctggatcatcccaattccatgaaatggatagtggaaacagccacacactcctc
gatctggatcctgaaaatactgtattttatgttggaggttacccatctgactttacactt
cctgctagactgaggttccctccgtacaaaggttgtattgaattagatgacctcaatgaa
aatgtcctgagcttgtacaacttcaaaaaaactttcaatctcaacacaactgaagtagag
ccttgtagaaggagaaaggaagagtcagacagaaattattttgaaggtacaggctacgct
cgagttccgactcaactaaatgctcccaacccaaattttggactgacgattcagaccact
gtggatagaggactgctgttctttgcagaaaaccaggatcacttcatatctctaaatata
gaagatggcaagctcctggtgcaatacaaactgaattcagagccaccaaaagaaagagaa
attggacacattgtcaatgatggaaaagaccaccggatactgatcataattggaaaattc
caaaaccgtatatcaatatctgtgaattcccaaacaagccaaattgatggtgacatattt
gatttcagcacatattatctgggaggaattccgatctcaatcagggaaagatttaacatt
tctacaccggctttccgaggctgcatgaaaaatctgaagaaaactactggtgttgtgagg
ctgaatgacactgtgggagtcacaaaaaaatgctcagaggactggaagctcgtgcgatct
gcctcattctccagggatggacagttgaggttcaccggtttggacctccctttgcccagt
gaattccaggcgtcctttgggtttcagacctttcaacccagtggcatattattcaatctc
cagtcccagaaacatagcctgcaagtcaccctggaggatggtcgtattgaactgaacacc
agggaaaacagcctaattattagatctccacagacgtacatggacggtgaactgcattat
gtgtctgtaataggtgacaactctggactgcggcttctcattgatgaccagactctgaaa
agtaaccaaaggctacaagacttgtcaggttcccagcatcccctgtatctgggtgggagc
cagtttgagggttgtatcagcaacgttttcatccagaggccatcaaagagtcctgcagtc
ctggacttggccagtaaaactttcaagagagatgtgtccctgggaggctgcagtttaaac
aaaccacctttcctaatgttgcttagaggttctacaaggcttaacaaatcccacactttc
aatatcaaccagccattacaggacacaccagtggcctccccaaggagcatggagatgtgg
cgagaggcccagtcttgcctaccacctccgcaggccccgaccagttccggagccttcagg
tttggggatagtcccaccagccacttgcaattcacgattccccaggagctggtgaagccc
aggtcacggtttgctgtggacgtgcagacggcttcctccagaggactggtgttctacacg
ggcaccaagaactcctatatggctctttatctctcaaaggggcggctcatcttcgctctg
ggggcaggagggaagaagctgaggctcaagagcaaggagaagtgcaatgatgggaaatgg
cacacggtggtgtttgggcaagatgacaagaaggggcacctaattgtggatggtctgagg
gcccgggagggaagtttgcctggaaattccaccttcagcctcacagcacctgtttacctg
ggatcatctcccgcagggaagccaaagagcctcccccaaaacagctttgtgggatgcctg
aggaattttcagttggatctgaaacccctggacaccccttctgcaagtgttggtgtgtcg
ccctgcctgggtggctctttggagaaaggcatttatttctcccaggaaggaggtcatgtc
atcctagctaactctgtgctattggggcccgaatttaagctggtcttcagcattcgccca
agaagcctcactggcatcctaatgcacgtcgggagtcagccagggaggtatttatgtgtt
tatatggaggacggaaagatcacggcctcagtagacagtgaggcagggggaatcctgaca
tcgatcacaccaaagcggtctctgtgtgacggacggtggcactcggtgacagtcaccata
aaacaacacatcgtgcacctggaactggactcagagaatagctacacaactggacggctt
cccttcccatctgccagcactcaggagccactacatgttggaggtatcccagccaatttg
aagaccctgaagctgcccgtgtggaaatcattttttggctgcctgaagaacgttcaagtc
aaccacattcccatccctgtcactgaagccttagatgtgcaggggactgtcagcctgaat
ggctgtcctgaccactaa

KEGG   Vulpes vulpes (red fox): 112927466
Entry
112927466         CDS       T05911                                 

Gene name
COL4A2
Definition
(RefSeq) collagen alpha-2(IV) chain
  KO
K06237  collagen type IV alpha
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04926  Relaxin signaling pathway
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04974  Protein digestion and absorption
vvp05146  Amoebiasis
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112927466 (COL4A2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112927466 (COL4A2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112927466 (COL4A2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112927466 (COL4A2)
  09154 Digestive system
   04974 Protein digestion and absorption
    112927466 (COL4A2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112927466 (COL4A2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112927466 (COL4A2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112927466 (COL4A2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112927466 (COL4A2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112927466 (COL4A2)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   112927466 (COL4A2)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112927466 (COL4A2)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 112927466
NCBI-ProteinID: XP_025864648
UniProt: A0A3Q7T5J7
LinkDB
Position
Unknown
AA seq 1712 aa
MDRPRCSASSPALRRWLLLGAVTVGLLAQSVLAGVKKFDVPCGGRDCSGGCQCYPEKGGR
GQPGPVGPQGYTGPPGLQGFPGLQGRKGDKGERGSPGITGPKGDVGARGVSGFPGADGIP
GHPGQGGPRGPPGYDGCNGTRGDVGRQGPEGPAGFLGPPGPQGPKGQKGEPYALSSVDRD
KYRGEPGEPGLVGFQGPPGRPGPIGQMGPVGAPGRPGPPGPPGPKGQPGNRGLGFYGEKG
EKGDMGLPGPNGIPSDTHHAIIGPMKEMFHPDQYKGEKGSEGEPGRKGISLKGEEGIMGF
SGTRGAPGYDGEKGSPGQKGSKGLDGYQGPDGPPGPKGEAGDRGPPGAPAYFPHPSQVKG
ARGDPGFPGTHGDPGSRGEPGDPGPPGLPGPSIRDEDGKRGLPGEMGPKGFIGEPGIPAL
YPGPPGTDGKPGLRGPPGAAGPPGPDGFLFGLKGTEGSAGFPGPSGFPGARGQKGWKGDA
GDCKCAEGDQFIGGLPGLPGPKGFPGINGEPGRKGSQGDPGQHGIPGFPGFKGAPGTIGP
PGPKGMKGDSRAITTKGERGQPGVPGVPGLKGDDGVPGRDGLDGFPGLPGPPGDGIKGPP
GDSGYPGAPGTKGAPGERGPPGLGLPGPKGERGFPGDAGLPGPPGFPGPPGPPGTPGQID
CDTGVKRPIGGDGQEAVQPDCVRGPMGSPGLPGPPGPTGAKGLQGIPGLSGADGTPGLRG
LPGDPGREGFPGPPGFVGPRGSKGAVGLPGPDGHPGPTGLPGPVGPPGDRGLPGEVLGAQ
PGPRGDAGLPGHPGLKGPPGERGPPGFRGSQGMPGMPGLKGQPGFPGPSGQPGLPGPPGQ
HGFPGAPGREGPLGLPGASGHGGLPGDRGDPGDTGVPGPVGMKGLSGDRGDPGLLGERGP
PGSPGFKGMSGMPGIPGQKGGRGSPGMDGFQGMVGLKGRPGLPGNKGEAGFFGIPGLKGL
AGEPGVKGSRGDPGPPGPPPIIQPGMKDIKGEKGDEGPMGLKGYLGLKGLPGMPGIPGLS
GVPGLPGKPGHIKGVKGDIGVPGMPGLPGFPGVPGPPGIIGFPGFTGSRGDKGAPGRAGL
YGEVGPTGDFGDSGDIINLPGSPGLKGERGIAGAPGLKGFFGEKGTEGEVGFPGITGVPG
VQGPPGPKGQTGFPGLTGLQGPQGDPGRAGVPGDKGDYGWPGIPGSPGFPGIRGISGLHG
LPGTKGLPGSPGADIHGDPGFPGPAGDRGDPGEANIRPGPIGAPGQKGERGDPGGRGPTG
SPGLQGFPGITPPSNVSGLPGDKGAPGIFGLEGYRGPPGPPGPAALPGSKGDEGNPGAPG
TPGTKGWGGDPGPQGRPGVFGLPGEKGPRGEPGFMGNTGATGSVGDRGPKGPKGDRGLPG
APGSVGSPGIAGIPQKITIQPGPVGPQGRRGPPGMQGEMGPQGPPGDPGFRGAPGKAGPQ
GRGGVSAVPGFRGDQGPMGHQGPVGQEGEPGRPGTPGLPGMPGRSVSIGYLLVKHSQTDQ
EPMCPVGMNKLWSGYSLLYFEGQEKAHNQDLGLAGSCLARFSTMPFLYCNPGDVCYYASR
NDKSYWLSTTAPLPMMPVAEDDIKPYISRCSVCEAPAVAIAVHSQDVSIPHCPAGWRSLW
IGYSFLMHTAAGDEGGGQSLVSPGSCLEDFRATPFIECNGGRGTCHYYANKYSFWLTTIP
EQSFQGSPSADTLKAGLIRTHISRCQVCMKNL
NT seq 5139 nt   +upstreamnt  +downstreamnt
atggaccgaccccggtgctcggcgtccagccctgccctgcggcggtggctgctgctgggg
gctgtgacagtggggctcctggcccagagcgtcctggcgggcgtgaagaagtttgacgtg
ccctgtggaggcagagactgcagcggaggctgccagtgctaccccgagaagggaggaagg
ggccaaccagggccagtgggcccccagggatacactgggcctccgggcctgcagggattc
ccaggactgcagggccgcaaaggtgacaagggtgaaagagggtcacccgggatcacagga
ccgaaaggagacgtgggagcgagaggtgtttctggattcccaggtgccgacggcattccc
ggacaccctgggcaaggtgggcccagaggaccacctggctacgacggctgcaacgggacc
agaggagacgtgggccggcagggacccgagggtcctgcgggcttcctcggccctcctggg
ccccaaggacccaaagggcagaaaggcgagccatatgcgctatccagtgtggaccgcgac
aaatacaggggtgaacctggagagcctggattggttggtttccagggtcctcctggccgc
cctgggcctataggacagatgggtccagttggagctccaggaagaccaggcccgcctgga
ccccccggaccaaaaggacagccaggcaacagaggacttggcttttatggagagaaagga
gaaaaaggcgacatggggctgccaggacccaatgggattccatccgacacccaccatgcc
atcataggacccatgaaggaaatgttccacccagatcaatataagggcgaaaaaggaagt
gagggggagccgggaagaaaaggcatctccttgaagggagaagaaggaatcatgggcttt
tctggcacacggggtgctcctggctacgatggtgaaaaagggtcaccgggacaaaaaggg
agcaaaggactggatggctatcaaggccctgacggacccccaggacccaagggagaagca
ggtgaccgtgggcctccaggtgcccctgcatacttccctcatccctcccaagttaaaggt
gccagaggtgacccaggattcccagggacccacggggatccaggaagccgaggtgaacca
ggagacccgggcccaccaggtctccccggcccatccatcagagatgaagatggaaagaga
ggcttaccgggtgaaatgggccccaaagggttcataggagagccaggcatccctgcactg
taccccggcccaccaggcactgatggaaagccaggactccgaggacccccaggggctgct
ggaccacctggaccagatggtttccttttcggcttgaagggaacagaagggagcgcaggg
ttccctggaccttctggcttccctggagctcgcggacagaaaggatggaaaggtgacgct
ggggactgtaaatgcgcggaaggcgatcagttcatcgggggtctcccggggctgccagga
cccaagggcttcccgggcatcaatggggagccagggaggaaagggagccagggtgaccct
ggccagcatggcatcccggggttcccaggtttcaagggcgcccctggcaccattggacct
cccgggccgaaaggaatgaagggggattctagagcaatcaccaccaaaggtgagagagga
cagccaggtgtcccaggtgtgcctgggctgaaaggtgatgatggtgtccccgggcgtgac
gggctggatggattcccaggcctcccaggccctcctggtgatggtatcaaaggccccccg
ggggactcgggttacccaggagcacccggtactaagggcgctccaggagaaaggggcccc
cccggactgggcctgcctggccccaaaggcgagcgtggtttccccggagatgccggatta
cctggacccccaggctttcccggaccccccggacccccaggcactccaggacaaatagac
tgtgacacaggcgtgaaaaggcccatcggaggtgacggacaggaggctgtgcagccagat
tgtgtcagagggcccatgggatcgccaggcctgccaggacccccaggacccacaggtgcc
aagggcctccaaggaataccaggactgtcaggagctgacggaacaccgggtctcaggggt
ctcccaggagacccaggtcgcgaaggattcccaggacccccagggttcgtggggccccga
ggatccaaaggcgcagtgggccttcctggcccagatggacacccaggtcccactggtctg
ccaggccctgtcgggcccccaggggacagaggccttcctggagaagttctgggagcccag
cccgggccccgaggagatgctggactgcctggacaccccgggctgaagggccctcctgga
gagagaggtccacctggattcaggggaagccagggcatgccaggaatgccaggcctgaag
ggccagccaggcttcccaggaccctcgggccagccgggcctgcccgggccaccaggacag
catggcttcccaggagctcccggccgggaggggcccttggggctgccaggagcctcaggt
catggaggtctgcctggagacagaggggacccaggggacacaggtgtccctggccctgtg
ggcatgaagggtctgtctggtgacagaggtgaccccggtttgctgggtgaacgaggccct
ccaggaagtcctggatttaaaggaatgagtggaatgcctggtatccctgggcagaaaggt
gggagaggctcgcccgggatggatggcttccaaggtatggtagggctcaaaggaagaccc
gggcttccaggaaataaaggagaggctggattttttggaattccaggactgaagggtctg
gctggtgagccgggtgtgaaaggcagccgcggggaccctgggcccccaggacctcctccc
atcatccagccaggaatgaaagacatcaaaggagagaaaggagacgaagggcccatgggg
ctgaaagggtacctgggcctgaaaggtcttcccgggatgccggggatccccgggctgtcc
ggagtgcctgggctgccggggaagccgggccacatcaaaggcgtcaaaggagacatcggc
gttcctggcatgcccggtttaccaggatttcctggcgtgcccggcccccccggaatcatc
gggtttcctgggttcacaggaagtaggggtgacaagggagctccagggagagcaggcctt
tacggcgaggtgggccccacaggggactttggtgacagtggagacatcataaacctgcca
ggaagcccaggcctgaagggtgagcggggcatcgctggagcaccaggtctaaagggattc
ttcggggaaaagggaacagagggtgaagttggcttccctgggataacaggcgtgccaggt
gtccaaggccctcccggacctaaagggcaaacaggcttcccaggactgacagggctgcag
gggccacagggagatccgggccgggcaggtgtgcctggcgacaaaggagactacggctgg
ccagggattccaggctccccaggctttcccggcatccgaggcatcagcggattacacggt
ttgccaggcaccaaaggccttcctggatccccaggtgcggacatccacggagaccctggc
ttccccggtcctgctggggacaggggcgaccccggagaggccaacatccgcccaggaccc
atcggggccccaggacagaaaggggagcgaggagatccaggtggacgaggcccaactggg
agtccaggacttcaaggcttcccaggcatcacccccccttccaacgtgtctgggttacct
ggtgacaaaggggcaccagggatatttggcctggaaggttatcgtgggcccccgggacca
cctgggcctgcggctcttcctggaagcaaaggagatgaggggaacccaggagctccagga
acccccgggactaaaggatggggcggggaccctgggccccagggccggcctggcgtgttc
ggtctccccggagaaaaagggcccagaggtgagcccggattcatgggcaacacaggagcc
accgggagtgtgggcgaccgaggccccaagggacccaagggagaccgaggactcccaggt
gcccctggctctgtgggatcccccgggatcgcaggaatcccccagaagattaccatccag
ccagggccagtgggaccacagggaaggagaggccctccggggatgcagggagagatggga
ccacagggaccgccgggggatccaggtttccgtggagctccaggaaaggcagggccccag
ggcagaggtggtgtgtctgctgttcccggattccgaggagaccaggggcctatgggacac
caggggccagtgggccaggaaggggagccgggccgcccagggacccccgggctgccaggc
atgcccggccgcagcgtcagcatcggctacctcctggtgaagcacagtcagacggatcag
gaacccatgtgccccgtgggcatgaacaagctctggagtggatacagcctgctgtacttc
gaaggccaggagaaagcccacaaccaggacctagggctggcgggctcctgcctggctcgg
ttcagcaccatgcccttcttgtactgcaaccctggtgatgtgtgctactatgccagccgg
aacgacaagtcctactggctgtccaccactgccccgctgcccatgatgccggtggccgag
gatgacatcaagccctacattagccgctgttccgtgtgcgaggccccagccgtcgccatt
gcggtccacagtcaagatgtctccatcccccactgcccagctggatggcggagtctctgg
attggatattccttcctcatgcacacagcagccggcgatgaaggtggtggccagtcgctg
gtgtcgccgggcagctgtctggaggacttccgtgccacgcccttcatcgagtgcaatgga
ggccgtggcacttgccactactacgccaacaagtacagcttttggctcaccaccatcccc
gagcagagcttccagggctcgccctccgccgacaccctcaaggcggggctcatccggacg
cacatcagccgctgccaggtgtgcatgaagaacctgtga

KEGG   Vulpes vulpes (red fox): 112927467
Entry
112927467         CDS       T05911                                 

Gene name
COL4A1
Definition
(RefSeq) collagen alpha-1(IV) chain
  KO
K06237  collagen type IV alpha
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04926  Relaxin signaling pathway
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04974  Protein digestion and absorption
vvp05146  Amoebiasis
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112927467 (COL4A1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112927467 (COL4A1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112927467 (COL4A1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112927467 (COL4A1)
  09154 Digestive system
   04974 Protein digestion and absorption
    112927467 (COL4A1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112927467 (COL4A1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112927467 (COL4A1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112927467 (COL4A1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112927467 (COL4A1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112927467 (COL4A1)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   112927467 (COL4A1)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112927467 (COL4A1)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 112927467
NCBI-ProteinID: XP_025864649
UniProt: A0A3Q7SPZ7
LinkDB
Position
Unknown
AA seq 1643 aa
MQGGCAGSGCGKCDCHGVKGQKGERGLPGLQGVIGFPGMQGPEGPHGPPGQKGDTGEPGL
PGTKGTRGPPGASGYPGNPGLPGIPGQDGPPGPPGIPGCNGTKGEPGPLGPPGLPGFAGN
PGPPGLPGMKGDPGEIIGHVPGTLLKGERGFPGPPGTPGSPGLPGLQGPVGPPGFTGPPG
PPGPPGPPGEKGQMGLSFQGPKGDKGDQGVSGPPGVPGQAQVQEKGDFATKGEKGQKGEP
GFQGMPGIGEKGEPGKPGPRGKPGKDGEKGEKGSPGFPGDSGYPGLPGREGFKGDKGEAG
PPGPPGIAIGPGPLGEKGERGYPGAPGLRGEPGPKGFPGLQGQPGPPGFPVPGQAGAPGF
PGERGEKGDQGFPGVSLPGPSGRDGLPGPPGPPGPPGQPGHTNGIVECQPGPPGDQGPPG
NPGQPGLTGEVGEKGQKGDSCLICDMAGLRGPPGPQGPPGEIGFPGQPGAKGDRGLPGRD
GLEGLPGPQGVPGLMGQPGAKGEPGEIYFDARLKGDKGDPGFPGQPGMPGRAGSPGRDGH
PGLPGPKGSPGSVGLKGERGPPGGVGFPGSRGDIGPPGPPGFGPIGPVGDKGQAGFPGIP
GSPGQPGPKGEAGKVVPLPGPPGAQGLPGSPGFQGPQGDRGFPGTPGRPGLPGEKGTIGQ
PGIGFPGPPGPKGVDGLPGDVGPPGSPGRPGFNGLPGNPGVPGQKGEPGIGLPGLKGLPG
LPGIPGTPGEKGNIGGPGVPGEHGAIGPPGLQGIRGDPGPPGLQGPKGAPGVPGIGPPGA
MGPPGGQGPPGSSGPPGVKGEKGFPGFPGLDMPGPKGDKGSQGLPGLTGQSGLPGLPGQQ
GTPGVPGFPGPKGEMGVMGTPGQPGSPGPAGLPGLPGEKGDHGFPGSSGPRGDPGFKGDK
GDVGLPGKPGSMDKVDMGSMKGQKGDQGEKGQIGPTGDKGSRGDPGTPGVPGKDGQAGHP
GQPGPKGDPGIGGTPGAPGLPGPKGSVGGMGLPGTPGEKGVPGIPGPQGVPGLPGEKGAK
GEKGQAGLPGIGIPGRPGDKGEQGISGFPGSPGEKGEKGSAGVPGIPGSPGPKGLPGTVG
YPGSPGLPGEKGDKGLPGSDGIPGIKGEAGLPGQPGPTGPAGQKGEPGSDGIPGSVGEKG
EPGLPGRGFPGFPGAKGEKGSKGDVGFPGQAGSPGIPGSKGEPGFLGPPGPQGQPGLPGA
PGHAVEGPKGDRGPQGQPGLPGLPGPVGPPGLPGLDGLKGDKGNPGWPGAPGAPGPKGEP
GFQGLPGIGGSPGITGSKGDMGPPGVPGFQGQKGLPGLQGAKGDQGDQGFPGSKGLPGPP
GPPGPYDIVKGEPGLPGPEGPAGLKGLPGPPGPKGQQGVTGSVGLPGPPGIPGFDGAPGQ
KGETGPFGPPGPRGFPGPPGPDGLPGSMGPPGTPSVDHGFLVTRHSQTTDDPQCPPGTKI
LYHGYSLLYVQGNERAHGQDLGTAGSCLRKFSTMPFLFCNINNVCNFASRNDYSYWLSTP
EPMPMSMAPIAGDNIRPFISRCAVCEAPAMVMAVHSQTIQIPQCPSGWSSLWIGYSFVMH
TSAGAEGSGQALASPGSCLEEFRSAPFIECHGRGTCNYYANAYSFWLATIERSEMFKKPT
PSTLKAGELRTHVSRCQVCMRRT
NT seq 4932 nt   +upstreamnt  +downstreamnt
atgcagggtggttgtgctggctctggatgtgggaagtgtgactgccacggagtgaaagga
cagaagggtgaaagaggactcccagggctgcaaggtgtcatcgggtttcctgggatgcaa
ggacccgagggaccacatgggccaccaggacaaaagggtgatactggagaacccggactg
cctggaacgaaagggacaaggggacccccaggagcatcgggttaccctggaaacccagga
ctgcctggcattcctggccaagacggcccccccggtcctccaggtatccctgggtgcaat
ggaacaaagggtgagccagggcctctagggcccccgggtttgcctggattcgctggaaat
cctggaccaccggggttaccaggaatgaagggagatccaggtgaaatcattggccatgtg
cctgggaccctgctgaaaggcgaaagaggatttcctggacccccaggaacaccaggctcg
ccgggactgccagggttgcaaggtcctgttggccctccaggatttactggaccaccaggt
cccccaggccctcctggccctccaggtgaaaagggacaaatgggcttaagttttcaaggg
ccaaaaggtgacaagggtgaccaaggggtcagtgggccaccaggagtgccaggacaagct
caagttcaagaaaaaggagactttgccactaaaggagagaagggtcaaaaaggtgaacct
ggatttcaggggatgccagggattggagagaaaggtgaacctggcaaaccagggccccga
ggaaaacctggaaaagatggtgaaaagggagaaaaagggagtccaggctttccaggcgac
tcggggtatccgggactcccaggccgtgaaggtttcaagggagacaaaggtgaagcaggt
cctccaggcccacccggcattgccatcggccctggacccttgggagagaaaggagagcgt
gggtacccaggtgccccagggttgagaggagagccaggccccaaaggtttcccaggattg
caaggccagccaggccctccaggcttcccagttccaggacaggctggtgctcctggcttc
cctggtgagagaggagagaaaggtgaccaggggtttccaggtgtatcattgccaggacca
agtggacgggatggactcccaggcccccctgggcctcccgggccccctggacagccaggc
cacacaaacggcattgtggaatgccagcctggaccaccaggggatcagggtccccccgga
aatccagggcagccagggctgacgggcgaagtcggagaaaaaggtcagaaaggagacagc
tgcctcatctgtgacatggcaggacttcgggggccccctgggccacagggccccccggga
gagataggtttcccggggcagccaggggccaagggtgacagaggcttgcccggcagagat
ggtctggaaggattgcctggtccgcagggtgtaccggggctgatgggccagccaggagcc
aagggagagcctggcgagatttacttcgacgcccgactcaaaggagacaagggagacccg
ggctttccaggacagcctgggatgccaggcagagcagggtctcctgggagagatggccat
ccggggctgccaggccccaaaggctccccgggttcagtaggattgaaaggagagcgtgga
cctcctgggggagttggattccccggtagtcgcggtgacatcggccctcctgggcctcca
gggtttggccccattggccccgttggtgacaaaggacaagcaggttttccggggatccct
gggtccccaggccagccaggtcccaagggtgaagcaggaaaagttgtgcccctacctggt
ccccctggagcacagggacttccaggatccccaggtttccaagggccgcaaggtgaccga
ggttttcctggaaccccaggaaggccgggcctcccaggagagaagggaactatcggccag
ccgggaatcggatttccagggcctcccggccccaaaggtgttgatggcttacctggagac
gtgggacctcctgggagtccaggtcgcccgggatttaatggcttacctggcaacccaggt
gtgcctggccaaaagggagagccaggaattggtctgccaggactcaaaggattacctggt
cttcccggcattcctggcacacccggggaaaaggggaacattggaggaccaggcgttcca
ggagagcatggtgctattggccccccaggccttcagggaatcagaggtgacccaggacca
cctggattacaaggtcccaaaggagctccgggagttcctggaatcggcccccctggagca
atgggcccccctggaggacagggaccaccagggtcctcaggccctcctggagtgaaagga
gagaagggcttccccggatttccaggcctggacatgccgggccccaaaggagataaaggg
tcccaagggctgcctggcctgacaggacagtcgggactccctggtcttcctggacagcag
ggcacaccaggagttccagggtttccaggtcccaagggagagatgggcgtcatggggacc
ccagggcagcctggctccccaggaccagcaggcctgccaggattgccaggagaaaaagga
gaccacggcttcccaggctcctcgggacccaggggagaccctggcttcaagggggacaaa
ggtgacgtgggtctgcccggcaagcctggctccatggacaaggtggacatgggcagcatg
aagggtcagaagggagaccaaggagagaaaggacaaattggaccaactggtgataaagga
tcccggggagatcctggaaccccaggagtgcctggaaaggatggccaggcagggcatccc
gggcagccaggacctaaaggtgacccaggcattggcggaaccccgggtgctcctggactc
cctgggcccaaaggatcagttggtggaatgggcctaccaggaacgcctggagaaaaaggt
gtgcctggaatccctggcccacagggtgtccctggcttacctggggagaaaggagcaaaa
ggagagaaggggcaggctggcctacctggcattggaatcccgggccggcccggggacaag
ggagagcaagggatctcgggttttccgggaagtcctggagagaagggagagaaaggcagc
gctggcgttccagggatacccggctctccaggccccaaaggattgccagggactgtcggc
tatccaggaagccctggactgcccggagaaaaaggtgacaaaggcctcccaggatcagat
ggaattcctggcatcaaaggagaagcaggtcttcctgggcagcctggccccacgggccca
gccggccagaaaggggagcccggcagtgacggaatcccagggtcagtgggagagaagggt
gaaccagggctgcccggaagaggattcccagggtttccaggggccaaaggagagaaaggc
tcaaagggtgatgtgggattcccgggacaagccgggagtccaggcattcccggatccaaa
ggagagccaggattcctgggccccccggggccgcaaggacagccaggcttgcctggagcc
ccaggccacgctgtggagggacccaagggagaccgaggcccacagggtcaacccggcctg
ccagggcttccgggacctgtgggacctccagggctccctgggcttgatggactcaaaggt
gacaaaggaaacccagggtggccgggggctcccggagctccagggcccaagggagagcca
ggattccagggcctgcctgggattggaggctctccaggcatcactggctcgaagggggat
atgggacctcctggagttccaggatttcaaggtcagaaaggtctccctggcctgcaggga
gccaagggcgatcaaggtgaccagggcttccctggaagtaaagggcttcctggtcccccg
ggccccccagggccctatgacatcgtcaaaggcgagccagggcttcctggtccagagggt
cctgcaggtctgaaggggctcccgggacctccaggccccaaaggacagcaaggtgtgaca
ggatccgtgggcttacctggaccaccaggtattcctggttttgacggtgcacctggccag
aaaggagagactggacccttcggcccccctggtccaagagggtttccaggcccaccaggc
cctgatgggttgccaggatccatgggtcccccgggcaccccatctgtggaccatggcttc
ctcgtgactaggcacagtcaaacaacagacgacccacagtgtccacctgggaccaaaatt
ctttaccacgggtactccttgctctacgtgcaaggcaacgaacgggcccatggccaggac
ttgggcacggcggggagctgtctgcgaaagttcagtacgatgcccttccttttctgcaac
atcaacaacgtgtgtaacttcgcctcccgaaacgactactcctactggctatccacgcca
gagcccatgcccatgtccatggcacccatcgccggggacaacatcaggccatttattagc
aggtgcgcggtgtgtgaggcaccagccatggtgatggctgtgcacagccagaccattcag
atcccgcagtgccctagcggctggtcctccctctggatcggctattccttcgtgatgcac
accagcgccggcgccgaaggttctggccaagcccttgcgtctcctgggtcttgcctggaa
gagtttcgaagtgcgccattcatcgagtgccacggccgtgggacctgcaactactacgcc
aatgcttacagcttctggctcgccactatcgagagaagcgagatgttcaagaagcccacg
ccatccaccttgaaggcaggagagctacgcacacacgtcagtcgctgccaagtctgtatg
agaagaacgtaa

KEGG   Vulpes vulpes (red fox): 112927828
Entry
112927828         CDS       T05911                                 

Gene name
LAMC3
Definition
(RefSeq) laminin subunit gamma-3
  KO
K06247  laminin, gamma 3
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp05145  Toxoplasmosis
vvp05146  Amoebiasis
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112927828 (LAMC3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112927828 (LAMC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112927828 (LAMC3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112927828 (LAMC3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112927828 (LAMC3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112927828 (LAMC3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112927828 (LAMC3)
   05145 Toxoplasmosis
    112927828 (LAMC3)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_B
Other DBs
NCBI-GeneID: 112927828
NCBI-ProteinID: XP_025865014
UniProt: A0A3Q7SQM2
LinkDB
Position
Unknown
AA seq 1598 aa
MRLGALGDKCRVRLSPLRKKAEVGGGRAGALFRANGEEGRAAAVLPRDVPREGPSPGLAG
ARGAGPREAGGGRREARPDPSRFADGPPGGAPGAAGALPGASTRWDMDCPHHQPLAPATP
FPITTNPTKHWAVFRGSHTISHSQQPWKAYEITYVRLKFHTSRPESFAIYKRTRAGGPWE
PYQYYSASCQKTYGRPEGHYLRPGDDERVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYN
FEESPVLQEWVTSTELLISLDRLNTFGDDIFKDPKVLQSYYYAVSDFSVGGRCKCNGHAS
ECSPDGAGRLACRCQHNTTGTDCERCLPFFQDRPWGRGTAEAANECVPCNCSGHSEECVF
DRELFRSTGHGGRCLRCRDHTAGPHCERCREDFYRWSPRTPCQPCDCHPAGSLRLQCDAS
GTCICKPTVTGWKCDHCLPGFHSLSEGGCRPCSCSHAGSLGTCDPHSGRCPCKENVEGHV
CDRCRPGTFNLQPHNPAGCTSCFCYGHSKVCEAAAQFREHHIISDLRQGAKGWRTGSVGG
PEHPAQWGPRGLLLNPEDEEELTLPEKFLGDQRFSYGQPLTLTFLVPPGASPLPVQLRLE
GAGLALTLQHSSLSSSLDAEQPGEVQLRFELQETSEDVDPPLPPFHFQRLLTNLTALRIR
TSGQSPSPSGQVFLTEVRLTSAQRGLSPTASWVETCSCPKGYTGQFCESCAPGYKREIPL
GGPYTNCVPCTCNQHGTCDPHTGICVCGHHTEGPSCERCLPGFYGNPFAGQPDDCQPCPC
PGQSACTAIPESSDVVCTHCPLGQRGRRCEICDDGYFGDPLGISGAPEPCRRCQCSGNMD
PNAVGNCDSQSGHCLRCLHNTTGAHCERCQDGFYGNALAPRPADRCTPCSCHPEGSVSEQ
RPCDPVTGQCTCLPHVMGRDCGRCSPSFYDLQPGRGCRSCKCHPLGSQEDQCHPKTGQCP
CRPGVEGQACDRCQLGFFGFSIKGCRACRCSPLGAASAQCHKNSTCVCRPGFVGYKCDHC
QDNFFLTAGGTRCQECPSCYSLVKEEAAKLKARLTLMEGWLEGSNCGRSWGPLPILQGEA
PRGDIYQDYHLLQGAWEVFLEQVTGLKDAVKAAREQLRALSRGASCAQAQTEKACIQLAD
LDTVLESSEEEILQAATVLKSLVIPQNGPSQPTTWSHLATEAHALARSHKDATAKIKATA
RRALVASNTSYALLWSLVEGRMALEAQRELEDRYQDVQAAQKALGTAAAEVLPEAERALA
TVQQVGVDAAPRLALLAAPMALPQKSQAGALDLKVQALEKTVTSRERVVTEAAWALQATA
QAMLHKTQPLMQLHQEARAALTRASSSVQAATVTVMGARTLLADLEGMKRQFPQPKDPAT
LGRKAGSVRGRLLTDLKKKTKQAERMLGNAASVSASAKKKGQEAETLAKDSAKLAKALLR
EGKQEHRRAGRLSSQVQTTLRQASQQVLASGYRRQELEAAGQVGARLNAVEQQIWESRTS
LEKDVKVLSELLARLGSLDTHQAPVQALNETQWALERLRLQLSPPGALQGKLRLLEQESE
QQELQIQSFENDLAEIRADKQNLEAILQSLPKSCASWQ
NT seq 4797 nt   +upstreamnt  +downstreamnt
atgagactaggtgcccttggtgacaaatgtcgagttaggctctccccgcttcggaagaag
gcggaggtcggcggcgggcgggcgggcgccctgttccgagctaacggggaggaggggagg
gcggcggctgtgctgcctagagatgtgccgcgggaggggccctcaccggggctggcggga
gcccggggagcaggtccccgggaggcgggaggcgggaggcgggaggcgcgtcctgacccg
tcccggtttgcggacgggccgccgggcggggctccgggagccgctggggcgctcccgggc
gcgtccaccaggtgggacatggactgcccccaccaccagcccctggcccccgccactccc
ttccccatcactacgaacccaacgaagcactgggctgtgttccgcggcagccacaccatc
tcgcattcccagcagccgtggaaagcttacgagatcacctacgtgaggctgaagttccac
accagccgccctgagagctttgccatctacaagcgcacacgtgccggcggcccatgggag
ccctaccagtactacagtgcctcctgccagaagacctacggcaggcccgagggtcactac
ctgcgccctggcgatgacgagcgggtggccttctgcacctcggagttcagtgacatctcc
ccactgagcggtggcaacgtggccttctccaccctggagggccggcccagcgcttacaac
ttcgaggagagccctgtgttgcaggagtgggtcaccagcactgagctcctcatctccctg
gataggctcaacacatttggggatgacatcttcaaggacccaaaggtgctgcagtcctac
tactatgctgtgtctgacttttctgtgggtggcagatgcaagtgcaacgggcatgccagc
gagtgcagtcccgatggggcaggccggctggcctgccggtgccagcacaacaccacgggt
acagactgcgagcgctgcctgcccttcttccaggaccgcccatggggccggggcacagcc
gaggccgccaacgagtgtgtgccctgcaactgcagcggccactccgaggagtgtgtgttc
gaccgggagctcttccgcagcacggggcacggtgggcgctgcctccgctgccgggaccac
acggctgggccacactgtgagcgctgccgggaggacttctatcgctggagcccacggacg
ccctgccagccctgtgactgccacccagcaggctccctgcgcctccagtgtgatgcctca
ggtacctgcatctgcaagcccaccgtgacgggatggaagtgtgaccactgcctgcctggg
ttccactcactcagtgagggaggctgcagaccctgttcctgtagtcatgctggcagcctg
ggcacctgtgacccccacagtggacgctgcccctgcaaagagaatgtggaaggccatgtg
tgtgacagatgtcgtcccggaacattcaacctgcagccacacaacccagccggctgcacc
agctgcttctgctatggccactccaaggtgtgtgaggccgctgcccagtttcgggagcac
cacattatctctgacctccgccagggagccaagggctggcggaccggaagtgtggggggc
ccagaacatcctgcacaatggggcccaagggggctcctcctgaatcccgaagatgaggag
gagctcacgctaccagagaagttcctgggagatcagcggttcagctatggacagcccctc
accctgaccttcttggtgccccctggggcctccccgcttcctgtgcagctgaggctggaa
ggggctggcctggccctgactctgcagcactccagcctctccagctccctggatgccgag
cagcctggggaggtacagctcaggttcgagctgcaggagacctccgaagatgtggaccct
cccctgcctcccttccacttccagcggctgctcaccaatctgacggctctgcgcatcagg
accagtggccagagcccaagcccttccggccaggtgttcctgactgaggttcggctcaca
tcggcccagcgggggctctcccccacagcctcctgggtggagacctgctcatgtcccaag
gggtacacaggccagttctgtgaatcctgtgctccaggatacaagagggagataccactg
gggggtccctacaccaattgtgtcccctgcacctgcaaccagcatggcacctgtgacccc
cacacagggatctgcgtgtgcggccaccacacggagggtccatcctgtgagcgctgcttg
ccaggtttctatggcaaccccttcgcaggccaacctgatgactgccagccctgcccatgc
cctggacagtcggcctgcacagccatcccagagagtagcgacgtggtgtgtacccactgc
cccctcggccagagagggcggcgctgtgagatctgtgatgatggctactttggggatccc
ctggggatctctggggctcccgagccatgccggcggtgccagtgcagtgggaacatggac
cccaacgctgtgggcaactgcgactcccagtctggccactgcctgcgttgcctgcacaac
acaacaggtgcccactgtgagcgctgtcaggatggcttctacgggaacgccctggcccct
cggcctgcagacagatgcaccccctgcagctgccaccctgagggctcagtcagcgagcag
agaccctgcgacccagtgactggccagtgtacttgcttgcctcatgtgatgggacgggac
tgtggccgctgcagccccagcttctatgacctccagcctgggaggggctgccggagctgc
aagtgtcacccgctgggctcccaggaggaccagtgccaccccaagactgggcagtgcccc
tgtcgcccgggtgttgagggccaggcctgcgacagatgccagctgggtttcttcggcttc
tccatcaagggctgccgggcctgtaggtgctccccgttgggtgctgcctcagcccagtgc
cacaagaacagcacgtgcgtgtgcaggcccggcttcgtaggctacaagtgtgaccactgt
caggacaacttcttcctcacggctggtggcacacgctgtcaggagtgcccatcctgctac
tccctggtgaaggaggaggctgccaagctgaaggccaggctgaccctgatggaggggtgg
ctggaggggtccaactgtggcaggtcctggggaccactgcccattctgcagggagaggcc
ccacggggggacatctaccaggactaccacctcctgcaaggagcctgggaagtcttcctg
gagcaggtgacaggcctcaaggatgctgtgaaggctgcccgggagcagctgcgggctctg
agcagaggtgccagctgtgcccaggcccaaacagagaaggcctgcatccagctggcagac
cttgacacagtgttggagtcctcagaagaggagattctgcaggcggccactgtcctcaag
tccctggtgattcctcagaatgggcccagccagcccaccacctggagccacctcgccaca
gaggcccatgctcttgccagaagccacaaggacgccactgccaagatcaaggccactgct
cggagggctctagttgcttccaacaccagttacgcccttctctggagtctagtggagggc
agaatggccttggaggcccagcgggaactagaggacaggtaccaggatgtccaggcggcc
cagaaggcgctgggcacagccgcggcagaggtgctgcctgaagcagagagggcgctagcc
accgtgcagcaagtcggtgtagatgcagccccgcgcctggccttgctggctgcacccatg
gcactgccccagaagtcccaggctggggccctggacctgaaagttcaggccttggagaag
acggtcacatccagagagcgggtggtcaccgaggctgcctgggccctccaggccactgcc
caggctatgctgcacaagacccagcccctcatgcagctacaccaggaggccagagctgcc
ctgacccgggcttcctcgtctgtccaggccgccacagtgactgtcatgggagccaggacc
ctgctggctgatctggaaggaatgaagcggcagtttcctcagcccaaggacccggccacg
ctggggaggaaggcaggctcggtcaggggcaggcttctcacagacttgaaaaagaagacc
aagcaggcagagaggatgctgggaaatgcagcgtctgtctccgccagtgccaagaagaag
ggccaggaagccgagacgttggccaaggacagtgctaagctcgccaaggccttgctcagg
gagggtaagcaggagcaccggcgggcaggccggctctccagccaggtgcagacaacactc
cgacaggcttcccagcaggtgctagcttcagggtaccgcagacaggagctggaggcagct
gggcaggtgggtgccaggctgaatgccgtggagcagcagatctgggaatcacggacctcc
ctggagaaggacgtcaaggtcttgtcggagctgcttgccaggctggggtcactggacacc
catcaagccccagtgcaggccctgaacgagacccagtgggcactggagcgcctgaggctg
cagttgagccctccaggggccctgcaggggaagctgaggctgttggagcaggagtctgag
cagcaggagctgcagatccagagcttcgagaatgaccttgctgagatccgtgctgacaag
cagaacctggaggccattctgcagagcctgcccaagagctgtgccagctggcagtga

KEGG   Vulpes vulpes (red fox): 112930944
Entry
112930944         CDS       T05911                                 

Gene name
LAMA2
Definition
(RefSeq) laminin subunit alpha-2
  KO
K05637  laminin, alpha 1/2
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp05145  Toxoplasmosis
vvp05146  Amoebiasis
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05222  Small cell lung cancer
vvp05410  Hypertrophic cardiomyopathy
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
vvp05414  Dilated cardiomyopathy
vvp05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112930944 (LAMA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112930944 (LAMA2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112930944 (LAMA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112930944 (LAMA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112930944 (LAMA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112930944 (LAMA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112930944 (LAMA2)
   05414 Dilated cardiomyopathy
    112930944 (LAMA2)
   05416 Viral myocarditis
    112930944 (LAMA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112930944 (LAMA2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112930944 (LAMA2)
   05145 Toxoplasmosis
    112930944 (LAMA2)
SSDB
Motif
Pfam: Laminin_G_1 Laminin_EGF Laminin_G_2 Laminin_I Laminin_N Laminin_B Laminin_II Laminin_G_3 Arfaptin
Other DBs
NCBI-GeneID: 112930944
NCBI-ProteinID: XP_025869210
UniProt: A0A3Q7UPR7
LinkDB
Position
Unknown
AA seq 3170 aa
MARKKKDIVEEMRSWMRRRMTKSFKAPGIVVRVRCLACTEEFSEVRFAFIEMRESSLGAA
CARSMALHTFEQPQSEYRLGHIQVWRLFPAVLNLASNALITTNATCGEKGPEMYCKLVEH
VPGQPVRNPQCRICNQNSSNPYQRHPITNAIDGKNTWWQSPSIKNGIEYHYVTITLDLQQ
VFQIAYVIVKAANSPRPGNWILERSLDGVDYRPWQYHAVTDTECLALYNIYPRTGPPSYA
KDDEVICTSFYSKIHPLENGEIHISLINGRPSADDPSPELLEFTSARYIRLRFQRIRTLN
ADLMMFAHKDPREIDPIVTRRYYYSVKDISVGGMCICYGHARACPLDPVTNKSRCECEHN
TCGDSCDQCCPGFHQKPWRAGTFLTKTECEACNCHGKAEECYYDENVARRNLSLNIHGKY
IGGGVCINCTQNTAGINCETCIDGFFRPKGVSPSYPRPCQPCHCDPVGSLNEVCVKDEKR
ARRGLAPGSCHCKPGFRGVSCDRCARGYTGYPDCKPCNCSGAGSTNEDPCFGPCNCKENV
EGGDCGRCKAGFFNLQEDNHKGCDECFCSGVSDRCQSSYWTYGQIQDMRGWYLTDISGRI
RVAPQQEEVDPPQQISVSSLEAHRALPQGYYWSAPAPYLGNKLAAAGGQLTFTISYDFEA
EGEDAESVLQVTVILEGNDLRISTAQDEVYLQPYEEHIHVLSLKEELFTTHGTNFPVSRR
EFMMVLASLKRVLIQITYGPGVEAIFRLGSVGLESAVPYPTDRSIAAAVEVCQCPPGYTG
SSCESLWPRHRRVNGTVFGGICEPCQCFGHAESCDDLTGECLNCKDHTGGPHCNQCLPGF
YGDPSKGTSEDCLPCACPLSIPSNNFSPTCHLERGLGLMCDACPAGYTGHRCDRCAEGYF
GQPSVPGGSCQPCQCNDNLDFSIPGSCDSLSGSCRICKPGTAGRHCELCADGYFGDAVDA
KNCQPCGCRVNSSLSERCHARTGQCECKPNVQGRRCDECKPETFGLQSGRGCVPCNCNSF
GSKSFDCEESGQCWCQPGVTGKKCDRCAHGYFNFQEGGCTACDCSHLGNNCDPKTGQCIC
PPNTVGEKCSKCSPNTWGHSIITGCKACNCSTVGSLDFQCNINTGQCSCHPKFSGAKCTE
CNQGHWNYPHCSPCECFLPGTDDRTCDPETKKCSCVDQTGQCTCKVNVEGVHCDRCRPGN
FGLDAKNPLGCSQCYCFGATTQCSEAKGLIRTWVTLKPEQTILPLVDEALQHTTTKGIVF
QHPEIVAHMDLVRQDLRLEPFYWKLPEQFEGKKLMAYGGKLKYAIYFEAREETGFSTYNP
QVIIRGGTPTHTRIIIRHMAAPLIGQLTRHEIEMTEKEWKYYGDDPRISRTVTREDFLDV
LYDIHYILIKATYGNIMRQSRISEVSLAVGQPGRGTAAAPPARLIERCECPAGHSGLSCE
ACGPGFYRLPSEPGSAAARPALGPCVPCQCHGHSSLCDPETSKCQNCQHHTAGDFCERCA
LGYYGIVRGLPNDCQQCACPLISSSNNFSPSCVMEGLDDYRCTACPRGYEGQYCERCSPG
YTGSPSSPGGTCQECECDPHGSLPLPCDPATGLCTCRPGATGPKCDGCQPGHARQGSECV
FCGDECTGLLLDDLARLEQMAMSINLTGPLPAPYKMLYGLENVTQELKHLLSPQRAPERL
IQLAEGDLDTLVAEMSELLTRATKVTADGEQTGQDAERTNRRADSLGEFIKELAQDAEAV
NEKAIRLNETLGTQDKAFERNLQALQKEIDQMMTELRRRNLDKQKEVAEDELVAAEGLLK
KVKKLFGESRGKNEEMEKNLQATLADYKDKVDDAWDLLREAMDKIREANRLSAVNQKNMT
ALERKKEAIERGKQQAENTLKEGNDLLDEANRLAGAIDSVIEYVEDIRTKLPPMSEELKD
KIDDLSQEIKDRKLAEKVSQAESHAAQLNDSSAVLDGILDEAKNISFNATAAFNAYSHIK
DSIDEAEKIAQEAKGLAHEATKLATGPQGSLKEGAKGSLQKSFGILNEAKKLANAVKEND
DYLNGLTTRLENADARNGDLLRALNDTLGKLSAIPNDTAAKLQAVKEKARQANDTAKDVL
AQIKDLHQNLDGLKKNYNQLADSVAKTNAVVKDPSKNKIIADAHDTVKNLEQEADRLIDK
LKPIKELEDNLKKNISEIKELINQARKQANSIKVSVSSGGDCIRTYKPEIKKGSYNNIIV
NVKTAVADNLLFYLGSAKFIDFLAIEMRKGKVSFLWDVGSGVGRVEYPDLTIDDSYWYRI
EASRTGRNGTISVRALDGPKASIMPSTYHAASPPGYTILDVDANAMLFVGGLTGKLKKAD
AVRVITFTGCMGETYFDSKPIGLWNFREKEGDCKGCTVSPQVEDSEGTIQFDGEGYALVS
RPIRWYPNISTVMFKFRTFSSSALLMYLATRDLKDFMSVELTDGHVKVSYDLGSGMASVV
SNQNHNDGKWKSFTLSRIQKQANISIVDIDTNQEENIATSSSGNNFGLDLKADDKIYFGG
LPTLRNLSMKARPEVNLKRYSGCLKDIEISRTPYNILSSPDYVGVTKGCSLENVYTVSFP
KPGFLELPPVPIDVGTEINLSFSTKNESGIILLGSGGTPAQPRRKRRQTGQAYYAVFLSK
GRLEVHLSAGTRTMRKIVIRPGPSGFHDGREHSVHVERTKGVFTVQVDEDGRHTQALPAE
QAIQVHRLFVGGAPPEFQPPPLRNIPPFQGCVWNVVINSVPMDFAQPVSFKNADIGRCAH
QKPREDEDAAVPAEAVTQPGPVPTPALPAPTPVGAHGPCAADPEPALLVGSKQFGLSRNS
HVAIAFDDTKVKNRLTIEFEVRTEAASGLLFYMARINHADFATVQLRHGLPYFSYDLGSG
DTNTMIPTKINDGQWHKIKIVRIKQEGILYVDDASNRTTSPKKADILDVVGMLYVGGLPI
NYTTRRIGPVTYSIEGCIRNFQMAEAPADLEQPTSSFHVGTCFARAQRGTYFDGTGFAKA
VGGFKVGLDLLVEFEFRTTRTTGVLLGISSQKMDGMGIEMIDEKLMFHVDNGAGRFTAVY
DAGIPGHLCDGQWHKVTANKIKHRIELTVDGKQVEAQSPNQASTSADTNDPVFVGGFPDG
LNQFGLTTNVRFRGCIRSLRLTKGTGKPLEVNFAKALELRGVQPVSCPAN
NT seq 9513 nt   +upstreamnt  +downstreamnt
atggcacggaagaagaaagatattgtagaagagatgagatcatggatgaggcgacgcatg
acgaagagcttcaaagcacctggtattgttgtaagagtaagatgcttggcgtgtacagag
gagttttcagaggtaagatttgccttcattgaaatgcgcgagtcctcgctgggtgcagca
tgcgctcggagcatggcactccacacgtttgaacagccccagtcggagtacaggctgggc
catattcaggtctggcgtttattccctgctgtcctgaatcttgcttctaatgctcttatc
accacgaatgcaacatgtggagaaaaaggacccgaaatgtactgcaaattggtagagcat
gtccctgggcagccggtgaggaacccccaatgtcgaatctgcaatcaaaacagcagcaat
ccataccagagacacccaattacaaatgccattgatggaaagaacacttggtggcagagt
cccagtattaagaacggaattgaataccattatgtgacaattacactggatttgcagcag
gtgttccagatcgcctatgtgattgtgaaagcagcaaactcccctcgtcctggaaactgg
attttggaacgctcgcttgatggtgttgactacaggccctggcagtaccatgcggtgaca
gacaccgagtgtctagctctctacaatatctatccccgcaccggacccccgtcatacgcc
aaagatgatgaagtcatctgcacttccttttattccaagatacaccccttagaaaatgga
gagattcatatctctttgatcaacgggagaccaagtgcagatgatccttctcctgaactg
ctagaatttacctctgctcgctatattcgcctgagatttcaaagaatccgtaccttgaat
gctgacttgatgatgtttgctcacaaagacccaagggaaattgatcctattgtcacacga
aggtattactactcggtcaaggatatttcagtcggagggatgtgcatctgctatggtcat
gccagggcttgtccacttgatccagtgacaaataaatcccgctgtgagtgtgagcataat
acctgtggtgatagctgtgatcagtgctgtccaggattccatcagaaaccttggcgagct
gggacttttctgactaaaacagaatgtgaagcatgcaattgtcatgggaaagctgaagaa
tgctattatgatgaaaatgttgccagaagaaatctgagtttaaatatacatggaaagtac
attggagggggtgtgtgtatcaattgcacccaaaacactgctggtataaactgtgagaca
tgcattgatggtttcttcagacccaaaggggtatctccaagctatccaagaccatgccag
ccatgccattgtgatccagttggttccttaaatgaagtctgtgtgaaggatgaaaaacgt
gctcgacgaggattggcgcctgggtcttgtcattgcaaacctggcttcagaggcgtgagc
tgtgaccgatgtgccaggggctacactggctacccagactgcaaaccctgtaactgcagt
ggtgccgggagcacaaatgaggacccttgtttcggaccttgtaactgcaaggagaatgtg
gaaggtggggactgcggtcgctgtaaagccggcttcttcaatttgcaagaggataatcat
aaaggttgtgacgagtgtttctgttccggggtttcagacaggtgtcagagctcctactgg
acctatggccagatacaagacatgcgtggctggtacctgactgacatctctggccgcatt
cgagtggctccgcagcaggaggaggtggacccacctcagcagatcagcgttagcagtctg
gaggcccaccgtgccctgccacagggctactactggagcgccccagccccgtacctgggg
aacaaacttgcagcagctggaggacagttgacgtttaccatatcgtatgacttcgaggca
gagggagaagatgccgaaagtgtactccaggttacggttatcttagagggaaatgacttg
agaatcagcacagcccaagatgaggtgtatctacaaccatatgaagaacatattcacgta
ttgtcacttaaggaagagttgtttactacacatggcacaaacttccctgtcagtagaaga
gagtttatgatggtgcttgcgagtctgaagagagtcctcatacaaatcacctacggccct
ggggtggaagccatcttcaggttaggctctgttggcctggagtccgcggtcccctatcct
actgacagaagcattgcagcagcggtggaggtttgccagtgtccacctggatatactggc
tcctcttgtgaaagtctttggcctcggcacaggcgagttaacggcactgtctttggcggc
atctgtgaaccctgtcagtgcttcggtcatgcggaatcttgcgatgacctcaccggagaa
tgcctgaactgcaaggatcacacaggtggcccacactgcaatcaatgtcttcctggtttc
tatggtgaccctagtaaaggaacctctgaagactgtctgccctgtgcctgtccactcagt
atcccatccaataactttagccccacgtgccacttagagcgaggcctcgggctgatgtgt
gacgcgtgccccgccggctacacgggacaccgctgcgacaggtgtgcagaaggctatttt
ggacagccttccgttcctggaggatcgtgtcagccgtgccagtgcaatgacaaccttgac
ttctccatccctggcagctgtgacagcctgtctggctcctgtcggatatgcaagccgggg
accgccggccggcactgtgagctgtgcgctgacggctatttcggagatgcggttgatgcg
aagaactgtcagccgtgcggctgtcgtgtcaacagctccctctccgagcgctgccatgct
aggacgggccagtgcgagtgcaagccgaacgtgcaggggcggcggtgtgacgagtgtaag
cctgaaacctttggcctacaatcaggaagagggtgtgttccctgcaattgcaattccttt
gggtctaaatctttcgactgtgaagagagtggtcagtgttggtgccagcctggagtgaca
ggaaagaaatgtgaccgctgtgcccatggctatttcaacttccaagaaggaggctgcaca
gcttgtgactgttctcatctgggaaacaattgtgacccaaagactggtcagtgcatttgc
cctcccaataccgttggagagaaatgttctaaatgttcacctaatacctggggtcacagc
atcatcactggttgtaaggcttgtaactgcagcacagtgggatccttggatttccagtgt
aatataaacacgggccaatgcagctgtcaccccaaattctctggtgcaaaatgtacagag
tgcaaccaaggtcactggaattacccgcactgcagcccctgtgagtgcttcctgcctggg
acggatgacaggacctgtgacccagagactaagaagtgctcctgcgttgaccagacgggg
cagtgcacctgtaaggtgaacgtagaaggtgtccactgtgacaggtgtcggccgggcaat
tttggacttgatgccaaaaacccacttggctgcagccaatgctattgcttcggtgcaact
acccagtgctctgaagcaaaaggactgatccggacgtgggtgactctgaagcctgagcag
accatcctgcccctggtggacgaggctctgcagcacaccaccaccaaagggatcgttttt
caacatccagagattgtggcgcacatggacctggtgagacaggatctccgcttggaacct
ttctattggaaacttccagaacagtttgaaggaaagaagctgatggcctatggaggcaaa
ctcaagtatgcaatctattttgaggctcgggaagagacagggttctctacttacaatcct
caagttatcattcgaggtgggacccctactcacactagaattatcatcaggcatatggct
gctcctctaattggccagctgacaaggcatgaaattgaaatgacggagaaagaatggaaa
tattatggtgatgatcctcgaatcagtagaactgtgacccgtgaagacttcttggatgtt
ttatatgacattcattatattcttatcaaggcaacttatggaaatatcatgagacaaagc
aggatttccgaggtctccctggcggtgggccagcccggccgcggaactgccgccgcacct
ccagctcgcctgatagaacgatgcgagtgtcctgccggccactctggcctgtcctgtgag
gcgtgtgggccagggttctaccggctgccatcagagccgggcagtgcggcggcaaggcca
gcccttggcccctgcgtcccctgtcagtgccacggacacagcagcctgtgcgaccccgag
acctccaaatgccagaattgtcaacatcacactgctggtgacttctgtgaacgatgtgct
ctgggatattatggaattgtcaggggattgccaaatgactgtcagcaatgtgcttgccct
ctaatttcgtccagcaacaattttagcccttcctgtgtcatggaaggcctcgatgattac
cgctgcaccgcttgccctcgggggtatgaaggccagtactgtgaacggtgcagccccggc
tacaccggcagccccagcagccccggcggcacctgccaggaatgtgagtgtgacccgcac
ggctcgctgcccctgccctgcgacccagccacggggctgtgcacctgccggcctggggcc
actggcccgaagtgcgacggctgccagcccgggcacgctcgccagggctccgagtgtgtg
ttttgtggagatgaatgcacaggcctccttcttgatgacttggctcgcctggagcagatg
gccatgagtatcaacctcaccggcccactgcccgccccatataaaatgctgtatggtctc
gaaaatgtgactcaagaactaaagcacctgctctccccgcagcgggcgcctgagcggctc
atccagctggcagagggcgacctggacacgctcgtggcggagatgagtgagcttctgacc
agggctaccaaagtgacagcagatggcgagcaaactggacaggatgctgagaggaccaac
aggagagcagactccttaggagaattcattaaggagcttgcccaggatgcagaagctgtg
aatgaaaaagccataagactaaatgaaactctaggaactcaagacaaggcctttgagaga
aatttgcaagcgcttcaaaaagagattgaccagatgatgacagaactgaggaggagaaat
ctagataaacagaaggaagttgctgaagatgagctggtagccgcggaaggccttctgaag
aaggtgaagaagctatttggagagtcccgaggaaagaacgaggaaatggagaagaatctc
caagcaacgttggccgactacaaagacaaagttgatgatgcttgggacctgttgagagaa
gccatggacaaaatcagagaggctaatcgcttgtctgcagtaaaccagaaaaacatgacc
gctttagaaagaaagaaggaggctattgagcgcggcaaacaacaagcggagaacactctg
aaagaaggcaacgacctactggacgaagccaaccgtcttgcaggggcaatcgactcagtc
atagagtacgttgaagacattcgaactaaattgccgcccatgtctgaggagcttaaagat
aaaattgatgacctctcccaggaaataaaggacaggaagcttgctgagaaggtgtcccag
gctgagagccacgcggctcagttgaatgactcatctgctgtccttgatggaatccttgat
gaggctaaaaacatctcattcaatgccaccgcagccttcaatgcttacagccatatcaag
gactctattgatgaagctgagaaaattgcccaagaagccaagggtcttgcgcacgaagct
acaaaactggcaacaggtcctcagggttcattaaaggaaggtgccaaaggctctcttcag
aagagctttggaattcttaacgaagccaagaagttagcaaatgctgtaaaagaaaacgat
gactatctgaatggcttaacaaccagattagaaaacgcagatgctagaaatggggatctc
ctgagagctttgaatgacactttgggaaagttgtcagccattccaaatgacacagccgct
aagctgcaggccgtcaaggaaaaagcaagacaagccaacgacacagcaaaagacgtattg
gcgcagattaaagatctgcaccagaacctggatggcctgaagaaaaactacaatcaacta
gcagacagcgtcgccaaaacaaatgcggtggtaaaagacccttcgaagaacaaaatcatt
gcagatgcacatgacactgtgaaaaatctagaacaagaagctgatcgtctgatagataaa
ctcaaacccatcaaggaacttgaggataacctgaagaaaaacatctctgagataaaggaa
ctgataaaccaagcccggaaacaagctaattctatcaaagtatctgtgtcttctggaggt
gactgcattcgaacatacaagccggaaataaagaaaggaagctacaataatatcattgtc
aacgtaaagacagctgttgctgacaacctccttttttatcttggaagtgccaaatttatt
gactttctggctatagaaatgcgtaaaggcaaagtaagcttcctctgggatgttggatct
ggagttggacgtgtagagtatccagatttgaccattgatgattcttactggtaccgtatt
gaggcatcaaggactgggaggaatgggactatttccgtgagagctctggatggacccaaa
gcaagcatcatgcccagtacctaccatgcagcatctcctccaggttatactattcttgat
gtggatgcaaacgcaatgctgttcgttggtggcctgactgggaaactaaagaaggccgat
gctgtacgtgtgattacattcacagggtgtatgggagaaacatactttgacagcaaacct
atagggttgtggaatttccgagaaaaagaaggtgactgcaaaggatgtactgtcagtcct
caggtagaagatagtgaagggactattcagtttgacggagaagggtacgccctggtcagc
cgccccattcgctggtaccccaacatctcaacggtcatgttcaagttcaggacattttct
tcaagtgctctcctgatgtaccttgctacacgagacctgaaagatttcatgagtgtagag
ctgactgatgggcatgtaaaagtcagctatgatctgggctcaggaatggcttccgtggtc
agcaatcaaaaccataatgacgggaaatggaaatccttcaccctgtcaagaattcagaaa
caagccaacatatcaatcgtagatatagatactaaccaggaggagaacatagcgacttca
tcttctggaaacaactttggccttgacttgaaagcagatgacaaaatatattttggtggt
ctgccaacactgaggaacttgagtatgaaagcaagaccagaagtaaatttgaagagatat
tccggctgcctcaaggatatcgaaatttccagaactccatataacatcctcagcagtcct
gattatgttggtgttaccaaggggtgttcactagagaacgtttacacagtcagcttcccc
aagcctggtttcctggagctgccccctgtgccaattgatgtagggacagaaatcaacctg
tccttcagcaccaagaatgagtctgggatcatcctcttgggaagtggagggacgccagcc
caaccccggaggaaacgaaggcaaactggacaggcctactacgccgtcttcctgagcaag
ggccgcctggaggtgcacctgtccgcggggacacggaccatgaggaaaattgtcatcagg
ccggggccgagcgggttccacgatgggagagaacattccgtccacgtggagagaactaaa
ggcgtcttcactgtgcaagtggatgaagacggaaggcacacgcaggccctgccggcggag
caggctatccaggtccacaggctcttcgtggggggcgccccgccggagttccagccgccc
cccctcaggaacatccctcctttccaaggctgcgtgtggaatgtggtcatcaactcagtc
cccatggactttgcgcagcccgtgtccttcaaaaacgcagacatcggtcggtgtgcccac
cagaaaccccgcgaggacgaggatgcagcggtcccagccgaagcagttacccagccaggg
cccgtgcccacgcctgccctccccgcgcccacccccgttggggcccacggtccttgcgcg
gcagatccagagccagctcttttggtcgggagcaagcagttcgggctttcgagaaacagc
cacgttgcaattgcgtttgatgacaccaaagtcaaaaaccggctcacgattgagttcgaa
gtgcggacagaagcggcatcgggcctgctcttctacatggctcggatcaaccacgcagac
ttcgccaccgttcagctgagacatgggttgccctacttcagttacgacctgggaagcggt
gacaccaacaccatgatccccaccaagatcaacgatggccagtggcacaagattaagatt
gtgcgaattaagcaagaaggaattctttatgtagatgatgcatccaacagaaccaccagt
cccaagaaagcagatatcctggatgtcgtgggaatgctgtatgttggcgggctacccatc
aactacaccactcgaagaattggtccggtgacctacagcattgaaggctgcatcaggaat
tttcagatggcggaggcccccgccgatcttgaacagccaacctccagcttccacgttgga
acatgttttgctcgtgctcagagaggaacatactttgatggaacaggttttgccaaagca
gttggtgggttcaaggtgggattggaccttcttgtagaatttgaatttcgtacaactaga
accactggagttctcctgggaatcagcagccagaaaatggatggaatgggtattgaaatg
attgatgaaaagcttatgtttcatgtggacaatggtgctggccgattcactgctgtctat
gatgctgggatcccggggcatctgtgtgacggacagtggcataaagtcacagccaacaag
atcaaacaccgcattgagctgacagtagatgggaagcaggtggaagcccagagcccaaac
caagcatccacatcggctgatacaaatgaccctgtgtttgttggaggtttcccagatggc
ctcaaccagtttggtctgacaaccaacgttaggtttcgaggttgcatccggtctctgagg
ctcaccaaaggcacgggcaagccactggaggtcaattttgccaaggccctggagctacgg
ggcgtccagcctgtatcatgcccagccaactaa

KEGG   Vulpes vulpes (red fox): 112932053
Entry
112932053         CDS       T05911                                 

Gene name
COL4A5
Definition
(RefSeq) collagen alpha-5(IV) chain isoform X1
  KO
K06237  collagen type IV alpha
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04926  Relaxin signaling pathway
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04974  Protein digestion and absorption
vvp05146  Amoebiasis
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112932053 (COL4A5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112932053 (COL4A5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112932053 (COL4A5)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112932053 (COL4A5)
  09154 Digestive system
   04974 Protein digestion and absorption
    112932053 (COL4A5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112932053 (COL4A5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112932053 (COL4A5)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112932053 (COL4A5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112932053 (COL4A5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112932053 (COL4A5)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   112932053 (COL4A5)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112932053 (COL4A5)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 112932053
NCBI-ProteinID: XP_025870695
UniProt: A0A3Q7UTT9
LinkDB
Position
Unknown
AA seq 1691 aa
MKLRGVSLAAGWFLLALSLWGQPAEAAACYGCSPGSKCDCSGVKGEKGERGFPGLEGHPG
LPGFPGPEGPPGPRGQKGDDGIPGPPGPKGIRGPPGLPGFPGTPGLPGMPGHDGAPGPQG
IPGCNGTKGERGFPGSPGFPGLQGPPGPPGIPGMKGEPGSIIMSSLPGPKGNPGYPGPPG
IQGPAGPTGLPGPIGPPGPPGLMGPPGPPGLPGPKGNMGLNFQGPKGEKGEQGLQGPPGP
PGQISEQKRPTDVEFQKGDQGLPGDRGPPGPPGIRGPPGPSGGMKGEKGEQGEPGKRGKP
GKDGENGQPGIPGLPGDPGYPGEPGRDGEKGQKGELGSTGPPGLVIPRPGTGVTIGEKGN
MGLPGLPGEKGERGFPGIQGPPGLPGPPGTAVMGPPGPPGFPGERGQKGDEGPPGISIPG
SPGLDGQPGAPGLRGPPGPPGPHISPSDEICETGPPGPPGSPGDRGLQGEQGVKGDKGDT
CFNCIGTGVSGPRGQPGLPGLPGPPGSLGFPGQKGEKGHAGLTGPKGLTGIPGAPGPPGF
PGSKGEPGDVLTFPGMKGDKGELGYPGAPGLPGLPGTPGQDGLPGLPGPKGEPGGIAFKG
ERGPPGNPGLPGLPGNRGPMGPVGFGPPGPVGEKGIQGVAGNPGQPGIPGPKGDPGQTIT
QPGKPGLPGNPGRDGEVGLPGDPGLPGPPGLPGIPGNKGEPGIPGIGLPGPPGPKGFPGI
QGPPGAPGTPGRIGLEGPSGPPGFPGPKGEPGLGLPGPPGPPGLPGFKGTLGPKGDRGFP
GPPGLPGRTGLDGLPGPKGDVGPKGQPGTMGPPGLPGIGVQGPPGPPGIPGPVGQPGLHG
IPGEKGDPGPPGFDVLGPPGERGSPGIPGAPGPMGPPGTPGLPGKAGASGFPGAKGEMGM
MGPPGPPGPLGIPGRSGIPGLKGDNGLQGQPGPPGPAGEKGGKGEPGLPGPPGPVDPDLL
GSKGEKGDPGLPGIPGVSGPKGYQGLPGDPGQPGLSGQPGLPGPSGPKGNPGLPGKPGLP
GPPGLKGSIGDMGFPGPQGVKGSPGPPGVPGQPGSPGLPGQKGEKGDPGVSGIGLPGLPG
PKGEAGLPGYPGNPGIKGSMGDTGLPGLPGTPGAKGQPGLPGFPGTPGLPGPKGINGPPG
NPGLPGEPGPVGGGGRPGPPGPPGEKGNPGQDGIPGPAGQKGEPGQPGFGIPGPPGLPGL
SGQKGDGGLPGIPGNPGLPGPKGEPGYQGFPGVQGPPGPPGSPGPALEGPKGNPGPQGPP
GRPGPTGFQGLPGPEGPRGLPGNGGIKGERGNPGQPGQPGLPGLKGDQGPPGIQGNPGRP
GLNGMKGDPGLPGVPGFPGMKGPSGVPGSAGPEGDPGLVGPPGPPGLPGPSGQSIIIKGD
VGPPGIPGQPGLKGLPGLPGPQGLPGPIGPPGDPGRNGLPGFDGAGGRKGDPGLPGQPGT
RGLDGPPGPDGMQGPPGPPGTSSIAHGFLITRHSQTTDAPQCPHGTVQIYEGFSLLYVQG
NKRAHGQDLGTAGSCLRRFSTMPFMFCNINNVCNFASRNDYSYWLSTPEPMPMSMEPLKG
QSIQPFISRCAVCEAPAVVIAVHSQTIQIPHCPHGWDSLWIGYSFMMHTSAGAEGSGQAL
ASPGSCLEEFRSAPFIECHGRGTCNYYANSYSFWLATVDVSDMFSKPQSETLKAGDLRTR
ISRCQVCMKRT
NT seq 5076 nt   +upstreamnt  +downstreamnt
atgaaactgcgtggagtcagcctggctgccggctggttcttactggccctgagtctttgg
gggcagcccgcagaggctgcggcttgctatggttgttccccaggatcaaaatgtgactgt
agtggtgtaaaaggagaaaagggggagagaggatttccgggtttggaaggccatccaggt
ttgcctggatttccaggtccagaagggcctccagggcctcggggacaaaagggtgatgat
ggaattccagggccaccaggaccaaaagggatcagaggtcctcctggacttcctggattt
ccagggacaccgggtcttcctggaatgccaggccatgatggggccccaggacctcaaggt
atccctggatgcaatggaaccaagggagaacgtggatttccaggcagtcctggttttcct
ggtctacagggtcctccgggacctcctgggatcccaggtatgaagggagaaccaggtagt
ataattatgtcatcactgccaggaccaaagggtaatccaggatatccaggtcctcctgga
atacaaggcccagctggtcccactggtttaccagggccaattggtcccccaggaccacca
ggtttgatgggccctcctggtccaccaggacttccaggaccaaaggggaatatgggctta
aatttccagggacccaaaggtgaaaagggtgagcaaggtcttcagggtccccctggtcct
cctgggcagatcagtgaacagaaaagaccaactgatgtagagtttcagaaaggagatcag
ggacttcctggtgaccgagggcctcctggacctccagggatacgtggtcctccaggtcct
tcaggtggtatgaaaggtgagaagggtgaacaaggagagcctggcaaaagaggtaaaccg
ggcaaagatggagagaatggccaaccaggaattccaggtttacctggtgatcctggttac
cctggtgaaccaggaagggatggagaaaagggccaaaaaggtgaacttggctcaactggg
cctcctggacttgtaattcctaggcctgggaccggtgtaactataggagagaaaggaaac
atggggttacctggcttgcctggagaaaaaggagagcgaggatttcctggaatacagggt
ccacctggccttcctggacctccagggactgcagttatgggtcctcctggcccccctggc
tttcctggagaaaggggccagaaaggtgatgaaggcccacctggaatatctattcctgga
tctcccggacttgatgggcagcctggggctcctggacttcgagggcctcctggccctcct
ggccctcacatctctcctagtgatgagatatgtgaaacaggccctccaggccctcccgga
tctccaggtgatagaggactccaaggagaacaaggagtgaaaggtgacaaaggtgatacc
tgcttcaactgtattggaactggcgtttcagggcctcgaggtcaacctggtctcccaggt
cttccaggtcctccaggatctcttggtttccctggacagaagggagaaaaaggacatgct
ggtctaaccggtcccaaaggattaacaggcataccgggagctccaggtcctccaggcttt
cctggatctaaaggtgaacctggtgacgtcctcacttttccaggaatgaagggtgacaaa
ggagagttgggttaccctggagcccctgggcttcctggtttacctggaacccctggacaa
gatggactgccagggcttcctggccccaaaggagaacctggtggaattgcttttaagggt
gaaagaggtccccctgggaatccaggcttgccaggtctcccggggaatagggggcctatg
ggccctgtgggttttggccctccaggcccagtaggtgaaaaaggaatacaaggtgtggca
ggaaatccaggccagccaggaataccaggtcctaaaggtgatccaggtcagaccataacc
cagccagggaagcctggcctgcctggtaatccaggcagagatggtgaggtggggcttcca
ggtgaccctggacttcccggcccaccgggcttgccaggaatacccggtaataaaggagaa
ccaggtatccctggaattgggcttcctggaccacctggtcccaaaggttttcctggaatt
caaggacctccaggagcacctgggacacctggaagaattggcctagaaggcccttctggg
ccaccaggctttccaggaccaaagggagaaccaggacttgggctgcctgggccacctgga
cccccaggactcccaggtttcaaaggaacacttggtccaaaaggagatcgtggtttccca
ggacctccaggtcttcccggacgtactggcttggatgggctccctggaccaaaaggtgat
gttgggccaaagggacaacctgggacaatgggacctcctgggcttccaggaataggtgtt
cagggaccaccagggccaccagggattcctggaccagtaggtcaacctggcctacacgga
ataccaggagagaagggagatccagggcctcctgggtttgacgttctaggaccccctggt
gagagaggcagtccagggattcctggagcacctggtcctatgggacccccaggaacacca
gggcttccaggaaaagcaggagcctctggatttccaggtgccaaaggtgaaatgggtatg
atgggacctcccggccctccaggacctttgggaattcctggcaggagtggtattcctggt
ctaaaaggtgataatggtttgcagggtcagccaggacctcctggccctgcaggagaaaaa
ggtggtaaaggagagcctggccttccaggccctcctggaccagtggatccagatctgttg
ggctcaaaaggagagaaaggggaccctggcttaccaggtattcctggagtttcagggcca
aaaggttaccagggtttgcctggagacccagggcaacctggactgagtggacaacctgga
ttaccaggaccatcaggtcccaaaggtaaccccggcctccctgggaaaccagggcttcca
ggacctcctgggcttaaaggaagcataggtgatatgggttttccaggtcctcagggtgtg
aaagggtctcctggacctcctggagttcctggacaacctggctccccaggattacctgga
caaaaaggtgaaaaaggtgatcctggtgtttcaggcattggtcttccaggtcttcctggc
ccaaagggtgaagctggtcttcctggatacccaggaaaccctggaatcaaaggttctatg
ggagatactggtttgcctggattaccagggacccctggagcaaaaggacaaccaggcctt
cctggattccccggaaccccaggacttcctggaccaaaaggtattaatggtcctcctggg
aaccctggccttccaggagaacctggtcccgtaggtggtggagggcgtcctgggccacca
gggcctccaggtgaaaaaggcaacccaggtcaagatggtattcctggaccagctggacag
aagggtgaaccaggtcaaccaggctttggaatcccaggaccccctggactcccaggactt
tctggtcaaaagggtgatggaggattacctggcattccaggaaaccctggccttcctggt
ccaaaaggagaaccaggctatcagggtttccctggtgtccagggtcccccaggccctcct
ggctctccaggtccagctctggaaggccctaaaggcaaccctgggcctcagggtcctcct
ggaagaccaggtcctacaggttttcaaggtctaccaggtccagaaggtccccggggtctc
cctggaaatggaggtattaaaggagagagaggaaacccaggccaacctgggcaacctggt
ttgcctggcttgaaaggagatcaaggaccaccaggaatccagggtaatcctggccggcca
ggtctcaatggaatgaaaggagatcctggtctccctggtgttccaggatttccaggtatg
aagggacccagtggagtaccaggttcagctggccctgagggggatccaggacttgttggc
ccaccaggtccccctggactacctggtccttcaggacagagtattataatcaaaggagat
gttggtccaccagggatcccaggccagcctggattaaaaggtctaccaggactaccagga
cctcagggcttaccaggtccaattggccctccaggagatccaggacgcaatggactccct
ggctttgacggcgctggagggcgcaaaggagacccaggtctgccaggccagccaggtacc
cgtggtttggatggtccccctggaccagatggaatgcaaggtcctccaggtcctccagga
acttcctctattgcccatggattcctcatcacacgtcacagccagacaacagatgcacca
caatgcccacatggaactgtccagatttatgaaggcttttctctcttatatgtccaagga
aataaaagagctcacggtcaagacttggggacggctggcagttgccttcgtcgcttcagt
accatgcctttcatgttctgcaacatcaacaatgtttgcaactttgcttcaagaaatgac
tattcttattggctgtctaccccagagcccatgccaatgagcatggagcccctgaagggc
cagagcatccagccattcattagtcgatgtgcagtatgcgaagctccagctgtggtgatt
gcagttcacagtcagaccatccagattccccattgtcctcacggatgggattctctctgg
attggctattccttcatgatgcacacgagcgcaggagcagagggctcaggtcaagccctg
gcctcccctggttcctgcttggaagagtttcgttcagctcctttcattgaatgtcatggg
cggggtacctgcaactactatgccaactcctacagcttttggctagcaactgtagatgtg
tcagatatgttcagcaaacctcagtcagaaacactgaaagcaggagacttgaggacacgt
attagccgatgtcaagtgtgcatgaagaggacataa

KEGG   Vulpes vulpes (red fox): 112932054
Entry
112932054         CDS       T05911                                 

Gene name
COL4A6
Definition
(RefSeq) collagen alpha-6(IV) chain isoform X1
  KO
K06237  collagen type IV alpha
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04926  Relaxin signaling pathway
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04974  Protein digestion and absorption
vvp05146  Amoebiasis
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112932054 (COL4A6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112932054 (COL4A6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112932054 (COL4A6)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112932054 (COL4A6)
  09154 Digestive system
   04974 Protein digestion and absorption
    112932054 (COL4A6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112932054 (COL4A6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112932054 (COL4A6)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112932054 (COL4A6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112932054 (COL4A6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112932054 (COL4A6)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   112932054 (COL4A6)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112932054 (COL4A6)
SSDB
Motif
Pfam: Collagen C4
Other DBs
NCBI-GeneID: 112932054
NCBI-ProteinID: XP_025870697
UniProt: A0A3Q7TM10
LinkDB
Position
Unknown
AA seq 1689 aa
MHPGLWLLLVTLCLTEELAGAGEKKSYGKPCGGQDCSGGCKCFPEKGARGQPGPIGIQGP
TGPQGFVGPSGLAGLKGERGSPGPLGPYGPKGDKGPMGVPGFLGINGIPGHPGQPGPRGP
PGLDGCNGTQGAVGYPGPNGYPGLLGPPGLPGQKGSKGEPVLAQGTFKGMKGEPGLPGLD
GIIGPPGAPGSPGAVGHMGPPGLQGPPGPPGFPGPDGNMGLGFQGEKGVKGDVGLPGPAG
PPPSTGELEFMGFPKGKKGSKGEPGLPGFPGISGPPGLPGLGTAGEKGEKGIPGLPGPRG
PMGLERLQGPPGIQGKKGSSGFPGLNGLPGIKGEKGGIGLPGPDVFIDTDGAVISGYPGD
PGMPGLPGLKGDEGVQGLPGPSGIPGLPALPGVPGALGPQGVPGLKGDQGSPGRTTVGTA
GPPGRDGLPGLPGLQGPPGPAFETETLQNTEPGFPGLRGERGPKGNPGLKGIKGDLGFCA
CDGGVPNTGPPGEPGMPGPPGLIGLPGLKGTRGDPGSGGAQGPSGAPGLFGPPGPAGSKG
DKGEPTFSSVSGVPGEQGDPGPQGLPGEMGTPGKDGIPGLPGLPGLPGDGGQGFPGEKGL
PGLPGERGHSGPTGPPGIGLPGSPGPRGLPGDQGIDGLPGQQGLPGLPGITLPCIIPGTY
GLSGLPGAPGFPGPKGARGLPGTPGQPGLRGNKGEPGSPGLVHLPELPGFPGPRGEKGLP
GFPGLPGKDGLPGKLGSPGLPGPKGAPGDIFGAENGSPGEQGLQGLPGDRGLPGDSGLPG
PKGLLGKSGLLGPKGERGSPGTPGHMGVPGPPGPDGLYGSIKGKPGLPGVPGFPGPSGHP
GKKGLRGETGSPASAGKRGLPGLKGLPGSPGLIGFLGSSGLPGNTGLPGLPGPKGEKGSV
GLVGFPGMPGLPGIPGTSGIKGISGSAGRVGPSGQAGHAGEKGDRGDPGPAGVPSPRPPM
LNLRFKGDKGSRGSAGLDGFPGPRGDKGEAGPLGPPGLPGAPGFPSTIKGLIGRAGLPGS
IGLRGLPGLKGSPGITGFPGIAGESGSQGLNGAPGLPGASGLPGSKGDQGQTLGISGSPG
LKGQPGESGFKGVQGTNGLVGDVGLPGSKGEDGKVGISGDLGLPGSPGLPGIAGMRGNPG
LPGSPGRPGATGTLGPPGLVGTKGFPGLPGLHGLNGLPGTKGTHGTPGPSISGVPGPAGL
PGPKGEKGSPGTGIGAPGRPGSRGQKGGRGFPGLQGPAGLPGAPGLSLPSIIVGQPGDPG
RPGLDGEQGRPGPPGPPGPPGPSSNQGDPGDPGFPGVPGPQGPKGVQGIPGFSGLPGELG
LKGMRGEPGFMGIPGKVGPPGDPGLPGMKGKTGPQGFSGPQGAPGQTTIAEAVQVPPGPM
GLPGIDGIPGLTGDPGVQGPVGLQGSKGLPGVPGKDGLNGIPGPPGALGDPGLPGLQGPP
GFEGAPGKKGPFGRAGVPGQSVRVGYTLVKHSQSEQLPLCPAGMSQLWVGYSLLFVEGQE
KAHNQDLGFAGSCLPRFSTMPFIYCNINEVCHYARRNDKSYWLSTTAPIPMMPVGQAQIP
QYISRCSVCEAPSQAIAVHSQDITIPQCPLGWHSLWIGYSFLMHTAAGAEGGGQSLVSPG
SCLEDFRATPFIECSGARGTCHYFANKYSFWLTTVEERQQFQEEPVSETLKSGQLHTRVS
RCQVCMRSL
NT seq 5070 nt   +upstreamnt  +downstreamnt
atgcaccctgggttgtggctgctcctggttacattgtgcctgactgaggaactggcagga
gccggagagaagaagtcctatggaaagccatgtggtggccaagactgcagtggaggctgt
aaatgctttcctgagaaaggagccagagggcaaccagggccaatcggaattcaaggtcca
acgggtcctcaaggatttgtcggccctagtggtttagcagggttgaaaggagaaaggggc
tccccaggccccctgggaccatatggaccaaaaggagataagggccccatgggagtgcct
ggctttctcggcatcaatgggattccgggtcaccctggacagccagggcccagaggccca
cctggcctggatggttgtaatggaactcaaggagctgtcggatatccaggccctaatggc
tatcctgggcttctcggaccacctgggcttcctggtcagaaaggctctaaaggtgaacct
gtccttgcccaaggtactttcaaaggaatgaagggggagcctgggcttcctggactggat
ggaataattggccctccaggagcacctgggtccccaggagctgtaggacacatgggacca
ccaggattgcaaggtcctccaggccctcctggcttccctggtcctgatgggaatatgggg
ttaggtttccaaggagagaaaggagtcaagggggatgttggcctcccgggccctgcagga
cccccaccatccactggggaactggaatttatgggatttcccaaagggaagaagggatcc
aagggtgaaccagggcttccgggtttcccaggaataagtggccctccaggtctcccggga
cttgggactgctggagaaaagggagaaaagggaatccctggtttgccaggaccaaggggt
cccatgggtttagaaagactccaaggccctccagggattcagggcaagaaggggtcctca
ggttttcctgggcttaatggactcccaggaattaagggtgaaaagggtggcattggcctg
ccaggcccagatgtgttcatcgatacagatggtgctgtaatctcaggttatcctggagat
cccggtatgccaggtctcccaggacttaaaggagatgaaggcgtccagggcctgcctggc
ccttctggcatccctggcttaccagctttaccaggtgtcccaggtgctctaggcccccag
ggagttccaggtttaaagggggaccaaggaagcccaggccgtaccacagttgggacagct
ggccccccaggcagagacggtttgccaggcctaccaggcctacaaggcccacccggtcca
gcatttgagactgaaaccctacagaacacagagccagggttccctggtctccgaggagaa
agaggtccaaaaggaaacccaggcctcaaaggcataaaaggagatttgggcttttgtgct
tgtgacggtggggtccctaacactggaccacctggggagccaggcatgcctgggccacca
ggtctcataggtcttccaggccttaaaggaaccagaggagatccaggctctgggggtgca
cagggcccatcaggggctccaggcttatttgggcctccaggtcctgcgggctccaaagga
gataaaggggagccaactttcagttcagtatcaggggtgccaggggagcagggtgatcct
ggcccccaggggctccctggggagatgggaactccaggcaaggatggaataccaggtcta
ccaggtctgccaggtcttccgggtgacggtggacagggcttcccaggtgaaaaggggtta
ccaggactgcctggtgaaaggggccacagtggcccaactggccccccaggaattgggctg
ccaggatctcctggacctcgtgggcttcctggagatcaaggaatagatggattaccaggg
caacaaggcctccctgggcttccaggaatcaccttgccatgtataattcctgggacatat
ggcctgtctggcttaccaggagctcccggattcccaggccctaaaggggcccgtggcctc
cctgggacccctggtcagcctggattgcgtgggaataaaggagaacccggaagtccagga
ttagttcaccttcctgaattgccaggatttcccggacctcgtggagagaagggcttgcct
gggtttcctgggctccctggaaaagatggcttgcctgggaaacttggcagtccaggttta
cctggtcccaagggagccccaggtgacatctttggtgctgagaatggttctccgggggag
caaggcctacagggattaccaggggacagaggacttcctggagactctggccttccagga
cccaagggtttgcttggaaagtcgggcctgctaggccccaaaggtgaacggggcagccct
ggaacaccgggccacatgggagtgccagggcccccagggcctgatggtctatacggcagc
atcaagggcaagcccgggctccctggagtgccaggctttccaggcccttcaggacatcct
ggaaagaaaggtttaagaggcgagacaggttcccctgcatcagctggaaagagaggcctg
ccagggctgaaaggccttccaggatctccagggctgattggcttcttggggagctcaggc
ttgccagggaacactgggttgccaggcctgccaggtccaaagggtgaaaaggggtctgtt
gggctggtaggttttccagggatgccaggtctccctggtattcctggcacgagtggaata
aagggaatttctgggtcagccggaagagtgggaccatctggacaggctggccatgctggt
gaaaaaggagacagaggcgatccagggccagctggagtacccagtccaagacctcccatg
ctgaacctccggttcaaaggagacaaaggctctagaggctcagctggattggatggattt
cccgggcccagaggtgacaaaggagaggctggtcccctggggccaccaggcttgcctgga
gctcctggcttccccagtaccatcaaggggcttattgggagggcaggcctccctggctcc
ataggactccggggcttacccggcctgaaggggtcccctggaatcacaggcttcccggga
atagcaggagaaagcggttcacagggtctcaatggagctcctggactcccaggagcatct
ggtctcccaggttcaaaaggagatcaaggtcaaacacttggaatttctggtagcccagga
ctcaaggggcaacctggggagtctggttttaaaggcgtgcaaggaaccaatggactggtt
ggtgatgtgggtctcccaggaagcaaaggagaagatgggaaagttggtatttctggagac
ctcggccttcctggctccccaggactccccgggattgcaggcatgagaggaaatccaggg
cttccgggttctccaggccgtccaggggcaactgggacccttggaccccctggcctagta
ggaaccaaaggtttccctgggcttcctggtttacatggactcaatgggcttccaggaacc
aagggaacacatggaactccaggacctagtataagtggcgtgccggggccagcgggcctg
cctggccccaaaggagagaaaggatctccaggaactggtatcggagccccagggaggcca
ggctcaagagggcaaaaaggtggccgaggtttcccgggtctccagggccctgctggtctg
cctggtgccccaggcctctccttgccttcaatcatagtaggacagcctggcgaccctggg
cgaccagggctagatggagagcaaggccgcccgggccccccggggcccccggggccccct
gggccatcctccaatcaaggtgaccctggagaccctggcttccctggagttcctggccct
caagggcccaaaggagtccaaggaattccaggtttctccggcctccctggagagctaggg
ctaaaaggcatgagaggtgagcctggcttcatggggattccaggcaaggttgggccacct
ggagacccaggacttcccgggatgaaggggaagacagggccccaaggcttttccggaccc
caaggtgctcctggacagacaacaattgcagaagctgtccaggttcctcctggacccatg
ggtctaccgggcatcgatggcatccctggcctcacgggagatcctggggttcaaggtcct
gtaggcctccaaggctccaaaggtttacctggcgtccctggcaaagatggtctcaacgga
atccccggtccgcctggggctcttggcgaccctggtctccctggactgcaaggccctcca
ggatttgaaggagctccagggaagaagggtcccttcgggagggctggagtgcctgggcag
agtgtgagagtgggctacaccttggtgaagcacagccagtcagaacagctgcccctatgc
cctgccgggatgagccagctgtgggtgggttacagcttgctgttcgtggagggccaggag
aaagcccacaaccaggatctgggctttgctggctcctgcctgccccgctttagcaccatg
cccttcatctactgcaacatcaacgaagtgtgccactacgccagacgcaatgataaatcc
tactggctctccaccaccgcccccattcccatgatgcccgtcggccaggcccagatcccc
cagtacatcagccgttgttcggtgtgcgaggcgccctcacaggccattgccgtgcacagc
caggacatcaccatcccgcagtgccccctgggctggcacagcctctggattgggtactcc
ttcctcatgcacactgccgctggtgccgagggcggcggccagtccctggtctcaccgggc
tcctgcctggaggatttccgtgctactcctttcatcgagtgcagtggggcccggggcacc
tgccactacttcgccaacaaatacagtttctggctgacaaccgtggaagagaggcagcag
ttccaggaggaaccagtctctgaaacgctcaagtctgggcagctccacacccgagtcagc
cgctgccaggtgtgtatgagaagcctatag

KEGG   Vulpes vulpes (red fox): 112932157
Entry
112932157         CDS       T05911                                 

Gene name
COL9A3
Definition
(RefSeq) collagen alpha-3(IX) chain isoform X1
  KO
K08131  collagen type IX alpha
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04974  Protein digestion and absorption
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112932157 (COL9A3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112932157 (COL9A3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112932157 (COL9A3)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    112932157 (COL9A3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112932157 (COL9A3)
Proteoglycans [BR:vvp00535]
 Extracellular matrix (ECM) proteoglycans
  Collagen family
   112932157 (COL9A3)
SSDB
Motif
Pfam: Collagen
Other DBs
NCBI-GeneID: 112932157
NCBI-ProteinID: XP_025870776
UniProt: A0A3Q7TZL3
LinkDB
Position
Unknown
AA seq 667 aa
MPNDISPFQKVGPQGPPGPQGPPGKPGKDGIDGEAGPPGLPGSPGPTGAPGKPGKPGEAG
LPGLPGVDGLTGQDGPPGPKGAPGERGSLGPPGPPGLGGKGLPGPPGEAGESGVPGGIGL
RGPPGPSGLPGLPGPPGPPGPPGHPGVLPEGATDLQCPAICPPGPPGPPGMPGFKGPTGY
KGDQGEVGKDGEKGDPGPPGPAGVPGSVGLQGPRGLRGLPGPAGPPGDRGPIGFRGPPGI
PGAPGKVGDRGERGPEGFRGPKGDLGRPGLKGVPGMAGPGGEPGMPGKDGRDGVPGLDGE
KGEAGRNGAPGEKGPNGLPGLPGRAGSKGEKGELGRAGELGEAGPSGEPGIPGDVGVPGE
RGEPGHRGSAGALGPQGPPGAPGVRGFQGQKGSMGDPGLPGPQGLRGASGDRGPGGAAGP
KGDQGVAGSDGLPGDKGELGPGGPVGPKGEAGSRGELGPKGIQGPNGTSGVEGLPGPPGP
VGFPGVQGVPGITGKPGVPGREASEQHIRELCGGMLSEQIAQLAAHLRKPLAPGSAGRPG
PAGPPGPPGPPGSIGHPGARGPPGYRGPTGELGDPGPRGAPGDRGDKGSAGAGLDGPAGD
QGLQGPQGVPGVSKDGRDGANGEPGPPGDPGLPGAVGAQGTPGICDTSACQGAVMGGGGE
KSGSRSF
NT seq 2004 nt   +upstreamnt  +downstreamnt
atgcctaatgacatttctccatttcagaaagtgggacctcaaggcccccccggcccccaa
gggccacctgggaagccgggcaaggatggcattgatggagaagctgggcctcccggtctg
cccgggtccccgggaccaacaggggccccagggaagccagggaagccaggagaggccggt
ctgccgggactgcccggtgtggacggcctgacggggcaggacggacctcccggacccaag
ggcgcacctggggaacggggaagcctgggacccccggggcctcccgggctggggggcaaa
ggcctccccggaccccctggagaggcaggggagagtggcgtccccggtggaatcggcctc
cggggccccccgggaccctctggactgccaggcctccccggcccccccggacctcccgga
ccacccggtcacccaggggtcctccctgagggcgccactgaccttcagtgcccggccatc
tgcccaccaggcccccccggtcctccaggaatgccggggttcaaggggcccaccggctac
aaaggagatcaaggagaggtcggcaaggacggcgagaagggcgatcctggcccccctggg
cccgctggcgtccctggctctgtagggctgcagggacctcggggactccgaggtctgccc
gggccggccgggcccccaggggatcggggtcccatcggattcagagggccgccagggatc
ccaggagcccccgggaaagtgggtgacagaggcgagaggggcccagagggtttccgcggc
cccaagggtgaccttggcagacccggcctcaagggagtccccgggatggccgggccgggc
ggggagccgggaatgccaggcaaggacggccgggatggcgtgccgggactggacggcgag
aagggagaggccggtcgcaacggggcccccggagagaagggtcccaacgggctgccgggc
ctcccgggtcgagcagggtccaagggcgagaagggagaactgggccgagctggagagctg
ggggaggctggcccctcgggagagcctggcatcccgggggacgttggcgtgcctggggag
cgtggcgagcctggccacaggggctcggcgggggctctgggcccacaaggccctcctgga
gcccctggcgtccgcggcttccagggccagaagggcagcatgggcgaccccggcctgcca
ggtccccagggcctccgaggtgcctcaggtgaccggggcccggggggagccgcaggccct
aagggagaccagggcgttgcaggttccgacggcctccctggggacaaaggagagctgggt
cccggtggcccggtcggacccaaaggagaggctggcagtcgaggggagctgggccccaag
ggcatccagggtcccaatggcaccagcggcgtcgagggcctcccgggtccgcccggcccc
gtgggcttcccgggcgtccagggcgtgcccggcatcaccgggaaacccggggttccgggg
cgagaagccagcgagcagcacatccgggagctgtgcggggggatgctcagcgaacaaatc
gcgcagttggccgctcacctgaggaagcctctggcgcccggatccgccgggcggcctggg
ccagcggggcccccaggccccccggggcccccaggctccatcggccaccccggtgcccga
gggccccctggataccgcggccccaccggagagctgggggacccggggcccagaggggcc
ccgggggaccgaggagacaaaggctccgcgggcgcgggtctggacgggccggccggggac
cagggcctccaaggaccacaaggcgtgcctggcgttagcaaagacggccgcgacggggcc
aacggcgagcccgggcctccaggcgatcctggcctccccggtgctgtgggtgctcagggg
acacccggcatctgcgacacctcggcctgccaaggagctgtgatgggaggcggcggggaa
aagtcaggttctagaagcttctaa

KEGG   Vulpes vulpes (red fox): 112932206
Entry
112932206         CDS       T05911                                 

Gene name
LAMA5
Definition
(RefSeq) laminin subunit alpha-5
  KO
K06240  laminin, alpha 3/5
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp05145  Toxoplasmosis
vvp05146  Amoebiasis
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112932206 (LAMA5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112932206 (LAMA5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112932206 (LAMA5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112932206 (LAMA5)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112932206 (LAMA5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112932206 (LAMA5)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112932206 (LAMA5)
   05145 Toxoplasmosis
    112932206 (LAMA5)
SSDB
Motif
Pfam: Laminin_EGF Laminin_N Laminin_I Laminin_G_2 Laminin_II Laminin_G_1 Laminin_B Laminin_G_3 CENP-F_leu_zip Glyco_hydro_16 EzrA
Other DBs
NCBI-GeneID: 112932206
NCBI-ProteinID: XP_025870852
UniProt: A0A3Q7UCB9
LinkDB
Position
Unknown
AA seq 3739 aa
MGSPSRAFLSIPLQFRLPRPPPEATQGWRERTVTCTGGRPGAGQGQSEPRARGRLHRVAE
GPGANVVGPRRVLAEQTGERWARGGGGGPRGGGKVTLDHPTPQGQYCDICTAANSNRAHP
VSNAIDGTERWWQSPPLSRGLEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERST
DFGRTYQPWQFFASSKRDCLERFGSQTLERITRDDHVICSTEYSRIVPLENGEIVVSLVN
GRPGAMNFSYSPLLRDFTKATNIRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDISI
GGRCVCHGHADVCDAQDPADPFRLQCACQHNTCGGSCDRCCPGFNQRPWKPATTDSANEC
QSCNCHGHAHDCFYDPEVDRRNASQNQDNVYQGGGVCIDCQHHTTGINCERCLPGFYRAP
DHPLDSPHACRRCNCESDFTDGTCEDLTGRCYCRPNFTGERCDACAEGFTGFPHCYPVPS
FSPNDTGEQVLPAGQIVNCDCSAAGTQGNACRQDPRLGRCVCKPGFQGTHCELCAPGFYG
PGCQPCQCSSPGVAGGDCDRDSGRCTCREGFEGAACDRCAPGYFHFPLCQLCGCSPAGTL
PEGCDEAGRCPCRPEFDGPHCDRCRPGHHGYPDCRACTCDPRGALDQLCGAGGTCHCRAG
YTGAACQECSPGFHGFPDCTPCRCSAEGSLHASCDPRSGQCSCRPGVTGLRCDTCVPGAY
NFPYCEAGSCHPAGLAPDGHRLPEAQAPCTCRAHVEGPSCDRCKPGFWGLSPENPEGCTR
CDCDPRGTLGGLTECQPGDGQCSCKPHVCGQTCAACQDGFFGLDRADYFGCRSCRCDVGG
ALGQGCDPRTGACRCRPNTQGLTCSEPARDHYLPDLHDMRLELEEATTPQGHTVRFGFNP
LEFESFSWRGYAQMTPIQPRIVAKLNVTSPDLFRLVFRYVNRGPVSVSGRVSVQEEGKFA
TCTNCTEQSQLVTFPPSTEPAFVTVPQRGFGEPFVLNPGTWALVVEAEGVLLDYVVLLPS
TYYEAALLQLRVAEACTFQPAAQRSRNNCLLYTHLPLDGFPSAAGPEALCRHDNSLPRPC
PTEQLSPSHPPLAACLGSDVDVQLQVAVPQPGRYTLVVEYANEDAPQEVGAAVHTPQRAP
QQGALTFHHCPYSALCRATALDAQHHLAVFHLDTEASVRLTAEQARFFLHSVTLVPVETF
SVEFMQPRVHCVSAHGTFSPTSASCLLSRFPKPPRPIILRDCQVLPLPPGLPLTHSQDLT
PGAPPAGPQPRPPTAADPEAEPTLLRHPQGTVVLTTHVPALGRYAFLLHGYQPDHPTFPV
EVLVSGGRVWQGHANASFCPHGYGCRTLVVCEGQTVLDVTDSELTVTLRVPEGRWLWLEY
VLVVPEEAYSSSYLREEPLDKSYDFISQCATHGYHISPSSSSQFCRDAASSLSLYYNNGA
RPCGCHEMGATGPTCEPFGGQCPCRAHVIGRDCSRCATGYWGFPSCRPCECRGRLCDELT
GRCVCPPRTVPPDCVVCQPQTFGCHPLVGCEECNCSGPGVQELTDPTCDVDSGQCKCRPN
VAGRRCDTCAPGFHGYPSCRPCDCHEAGSMPSVCDPLTGQCHCKENVQGPRCDQCRLGTF
SLDAANPKGCTRCFCFGATERCRSSALARRELVDMEGWTLLSSDRQVVPHELRAEAELLY
ADLRRGFEAFPELYWQAPPSYLGDRVSSYGGTLRYELHSETHRGDVFIPRESRPDVVLQG
NQMSITFLEPVYPVPGHVHQGQLQLVEGNFRHTETHNAVSREELMMVLAGLEQLHIRALF
SQTSSAVSLRRVALEVAGEVGGGPPASNVELCMCPANYRGDSCQECAPGYYRDTKGLFLG
RCVPCQCHGHSDRCLPGSGICMGCQHNTEGDHCEHCLAGFVRSGSEDPTAPCVSCPCPLS
VPSNNFAVGCVLRGGRTQCLCKPGYAGTSCERCAPGFFGNPLVLGSSCQPCDCSGNGDPN
LLFSDCDPLTGACRGCLRHTAGPRCESCAPGFYGDALVPGNCTRCDCAACGTEACDPHTG
RCVCKAGPVPQEGYFGFQDCGGCRPCACGPAAEGSECHPQSGQCHCRPGAGGPQCRECAP
GHWGVPEQGCRRCQCQGGHCDVHTGRCTCPPGLSGERCDTCSQQHQVLVPDGPRGHGVHC
EVCDHCVVLLLDDLEQAGALLPAIREQLRGVNASSVAWARLHKLNASIATLQRQLQSPLG
VRHETAQQLEALDQQSSSLGQDVQTLDSQATRALAQASRLLDSTEASLGWAQTLLVAIRA
VDRILSELESQTDLLFPANASAPSGEHVRRTLAEVERLLGAMRARDLGAPRAAAEAELEE
AQRLLARVQEQLTSRWEQNQALAARVRDQLAQHEAGLMDLRGALNRAVGTTREAEELNSR
NQERLEDALQRRQELSRDNTTVRATLQAASDILARLSELLRGMDQAREEYEHLAANLDGA
RTPLLEKMRAFSPASSKVDLVEAAEAHAQQLHQLALNLSSIIRGVNQDHFIQRALEAAHA
YGSILEAVRAAEGAAGQALQQASHAWAVVVQQGLAPRARELLANSSALAEAALREQQRLG
RAWATLQGTGTPLRDAQAKKEQLAARVQAVQAMLAMDTDETSQKIAHAKAVATEAQATAT
RVQSQIQDMQRNLEQWQGQYGGLRSQDLGQAVLDAGRSVSTLEKTLPQLLAKLSLLENRG
VHNASLALSASIGRVRELIAQARGAASKVKVSMKFNGRSGVQLRAPRDVSDLAAYTALKF
YLQSPEQESGQVTRDRFVLYMGSRQAVGDYMGVALRNRKVQWVYRLGEAGHGVLSIDEEI
GEQFAAVSIDRTLQFGHMSITVEKQMLQETKGDTVAPGLEGLLSLQPDDFVFYVGGYPSN
FTAPEPLRLPGYLGCIEMDTLNEEVLSLYNFEDIFELNTAVDRPCARSKSTGDPWLTDGS
YLDGSGFARIRVEAQMGSYKRFEQELRLVSSSGIIFFMQHQDQFLCLAVQNSSLLLLYDL
GTGLQKASPQHTQHEEVQRLLALGTASKAIQVFLLRGTQNRVSRVLVRVERINVFSVEHN
STLELADSYYLGGVPPDQLPPSLRQLFPSGGSIRGCVKGIKAQGKYVDLKRLNTTGVSSG
CTADLLVGRAMTFHGDGYLSHELPDVPPVVTYIYSGLGFRSTQEDGLLYHQALLEGPCQV
SLQQGRVTLRLVRMEVKTQGSFADGAPHYVAFYGNDTGVWLYVDDQLQQMKPHQGLPPGL
QPQPSPRLYLGGSSTTGDTVNFTGCISNVFLRPLGPQRVFDLQQGWDNVNVSSGCAPAPR
TQPQGQRPRGLRAQKAGRHSRQPPQDPACSSPWPLSTIQDAYQFGGPLSGHLEFTRVPAA
PRNWFHMSMLVRPHLPRGLLLLAAPLADGSPSLVLFLSRGYFVAQTEGPGPQLRVRSRQR
SRTDQWHTVSVRWEKTRVQLTINGVRDQDRNQEGPGQQHQAARSPQPHTLFVGGLPASGF
SPRLPVAVGSFSGCVRRLRLDGQPLGAPIQVTGVTPCFSGPLEEGLFFADSGGVVTLDTL
GAALETLELEVRPQTASGLVFHLGRVQAPPYLQLQVLEKQVSGGPVGEGETGXANDGAGE
FSTWVTCPAALCDGQWHRLAVTRRGNVLQLKVDTQSNHTVGPAPAASADARPPLHLGGLP
GPLNAQAGPLAYRGCMRNLVLNQSPITWPRSVGVQGAVGASGCPSIHAAERPGAPAGHPL
EGRPRQAGSHLSGPPAPFS
NT seq 11220 nt   +upstreamnt  +downstreamnt
atggggtccccaagccgggcctttctatccatcccgctgcagttccgactccctcggccc
ccacccgaggccactcaaggctggcgggagcgcaccgtcacctgcacggggggccgaccc
ggggccgggcaggggcagagcgagccccgggcccgcgggaggctgcacagggtcgcggag
ggccccggggcgaatgtagtgggccctcgacgcgtgcttgccgagcaaacgggggagcgg
tgggcgaggggaggcggtggaggcccgcgtggtggtgggaaggtgaccctggaccatccg
accccccagggccagtactgcgacatctgcacagccgcgaacagcaacagggcacacccc
gtgagcaatgccatcgacggcacggagcgctggtggcagagcccgccactgtcccgggga
ctggagtacaacgaggtcaacgtcacgctggacctgggccaggtcttccacgtggcctat
gtgctcatcaagttcgccaactcgcctcggccggacctctgggtgctggagcggtccacg
gacttcggccgcacctaccagccgtggcagttcttcgcctcctccaagagggactgcttg
gagcggttcgggtcacagacgctggagcgcatcacgcgggacgaccacgtcatctgctcc
accgagtactcccggatcgtgcccctggagaacggcgagatcgtggtgtccctggtcaac
gggcgccctggggccatgaacttctcctactcgccgctgctgcgagacttcaccaaggcc
accaacatccgcctgcgcttcctgcgcaccaacacgctgctgggccacctcatgggcaag
gcgctgcgggaccccaccgtcacccgccggtactattacagcatcaaggacatcagcatc
ggcggccgctgtgtgtgccacggccacgcggacgtgtgcgacgcccaggaccccgcagac
cccttccggcttcagtgtgcctgtcagcacaacacgtgtgggggctcctgtgaccgctgc
tgccccggcttcaaccagcggccatggaagccggccaccaccgacagtgccaacgagtgc
cagtcctgcaactgccacggccacgcccacgactgcttctatgaccccgaggtggaccgg
cgcaacgccagccagaaccaggacaacgtgtaccagggtggcggcgtgtgcatcgactgc
cagcatcacaccaccggcatcaactgtgaacgctgcctgcccggcttctaccgggccccg
gaccaccccctcgactctccccacgcttgccgccgctgcaactgcgagtcggacttcacg
gacgggacgtgcgaggacctgaccggccgctgctactgccgccccaacttcacgggggag
cgttgtgacgcctgcgccgagggcttcactggcttcccgcactgctacccggtgccctcc
ttctcccccaacgacaccggggagcaggtgctgccggccggacagatcgtgaactgtgac
tgcagcgccgccgggacccagggcaacgcctgccgccaggacccgcggctgggacgctgc
gtgtgcaaacccggcttccagggcacccactgcgagctctgcgccccgggcttctacggc
cccggctgccagccgtgccagtgttccagccccggagtggcgggcggggactgtgaccgg
gactcgggccggtgcacctgccgggagggcttcgagggcgccgcgtgcgaccgctgtgcg
cccggctacttccacttccctctctgccagctgtgtggctgcagccctgcggggaccctg
cccgagggctgtgacgaggctggccgctgcccctgccggccggagttcgacggccctcac
tgtgaccgctgccgcccaggccaccacggctaccccgactgtcgcgcctgcacctgcgac
ccacggggtgccctggaccagctgtgcggggcaggcgggacgtgccactgccgcgctggc
tacacgggcgccgcctgccaggagtgcagccccggcttccacggcttccccgactgcacc
ccctgccgctgttccgccgaggggtccctgcacgcatcctgtgacccccgcagcgggcag
tgcagctgccggcccggtgtgacggggctgcgatgtgacacgtgtgtgcctggcgcctac
aacttcccctactgcgaagctggctcctgccaccctgccggcctggccccggatggccac
cgccttcccgaggcgcaggcgccctgtacgtgccgggcccacgtggaggggccgagctgc
gatcgttgtaaacccgggttctgggggctgagtcccgagaaccccgagggctgcacccgc
tgcgactgtgatcctcggggcacgctgggcggacttaccgagtgccagccgggcgacggc
cagtgctcttgcaagcctcacgtgtgcggccagacctgcgcggcctgccaggacggcttc
ttcgggctggaccgggctgactacttcggctgccgcagctgccggtgcgacgttggcggt
gcgctgggccagggctgcgacccgaggaccggcgcctgccggtgccgccccaacacccag
ggcctcacctgcagcgagccggcgcgagaccactacctgcctgacctgcacgatatgcgt
ctggagctggaggaggcgaccacgccccagggccacactgtgcgcttcggcttcaacccc
ctggagttcgagagcttcagctggaggggctacgcccagatgacgcccatccagcccagg
atcgtagcaaagctgaacgtgacctcccctgacctcttccggctggtcttccgctatgtc
aaccgggggcctgtgagtgtgagtgggcgagtgtcggtgcaagaggagggcaagtttgcc
acgtgtaccaactgcacagagcagagccagctcgtcaccttcccgcccagcacggagcct
gcctttgtcaccgtgccccagaggggctttggggagcccttcgtgctgaaccctggcacc
tgggctctggtcgtggaggctgaaggggttctcctggactacgtggtgctgctgcccagc
acgtactacgaggcagccctcctgcagctgcgtgtggccgaggcctgcacgttccagcct
gccgcccagcgctctaggaacaactgcctcctctacacccacctgcccctggatggcttc
ccctcagcggcgggacccgaggccttgtgtcgtcacgacaacagcctaccccggccttgc
cccacggagcagctcagcccttcacatccgccactggccgcctgcctgggcagtgacgtg
gacgtccagctccaggtggcagtgccacagccaggccgctacaccctggtggtggagtat
gccaatgaggacgccccccaggaggtgggcgcagccgtgcacacgccccagcgggccccc
cagcagggagcactcactttccaccactgcccttacagcgccctgtgccgggccacagcc
ctggacgcccagcaccacctggcggtcttccacctggacacggaggccagcgtccggctc
acggccgagcaggcccgcttcttcctgcacagcgtcaccctggtgcccgtggagacgttc
agcgtggagttcatgcagccccgggtccactgtgtcagcgctcacggcaccttcagcccc
accagcgcctcctgcctgctgtctcgcttcccgaagccgccccggcccatcatcctcagg
gactgccaggtgctgccgctgccacccggcctcccgctgacccactcgcaggacctgacg
cccggcgcacccccggcggggccccagcctcggccccccacggccgcggaccccgaggcg
gagcccacgctgctgcgccacccccagggcactgtggtccttaccacgcacgtgccggcc
ctgggccgctacgccttcctgctgcacggctaccagccggaccaccccaccttccccgtg
gaggtcctcgtcagcggcggccgagtctggcagggccatgccaacgccagcttctgccca
cacggctacggctgccgcaccctggtggtctgtgaaggccagacggtgctggacgtgacc
gacagcgagctcaccgtgaccctgcgtgtgcccgagggccgatggctctggttggagtat
gtgttggtggtccccgaggaggcctacagctccagctatctccgagaggagcccctggac
aaatcctatgacttcatcagccagtgtgccacccatgggtaccacatcagcccctccagc
tcgtcccagttctgtcgcgacgctgcctcttccctgtctctctactataacaacggggct
cggccttgcggctgccacgaaatgggcgccacgggccccacgtgcgagccctttgggggc
cagtgtccctgccgagcccacgtcatcggccgggactgctcccgctgtgccaccggctac
tggggcttccccagctgcaggccctgtgagtgccgaggccgtctgtgcgacgagctcacg
ggccgctgtgtgtgcccgccacgcaccgtcccgcccgactgcgtcgtgtgccagccccag
accttcggctgccaccccctggtgggctgtgaggagtgtaactgctcggggcccggtgtc
caggagctcacggaccccacctgtgacgtggacagtggccagtgcaagtgcagacccaac
gtggccggacgccgctgtgacacgtgtgcccccggcttccacggctaccccagctgccgt
ccctgcgactgccatgaagcgggctccatgcccagcgtgtgcgaccccctcacgggccag
tgccactgcaaggagaacgtgcagggcccgcggtgtgaccagtgtcgcctcgggaccttc
tccctcgatgccgccaacccgaaaggctgtacccgctgcttctgcttcggggccacagag
cgctgccggagctcggccctcgcccgtcgggagctggtggacatggagggctggacgctg
ctcagcagtgaccggcaggtggttccccacgagctgcgcgcggaggcagagctgctctac
gctgacttgcggcgcgggttcgaggccttccctgagctgtactggcaggccccaccctcc
tacctgggggacagggtgtcatcctatggcggaaccctccgctatgagctgcactcggag
acccatcgcggagatgtgttcatccccagggaaagcaggccggacgtggtgctgcagggc
aaccagatgagcatcacgttcctggagccggtgtacccggtgcccggccacgttcaccag
ggacagctgcagctggtggaggggaacttccgacacacggagacccacaacgccgtgtcc
cgcgaggagctcatgatggtgctggcgggcctggagcagctgcacatccgcgccctcttc
tcccagacctcctcggccgtctccctgcgccgcgtggcgctcgaggtggctggcgaggtg
ggcggggggcctccggccagcaacgtggagctgtgcatgtgcccggccaactaccgtgga
gattcgtgccaggagtgtgcccccggctattaccgagacaccaaaggtctcttcttgggt
cgctgtgtcccctgtcagtgccacggccactcagaccgctgcctccctggctcgggcatc
tgcatgggctgccagcacaacaccgaaggtgaccactgtgagcattgcctggccggcttc
gtgcgcagtgggtcggaggaccccacggccccctgtgtcagctgcccctgccccctctcg
gtgccttccaacaactttgccgtgggctgtgtcctgcgagggggccgcacgcagtgtctc
tgcaaacccggctatgcgggtacctcctgcgagcggtgcgcacccggcttcttcgggaac
ccgctggtgctgggcagctcctgccagccgtgcgactgcagcggcaacggtgaccccaac
ctgctcttcagcgactgcgaccccctgaccggtgcctgccgaggctgcctgcgccacacc
gcggggccccgctgcgagagctgcgcccccggcttctacggcgatgccctggtgccgggc
aactgcacccggtgtgactgcgcggcatgcgggacagaggcctgcgacccccacacggga
cgctgcgtgtgcaaggcaggacctgtaccgcaggaaggatacttcggcttccaggactgt
gggggctgccgcccgtgcgcctgcggaccagccgcggagggctctgagtgccacccccag
agtgggcagtgccactgccggccgggggctggagggcctcagtgccgtgagtgcgccccc
ggccactggggggtgcccgagcagggctgcaggcgctgccagtgccaggggggccactgt
gacgtgcacacaggccgctgcacatgcccccctgggctcagcggggagcgctgtgacacc
tgcagccagcaacaccaggtgctggtgccagacgggcccaggggccatggtgtccactgt
gaagtgtgtgaccactgtgtggtcctgctcctcgacgacctggagcaggcgggcgccctc
ctccctgccatccgggagcagttgcgtggcgtcaatgccagctctgtcgcctgggcccgg
ctgcacaagctgaacgcctccattgccaccttgcagaggcagctccagagccccctggga
gtccgccacgagacagcgcagcagctagaggccctggaccaacagagctcgagcctcggg
caggatgtgcagacgctggacagccaggccacaagagccctggcccaggccagccggctg
ctggacagcactgaggcctctctgggctgggcacagacgctgctggtggccatccgggct
gtggaccgcatcctgagtgagctcgagtcccagacggacctgctgttcccggccaatgcc
tccgccccgtcgggcgagcacgtgcgccggaccctggccgaggtggagcggctgctgggg
gcgatgcgggcccgagacctgggagccccgagggccgcagctgaggccgaactggaggag
gcccagagattgctggcccgtgtgcaggagcagctgaccagccgctgggagcagaaccag
gcgctggccgcacgtgtccgagaccagctggcccagcacgaggctggcctcatggacctt
cgaggggccctgaaccgggcggtgggcaccactcgggaggctgaggagctcaacagccgg
aaccaggagcgcctggaggacgccctgcaacggaggcaggagctgtcccgggacaacacc
actgtgagggccactctgcaggcggccagcgacatcctggcccggctgtctgagctcctg
cggggtatggaccaggccagggaggagtatgagcaccttgctgccaacctggacggggcc
cggacgccactgctcgagaagatgcgggccttctccccagcaagcagcaaggtggacttg
gtggaggccgcggaggcccacgcgcagcagctgcaccagctggccctcaacctgtccagc
atcatccgtggcgtcaaccaggaccacttcatccagcgcgccctcgaggcggcgcacgcc
tacggcagcattctagaagctgtgcgggccgccgagggggccgccggccaggccctgcag
caggcgagccacgcgtgggcggtggtggtgcagcagggcctggcgccccgagcccgagag
ctgctggccaacagcagtgccctggcggaggccgcgctcagggagcagcagaggctgggc
cgcgcgtgggctaccctccagggcactgggaccccgctccgagacgcccaggccaagaag
gagcagctggcggcccgagtgcaggcggtgcaggccatgctggccatggataccgatgag
acgagccagaagattgctcatgccaaagctgtggccaccgaagcccaggccacggccacc
cgcgtgcagtctcagattcaggacatgcagaggaacctggagcagtggcagggccagtac
ggaggcctgcggagccaggacctgggccaggcggtgctggacgcaggccgctcagtgtcc
accctggagaagacgctgcctcagctgctggccaagctgagcctcctggaaaaccgtggg
gtgcacaacgccagcctggccctgtcggccagcatcggccgagtgcgggagctcatcgcg
caagcccgaggagccgccagcaaggtgaaggtgtccatgaagttcaacgggcgctcaggg
gtgcagctgcgggcccctcgggacgtctccgacctcgccgcctacaccgctctcaagttc
tacctccagagcccggagcaggagtcgggccaggtcaccagggaccgctttgtgctctac
atgggcagccgccaggccgtcggggactacatgggtgtggctctgcggaaccggaaggtg
cagtgggtgtaccgcctgggggaggcgggccacggcgtcctcagcatcgacgaagaaatc
ggggagcagttcgcagcagttagcattgaccggaccctccagtttggccatatgtccatc
acggtggagaagcagatgctccaagagaccaagggtgacacggtggccccggggctcgag
gggctgctcagcttgcagcccgacgactttgtcttctacgtggggggctaccccagcaac
ttcacggcccccgagcccctccgcctccctggctacctgggttgcattgagatggacacg
ctcaacgaggaggtgctcagcctctataacttcgaggacatcttcgagctgaacacggcc
gtggacagaccttgtgcccgctccaagtcgaccggggacccctggctcactgacggctcc
tacctggacggctccggcttcgctcgcatccgcgtggaggctcagatgggctcttacaaa
cgctttgagcaggagctgcgcctcgtgtcctccagtggcatcatcttcttcatgcagcac
caggaccagttcctgtgcctggctgtgcagaacagcagcctcctgctcctctatgacttg
ggcaccggcctgcagaaggcctccccgcagcacacgcagcacgaggaggtgcagagactg
ctagccctgggcacggccagcaaggcgatccaggtgttcctgctgcggggcactcaaaac
cgcgtcagccgggtgctggtgcgcgtggagaggatcaacgtgttcagcgtggagcacaac
agcaccctggagctggccgactcctactacctggggggcgtgccgcccgaccagctgccc
ccgagcctgcggcagctcttcccctccggaggctctatccgcggctgcgtcaagggcatc
aaggcgcagggcaagtacgtggatctcaagaggctgaacaccaccggcgtcagctcgggc
tgcactgccgacctgctggtgggacgggccatgactttccacggcgacggctacctgtcc
cacgagctccccgacgtcccgcccgtcgtgacctacatctactccggcttaggcttccgc
agcacccaggaagatggtctgctctaccaccaagcgctcctggaggggccatgccaggtg
tccctgcagcagggccgtgtgacgctccggctggtgaggatggaggtgaaaactcaaggg
agctttgccgacggcgccccccattacgtggccttctacggcaacgacacgggggtctgg
ctctacgtggacgaccagctgcagcagatgaagccccaccagggcctgccccccgggctg
cagcctcagccctcccctcggctctatctggggggcagttccacaactggcgacacggtc
aacttcactggctgcatcagcaacgtattcctgcggccactggggccgcagcgcgtgttt
gacctgcagcagggctgggacaacgtgaacgtgagctcaggctgcgcccctgccccacgc
acccagccccaggggcagaggcctcgaggactgcgggcccagaaggccggccgacacagc
cgccagcccccccaggaccctgcgtgctcatcaccctggcccctcagcaccatccaagac
gcctaccagtttgggggccccctgtctggtcacctggagttcacccgcgtgccggctgcc
ccccggaactggttccacatgtcgatgctggtgcgcccccacctcccgcgaggactcctg
ctcctcgcggcccccctcgcagatggcagcccctccctggtcctcttcctgagccgcgga
tactttgtcgcgcagacagaaggccccgggccccagctccgagtgcggagccgccaacgt
tcacggactgaccagtggcacacggtgtctgtgcggtgggagaagacgcgggtccagctg
acgatcaatggggtccgggaccaggaccggaaccaggagggacccggccagcagcaccag
gcggcaagaagcccccagccccacactctgttcgtggggggcctccctgccagtggcttc
agccccaggctgccagtggccgtgggcagcttcagcggctgtgtgaggagactgcggctg
gacggacagcccctgggggcccccatacaggtgacgggggtcacgccgtgcttctcaggg
cccctggaggagggcctgttcttcgcagacagcggaggtgttgtcaccctagacaccctg
ggggccgctctcgagaccctggagctggaggtccggcctcagacagccagcggcctggtc
ttccacctgggccgggtgcaggcaccgccctacctgcagctgcaggtgctggagaagcag
gtaagtggtgggcctgtgggggaaggggaaacgggggnggccaacgatggcgcaggggag
ttctccacgtgggtgacgtgccctgcagccttgtgtgatgggcagtggcaccgcctggcg
gtgaccagaagggggaacgtgctccagctgaaggtggacacgcagagcaaccacactgtg
ggccctgcgccggcagcctcagcggacgccagaccacccctgcacctcgggggcctgcct
ggtcccctgaacgcacaggcggggcctctagcctaccgcggctgcatgaggaacctggtg
ctgaaccagtcccccatcacctggcctcgctctgtgggcgtccagggggcagtgggggcc
agcggctgcccctccatccacgcagcagagcgcccaggggccccagctgggcatccactg
gagggccgcccccggcaggccggctcccacctctcggggcctcctgcccccttcagctga

KEGG   Vulpes vulpes (red fox): 112932527
Entry
112932527         CDS       T05911                                 

Gene name
COL6A5
Definition
(RefSeq) collagen alpha-5(VI) chain
  KO
K06238  collagen type VI alpha
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04974  Protein digestion and absorption
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112932527 (COL6A5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112932527 (COL6A5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112932527 (COL6A5)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    112932527 (COL6A5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112932527 (COL6A5)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112932527 (COL6A5)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112932527 (COL6A5)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   112932527 (COL6A5)
SSDB
Motif
Pfam: VWA VWA_2 Collagen VWA_CoxE Copine
Other DBs
NCBI-GeneID: 112932527
NCBI-ProteinID: XP_025871289
UniProt: A0A3Q7T2Z7
LinkDB
Position
Unknown
AA seq 2609 aa
MKILLIIFVLILWTETLADQSPGPGPEYADVVFLVDSSNHLGTKSFPFVKTFISKIINSL
PIEAHKYRVALAQYSDQLHSEFELGTFKSRNPMLNHLKKNFGFVGGSLRLGQALREAHRT
YFSRPDSGRDKKQFPPILVVLASAESEDDVEEASKALREDGVRIISVGLQSASEQELKAM
ATGQFHFNLRSVRDLGAFAPNMTRIIKEATQYREVTALDDVKVPLPVACQRDSLADLMFL
VDESVGTRQDLRNLQNFLRNITASMDMRYNCTRLGLMSYSDGAKTISLLNSSTSQYEFQE
QIQKLSFQAGKSHAGAAIEKMRLEAFSESSGSRRAQGVPQIAVLVTHRPSTDEVRDAALQ
LRLQDVTVFAMNIQGANDTQLEEIVSYPPRQMVSMLKSYADLEAYSNNFQKKLQNEIWSQ
ISARAGQMDLDRTGCIDTKEADIYFLIDGSTSINKEGFEQIKQFMLAVTGMFSIGSDKVQ
AGAVQYSDKIRVEFYINASSNDMDLRKAILNIEQLQGNTHTGKALDFMLSIIKKDRKHRI
SEIPCHLIVLTDGKSQDEVLKPAERLRDEQITIHAVGIGEADKIQLQQIAGEEERVNFGQ
NFDSLRNIKNEVVHKICTEKGCEDMKADIMFLVDSSGSIGHNNFGKMKTFMKNLLAKIQI
GPDSTQIGVVQFSDINQEEFQLNKYFTRNETSDAIDRMSLINRGTLTGSALTFVGQYFTP
TKGARTKVKKFLILITDGEAQDPVRDPAKALRDKGVVIFSVGVYGANRTQLEEISGDSSL
VFQVENFDDLKTVESKLIFRVCALHDCKNIKVLDIVFVLDHSGSIGTQEQESMMNLTIHL
VKKADVDSDRVRVGALKYSDYPEVLFYLSGNKSSVIEHLRRRRYTGGNTYTARALEHANV
MFTEEHGSRIQQNVKQMLIIITDGVSHDRDNLSDTASKLRNKGINIYAVGVGQANQLELE
TMAGNKNNTFHVDNFSNLKDIYLPLQEKMCTNAHEPCDIQEADVIFFCDGSDMVSNFEFA
TMTTFVSDLIDNFNIQNQRIKIGLAQFGSRFQKIIELKNSLTIQELKTQIQMITKSKGFP
RIDLAFKEVKAMFDSSSGGRRNAGVPQTLVVLTSGDPYYDVANEAKILRSLGICVLVWGI
GNVHKEQFLPITGNSEKIITLHNFNKLNNVDVKKRMVREICQSCGKTNCFMDIVVGFDIS
THLPGQPLFHDHPRLRSYLPDILEDITSIRRASCGAGTEVQVNVAFKVNNDREFPAKFRI
YQRAMFDSLLQVTVDGPTHLNAQFLLSLWDTFEAKSKSQGQVLLIFSDGLGGESEIMLEN
QSDRLRKAGLDALLVVSLNTTAHDEFSSFEFGKGFDYRTHLTIGMRELGKKLSQYLGNIA
EKTCCCTFCKCSGAPGLYGSRGLRAMKGSPGLKGTRGHRGEDGDPGRRGDIGPTGDSGTA
GCPGQQGQKGAKGFSGSKGEHGEDGIDGLDGEEGIHGFPGAKGEKGDPGSQGSPGSRGPP
GGYGEKGFPGDPGNPGQNSNIKGQKGSKGEQGRQGRTGQKGTPGDPNSRGSRGREGRRGS
PGALGEPGNPGPQGTQGADGLQGPQGLNGIPGRKGEKGSEGHKGPQGSSGPVGAKGNVGS
PGPPGKKGESGILGDPGPMGQAGQRGRQGDDGIPGYGHMGRKGVKGPRGFTGDMGQKGDV
GDPGVPGGPGPKGYRGLTLTVGRKGEKGSPGPPGPPGRRGMKGMAGKPVYSQCDLIQFMR
NHSPCWKEKCPVYPTELVFALDQSNSISEQRFNETRDIITSIVNDLNIRESNCPVGARVV
VVSYDTGTSYLIRWSDYHSKKQLLQLISQIKYRPPTEAQDIGNAMRFVARNIFKRTYGGA
NVRKVAVFFSSGQAASPSSIITATMEFNALDINPAVFAFSERIFLEAFEFDNTGTFQVIP
VSPNGEYEPLEKFQHCTLCYDKCFPNVCIKEIFLPENSYMDVAFLLDNSQTIANDEFKAV
KTLVSSMIDNFNISSDPRISDIGDRIALLSYSPWDTSRRKKGVVKTEFGFTTYNDRVLMK
RHIQTSLQQLKGEATIGHTLLWTVENLFPQTPNLRKHKVIFVILAGEYHERKEFLKKVAL
RAKCQGYVIFVVSLGFTHTDDMEELASYPLDHHLIQLGRIHKPDLDYVTKFVKPLVYYIR
RGFNQYPPPVLENTCRLINSEEEDNQNSDLLFTPETHEFSSGEDSFIGRELSAKTDTSFV
WENGGSAHVAYINNRVKPQGLMITYENGQDSEGIASFTSGLENHGRKEEPGVINIPGDTS
LQEYYMDVAFLIDASQRIGNDEFREVKAFLISVLDYFHIAPDPLTSMLGDRVAVLSYSPP
GYMPNSEECPVYLEFDLITYNSIYQMKHHLQDSFQQLSGDVFIGHALQWTIDNVFVGTPN
LRKNKVIFVISAGETNPLDKEVLRNVALRAKCQGYIIFVFSFGPIHNDKELEELASHPLD
HHLVQLGRTHKPDLNYITKFVKPFVHLIRRAINKYPPADLRPKCVNITSPNPENVGSGNT
VVLIPEVYKIETGNSELFGEFGSQEHHSFVLGNNPSNGSETAIDLIQKLYMLFSTGELVM
NDKEEAHSEEMPALADGKQQDKKDGEDTR
NT seq 7830 nt   +upstreamnt  +downstreamnt
atgaagatcctactaattatatttgtcttaatcctttggactgaaacattggcagatcag
agtccagggccaggccctgagtatgcagatgtcgtgtttctggtggacagctccaatcac
ctgggaactaagtccttcccctttgtgaaaaccttcatcagcaaaatcatcaacagcctc
cccatcgaggcccacaagtaccgtgtggccctggcccagtacagcgaccagctccacagt
gagttcgagctgggcacgttcaagagcaggaaccccatgctgaaccacctcaagaagaac
ttcggcttcgttggtggctccctgcgcctaggccaagccctccgggaggcccacaggacc
tacttctccaggcccgacagcgggagggacaagaagcagtttcccccgattctggtggtc
ctggcttcggcggagtccgaggatgacgtggaggaggcctcgaaggccctgcgggaagac
ggggtgagaatcatctccgtggggctgcagagcgcgtctgagcaggagctgaaggccatg
gccacggggcagtttcatttcaacctgcggtcggtcagggaccttggagcgtttgcccca
aacatgacgcggatcatcaaggaagccacccagtacagggaggtaacggccctggacgat
gtaaaagttcctctcccagtggcctgtcagagagattcattagccgacctcatgttccta
gtggatgagtccgttggtaccagacaagatttaaggaacttgcagaatttcctgaggaac
attactgcctccatggatatgaggtacaactgcacacgccttggacttatgagttatagt
gatggagccaagacgatttcccttctaaattcaagcacaagccagtatgaatttcaggag
caaatccagaagctttctttccaggctgggaaatcccatgctggggctgccattgagaag
atgaggctagaagccttctcagagtcaagtggcagcagaagggcacaaggagtgcctcag
atcgccgtcttggtcactcacagaccatcaactgatgaggtgcgtgatgccgcactacaa
cttcggctgcaggatgtgactgtgtttgccatgaacatccaaggggctaatgacacccag
ttagaagaaatagtgtcttaccctccgagacaaatggtttccatgctcaagtcctatgca
gacttagaagcttacagtaataacttccagaaaaagcttcagaatgaaatttggtctcaa
atttctgctcgtgctgggcaaatggaccttgacagaactggctgtatagatacaaaagaa
gctgatatctatttcctcattgatggctcaaccagcataaataaagaagggtttgagcaa
atcaagcaatttatgttggcggtgacaggaatgttcagcattggctcagacaaagtccaa
gctggagctgtgcagtattcagataaaataagagtggagttttatatcaatgccagttct
aatgatatggacttaagaaaggctattttgaacattgagcaactccaaggaaatactcat
actgggaaagccctggatttcatgctgtcaataataaagaaggataggaagcataggata
agcgagattccctgtcacctcattgtgctgactgatgggaaatcccaagatgaagtgctg
aagcctgctgagagattgagggatgaacaaatcaccattcatgcagttggcattggggag
gctgataaaatacaactccaacaaattgctggggaagaagaaagggttaactttgggcag
aacttcgattctttaagaaacattaaaaatgaagttgttcacaaaatctgcactgaaaaa
ggatgtgaagacatgaaggctgacatcatgtttctggtggacagttctggcagcatagga
cataacaattttggaaaaatgaaaaccttcatgaaaaacctattagcgaagattcagatt
ggtccagacagcactcagattggtgtcgttcagttcagtgatataaatcaggaagaattc
cagcttaataaatactttacacgaaatgagacttctgatgcaatagacaggatgtctctc
atcaacagaggcactttgactggaagtgcactaacctttgtaggtcaatacttcaccccc
accaagggggcccgtactaaggtcaaaaagtttcttatcctcatcacggatggagaagcc
caagatcctgtgagagaccctgctaaagctcttcgggacaaaggtgtggtcatcttctct
gtgggggtgtacggtgccaacaggacacagctggaggagatcagtggggatagcagcctg
gtcttccaagttgagaactttgatgatctaaagacagtggaaagcaaactcatttttcgt
gtatgtgctctccatgattgtaaaaatattaaagtgttggacattgtgtttgtgctggat
cattcaggcagcataggcacacaagaacaagaaagcatgatgaacctaactatccatttg
gtgaagaaagcagatgttgacagtgaccgagttcgggttggagctctcaaatactcggac
tatcctgaggttcttttctaccttagtggaaataaatcttcagtcattgagcatctgagg
aggcgcaggtacaccggagggaatacctatactgccagggctcttgagcacgcaaacgta
atgttcacagaggaacatggcagccgcatccagcaaaatgtgaagcagatgctgatcatc
atcactgatggggtgtcccatgatcgagataacctcagtgacacagcatcgaaattaaga
aacaaaggcatcaatatctacgcagtgggtgtaggacaggccaaccaacttgaacttgag
actatggcagggaataaaaacaatactttccatgtagataatttcagtaacctgaaagac
atttacctgcctctacaagaaaaaatgtgtaccaatgcacatgagccgtgtgacattcaa
gaagctgatgttattttcttttgtgatggctctgacatggtatccaatttcgagtttgct
accatgacaactttcgtgtcagacttaattgataattttaacattcagaatcagagaata
aaaattgggttggctcaatttgggagtcgcttccaaaaaattatcgagttgaaaaactct
ctgactatacaggaattgaagactcaaattcaaatgatcaccaagagcaaagggtttcca
cgaatcgatctggcctttaaagaagtgaaagctatgtttgattcatcttctggtgggaga
agaaatgctggtgtccctcaaactttggttgttctcacatccggggatccctactatgat
gtggcaaatgaagcgaagatcttgagaagcctcggaatttgtgtcctggtttggggcata
ggaaatgttcataaggagcaatttctgccgataacaggcaattctgaaaaaataatcact
ctccataactttaataaattaaataatgtggatgtgaaaaaaagaatggtccgtgaaatc
tgccagagctgtgggaaaacgaattgctttatggacatagtggtcgggtttgacatttcc
actcacttgccgggacagccgttgttccatgaccacccccggctgagatcctacctccca
gacatcttagaggacatcacttccatcaggagggcaagctgtggggcaggcacagaggta
caggtgaacgtggccttcaaggtgaataatgaccgagaattccctgccaagttccgaatc
taccagagagcaatgtttgacagcctgctgcaagtcaccgttgatgggccaactcatctg
aatgcacagttcttgctgtcactgtgggatacatttgaggctaaatccaaatcccaagga
caggtgctactcatcttttcagatggtcttgggggtgaaagtgagataatgcttgaaaat
caatcagacaggctcagaaaagcaggactcgatgctctgctggtggtgtccctaaacacg
actgcccatgatgagttttccagctttgaatttggaaagggatttgattacaggactcac
ttgaccattggcatgagagagctgggcaagaagctatcacagtacctgggaaacattgca
gagaagacttgctgctgcacattttgcaagtgttcaggggctccaggtctttatgggtcc
cgaggactacgagccatgaagggttctccgggcttgaaaggtaccagaggacaccgggga
gaagatggagaccccggaagacgaggagatattggacccacaggagatagcgggactgca
ggatgtccagggcagcagggtcaaaagggagccaaaggattttctggaagtaagggagaa
catggagaggatgggattgatggactggatggggaagagggcattcatggatttcctggg
gcaaagggagaaaaaggtgatccaggatctcagggcagtccaggttccagaggcccccct
gggggatatggagagaaaggcttcccaggagatcctggtaatccaggacaaaacagtaac
atcaaaggacaaaagggctccaaaggagaacaaggaagacaaggtagaactggacagaaa
gggacaccaggtgatcctaattccagaggaagtaggggaagggaaggccgaagggggtcc
ccaggggccttgggggagccgggaaatcctggacctcaaggtacccagggagctgacgga
ttacaaggcccacagggattaaatggaattcctggcaggaaaggagagaagggaagcgag
gggcataaaggacctcagggctcttctgggccagtgggagctaaagggaatgttggaagt
cctgggcctccggggaaaaaaggagaatctggaattcttggagatccagggccaatgggg
caagctggacagagaggaagacagggagatgatggcatcccaggctatggtcatatggga
cgaaagggcgtaaagggcccaagaggattcactggagatatggggcaaaagggtgatgtt
ggtgatcctggagttcctggaggtcctggacccaaaggatataggggattaacactcact
gttggccggaaaggtgagaagggatctccaggacccccaggccctcctggacgaagaggc
atgaaaggcatggcagggaagcctgtatattctcaatgtgatctgatccagttcatgcgg
aaccatagtccctgttggaaagaaaagtgtccagtgtacccaacggaactggtatttgcc
ctggaccagtccaacagtatctctgaacagagatttaatgaaacaagggacatcatcacg
tccattgtcaatgaccttaacatcagggaaagtaactgccctgtgggagcaagagttgtt
gtggtttcctatgacacaggcaccagctacctcatccgctggtcagactaccatagcaag
aagcagctcctccagcttatttcccaaataaaatatcgaccccccacagaagcccaagac
attggtaatgcaatgaggtttgtggcccggaacattttcaagcggacatacgggggagcc
aatgtgaggaaagttgccgtgtttttcagcagtggacaagcagccagtccgtcatccatc
atcacagccaccatggaatttaatgccctagatatcaatccggcagtctttgcttttagt
gaaaggattttccttgaggcttttgagtttgacaatactggaacattccaggtgatccca
gtttctccaaatggggagtatgagccattagaaaaatttcaacactgtacactttgctac
gataaatgttttccaaatgtttgcatcaaagagatttttctacctgaaaattcatacatg
gatgtggctttcctcttagacaattctcagactatagcaaatgatgagtttaaggctgtg
aaaaccttggtgagctctatgattgacaacttcaacatttcatcagatccaagaatctca
gacattggtgacaggattgccttgttgagctattctccttgggatacttctaggagaaag
aagggtgtggtaaaaacagagtttggatttacaacttataatgacagagtcctaatgaag
aggcatatccagacttccctccaacagctaaaaggagaagctaccattggccatacccta
ctgtggacagtggagaacctcttcccacaaacacccaacttgagaaaacacaaggtcatt
tttgtgatcttagctggagagtatcatgagagaaaggaattcttgaagaaggtagctctg
agggccaagtgccaaggctatgtcatatttgtggtttccctgggctttacacatacggat
gacatggaagagttagccagctacccacttgatcaccatctgatacagcttgggagaatt
cataaaccagatctggattatgttacgaagtttgtaaagccacttgtttactatatcaga
cgtggattcaatcagtatccaccaccagtgcttgagaatacctgtagactcatcaattca
gaagaagaagataatcaaaacagtgatctcctatttactcctgagacacatgagttttct
tcaggagaggacagcttcattggccgggaattaagtgctaaaacagacacatcttttgtg
tgggagaatggtggaagtgcccatgtggcttacataaacaacagggttaagccacaagga
ttaatgatcacatatgaaaacggtcaggattctgaaggaattgcaagttttacttctgga
cttgaaaaccatggcagaaaagaagaaccaggtgttattaatatacctggagatacctct
cttcaagaatattacatggatgtggctttcctcatagatgcttcccaaagaataggaaat
gatgagtttagggaagtgaaagcttttcttatctcagtgcttgattactttcacattgcc
ccagacccactgacctccatgttaggagacagagtggcagttctgagctattctcctcca
ggctatatgccgaacagtgaagaatgccctgtctacctggaatttgatttgattacttac
aacagcatataccaaatgaaacatcatctccaagactcttttcaacagctcagtggagat
gtttttattggccatgccctgcagtggacaattgacaatgtctttgtaggaactcccaac
ctgaggaaaaacaaagttatctttgttatatctgctggtgaaaccaatcccttagacaag
gaagtcttaagaaatgtagctctgagagccaagtgtcagggctatattatatttgtgttt
tcctttggtcctatacacaatgacaaggaattagaagaattagccagccacccactggat
catcacttagtccagcttggccgaacccacaagccagatttgaactatatcaccaagttt
gtcaagccatttgttcatttaatcagacgtgccatcaacaaatatccccctgcagatctg
agacccaagtgtgttaacatcacctctcccaacccagagaacgttggctcaggaaacact
gtagtccttattcctgaggtgtataaaatagagacaggaaacagtgagctgtttggtgaa
tttggttcccaggagcatcattcctttgtattagggaacaatcctagtaatggttctgag
accgctattgatttgatccagaagttatacatgctcttttcaactggagaactggtgatg
aacgataaggaagaggcacattcagaagaaatgccagctctagcagatggtaaacaacaa
gataaaaaagatggtgaggacacaagatga

KEGG   Vulpes vulpes (red fox): 112932531
Entry
112932531         CDS       T05911                                 

Gene name
COL6A6
Definition
(RefSeq) collagen alpha-6(VI) chain
  KO
K06238  collagen type VI alpha
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04974  Protein digestion and absorption
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112932531 (COL6A6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112932531 (COL6A6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112932531 (COL6A6)
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    112932531 (COL6A6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112932531 (COL6A6)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112932531 (COL6A6)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112932531 (COL6A6)
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   112932531 (COL6A6)
SSDB
Motif
Pfam: VWA VWA_2 Collagen VWA_3 VWA_CoxE Integrin_beta
Other DBs
NCBI-GeneID: 112932531
NCBI-ProteinID: XP_025871291
UniProt: A0A3Q7U0X1
LinkDB
Position
Unknown
AA seq 2268 aa
MKMLLILFLIIICSSVSMNKDSGPEYADVVFLVDSSDHLGTKSFPLVKIFINRMINSLPI
EAHKYRVALAQYSDQLHSEFELGTFKSRNPMLNHLKKNFGFVGGSLRLGQALREAHRTYF
SRPDSGRDKKQFPPILVVLASAESEDDVEEASKALREDGVRIISVGLQSASEQELKAMAT
GQFHFNLRSVRDLGAFAPNMTRIIKEATQYREVATDDILVEVCQGPSVADLVFLLDVSVN
GSQENFDYLKEFLEESVSALDIKENCMRVGLVTYSNETKVINSLSRGVNKSEVLQNIQNL
SPRAGKAYTGAAIRKIRKEVFSARNGSRKNQGVPQIAVLVTHRPSEDNVTKAAVNLRREG
VTIFTMGIEGASDSQLEKIASHPAEQHVSKLKTFSDLAAHNQTFLKKLRNQITHTVSVFS
ERTETLKSGCVDTEEADIYLLIDGSGSTQATDFHEMKTFLSEVVGMFNIAPQKVRVGAVQ
YADSWDLEFEINKYTNKHDLGKAIENIRQMGGNTNTGAALNFTLGLLQKAKKQRGNRVPC
HLVVLTNGMSKDSILEPANRLREELIRVYAIGVKEANQTQLREIAGEDKRVYYVHDFDAL
KDIRNQVVQEICAEEACKEMKADIMFLVDSSGSIGLENFIKMKTFMKNLVSKSQIGADRV
QIGVVQFSDINKEEFQLNRYMSQNEISNAIDRMAHIGETTLTGSALTFVSQYFSPAKGAR
PNVRRFLILITDGEAQDIVKDPAVALRQEGIIIYSVGVFGSNVTQLEEISGRPEMVFYVE
NFDILQHIEDDLVFGICSPREECKRIEVLDVVFVIDSSGSIDHDEYNIMKDFMVDLVKKA
DVGKNQVRFGALKYADDPEVLFYLDDLSTKWEVISVLQKDQPMGGNTYTAEALGFSDHMF
TEARGSRLHKGVPQVLIVITDGESHDADKLNDTAKALRDKGILVLAVGIAGANPVELLAM
AGSSDKYFFVETFGGLKGIFSDVSASVCNSSKVDCEIEKVDLVFLMDGSNSIHPDDFKKM
KEFLASVVQDFDVSVNRVRIGAAQFSHTYRPEFPLGTFIGKKEISFQIENIQQIFGYTHI
GAALREVGDYFRPDMGSRINAGTPQVLLVLTDGQSQDEVAQAAEELRHKGIDIYSVGIGD
VDDQQLIQITGTADKKLTVHNFDELTKVKKRIVRNICTSGGESNCFVDVVVGFDISTHEN
GQTLLEGQSWIETYLQDLLRAISSLNGVSCEVGTETQVSVAFQVTNAVEKYSPKFEIYSE
NILNSLKDVTVKGPSLLNANLLSSLWDAFQNKSAARGKVVLLFSDGLDDDTEKLEQKSDE
LRKEGLNALITVALDGATDSGDLADLLYIEFGKGFEYRTQLTIGMRDLGSRLSKLLVNVA
ERTCCCLFCKCIGGDGTMGDPGPPGKKGSPGFKGSEGYLGEEGVAGDRGASGPMGEQGTK
GCYGAKGPKGNRGLNGQEGEVGESGIGGLNGEPGDSGLPGEKGEKGNEGSQGSPGKRGVS
GDRGSKGQRGDPGVPGFDNTIEGPKGLKGERGRQGRRGWPGPPGTPGSRRKTAAHGRRGH
TGPQGKTGIPGPDGLEGSWGVKGPQGPRGETGVKGEKGGLGSKGPQGPPGRGGEAGSPGH
LGSQGTKGEPGDLGEKGAIGLPGPRGLPGDDGNPGYGSIGRKGAKGQDGFPGESGPKGEM
GDLGGPGETGPKGARGKRISTGLPGEMGSPGEPGPPGRKGVKGARGLASFSMCELIQYVR
DHSPGGHGKPECPVHPTELVFALDQSRDVTKQEFERMKELMSSLVRGVRVRENSCPVGAR
IAILTYTSHARHLVRFSDAYKKQQLLREIEAIPYERSSDSREIGRVMRFISRNVFKRTLP
GSHTRRIATFFSSGQSADAQTIATAAMEFSALDIVPVVIAFSNVPSIKRAFAIDDTGTFQ
VIMVPSGTDYAPALERLQRCTFCYDVCKPDAFCDEAKPPPAQSYMDAAFLLDSSRHVQSA
EFEDMRHFLGALLDHFEISPEPETSVTGDRVALLSHAPPNFLPNTQKSPVKTEFNLTTYN
SKRLMKRHMEQSVQQLNGDAFIGHALQWTLDNIFLNTPNMRRNKVIFVISAGETNHLDRE
TLKKESLRAKCQGYALFVFSLGPAWNDKELEDLASYPLDHHLVQLGRIHKPDHRYSVNFV
KSFVNSIRRAINKYPPISFKMKCNRLTSTDVKQPPRQWRSIVPGPHKTALKEDALQKAKF
FQDKKYLSRVARGSRDIIRNLTRNTFHTFKNGKKVIKTAPKQHDKASA
NT seq 6807 nt   +upstreamnt  +downstreamnt
atgaaaatgctgctgattttattcctcataataatttgttcttctgtctctatgaacaaa
gattctggtcctgagtacgcagatgtcgtgtttctggtggacagctccgatcacctggga
actaagtccttccctcttgtgaaaatcttcatcaacagaatgatcaacagcctccccatc
gaggcccacaagtaccgcgtggccctggcccagtacagcgaccagctccacagtgagttc
gagctgggcacgttcaagagcaggaaccccatgctgaaccacctcaagaagaacttcggc
ttcgttggtggctccctgcgcctaggccaagccctccgggaggcccacaggacctacttc
tccaggcccgacagcgggagggacaagaagcagtttcccccgattctggtggtcctggct
tcggcggagtccgaggatgacgtggaggaggcctcgaaggccctgcgggaagacggggtg
agaatcatctccgtggggctgcagagcgcgtctgagcaggagctgaaggccatggccacg
gggcagtttcatttcaacctgcggtcggtcagggaccttggagcgtttgccccaaacatg
acgcggatcatcaaggaagccacccagtacagggaggtagccaccgatgacattcttgtg
gaagtttgccaaggcccgtctgtggctgacttggtgttcctgttggatgtgtccgtcaac
ggcagccaggagaactttgactatcttaaggaattcctggaagagagtgtatctgccctt
gacataaaggaaaactgcatgagggttggcctggtgacctacagcaatgagacgaaggtg
ataaactccctcagcaggggcgtaaataagtcggaggttctccagaatatacagaacctc
tctccccgggctgggaaggcctacacaggggctgccatcagaaaaatcaggaaggaagtg
ttcagtgcacgcaacggcagtcggaagaatcagggggtgccccagattgcggtgctggtg
acccacaggccctccgaggataatgtgaccaaggcagctgttaacctccggcgcgagggg
gtgaccatcttcaccatgggcatagagggggccagcgacagccagctggagaagatcgcc
tctcaccctgccgagcagcacgtgtccaagctgaaaaccttctccgacctggccgcgcac
aaccagacgttcctgaagaagctgcggaaccagatcacacacaccgtctccgtgttctcg
gagcgcactgaaacgctcaaatccggttgtgtggatactgaagaagcagacatctatctg
ctcattgatggctctggaagcacccaggccacagacttccacgaaatgaagaccttcctg
tccgaggttgtagggatgttcaacattgcaccccaaaaggtgcgggttggggctgttcag
tatgcggacagctgggacctggaatttgagatcaataaatacactaataagcatgacttg
ggaaaggccattgagaacattcggcagatgggtgggaacacaaacacgggtgcagcccta
aatttcacactagggctgttgcaaaaagcaaagaagcaacgaggaaacagagtgccctgt
catcttgttgtcctgacgaatggcatgtccaaggatagcatcttagagcctgcaaacaga
ctgagagaagaactcattcgcgtttatgccatcggggtcaaggaggccaaccaaacacag
ctgcgagaaattgcaggcgaggacaagagggtgtactatgtgcatgactttgatgctttg
aaagacataagaaaccaagttgttcaagaaatctgtgctgaagaagcatgcaaagagatg
aaagcagacatcatgtttctggtggacagttctggcagtataggacttgaaaacttcatc
aaaatgaaaacatttatgaaaaacctggtgagcaaatctcagattggggcagatcgagtg
cagatcggcgtagtccagttcagtgacatcaataaggaggaattccagctcaacagatat
atgtcccaaaatgaaatttcaaatgcaatagaccggatggctcacattggggaaaccact
ttgactggtagtgccctgacctttgtttctcagtacttcagccctgccaaaggggcccgg
cccaatgtcaggaggtttctcatcctcatcactgacggtgaagctcaggacatagtcaag
gacccagcagtagcacttcgacaagaaggcataattatctactctgtgggggtgtttggt
tccaatgtcactcagctcgaggaaatcagtgggaggccagagatggttttttatgttgag
aattttgatattctgcaacacattgaagatgatcttgtttttggaatatgcagcccccgt
gaagaatgcaagcggattgaggttttggatgttgtgtttgtaattgacagttctggaagc
attgaccatgatgaatataatatcatgaaagactttatggttgacttggtgaaaaaagct
gatgttggcaagaatcaagtccgatttggggctctgaagtatgcagatgacccggaggtg
ctgttttatctggatgaccttagcacaaaatgggaggtgatttcggtgctccagaaggac
cagcccatggggggcaatacttacactgctgaggcattaggcttctcagaccacatgttc
accgaagcccgtggcagccgtctgcacaaaggggtcccccaagtcctcattgtgatcact
gatggggaatcccacgatgcagataagctcaatgacacagccaaggccttgagggacaaa
ggcatccttgtcctggctgtggggattgccggtgcaaatcctgtggagctgctagctatg
gcaggatcgagtgataagtacttcttcgtggagacgtttggaggcctgaagggaatattt
tcagatgtgtcagccagtgtatgtaactcttcaaaagtagattgtgaaattgaaaaagta
gatcttgtcttcctcatggatggttcaaatagcattcatccggatgacttcaagaagatg
aaggaattcttggcatctgttgttcaagactttgatgtcagtgtcaacagagtgcgtata
ggtgctgcccagtttagccatacctatcggccagaatttccactaggaactttcataggc
aaaaaggagatctcatttcagattgaaaacatccagcaaatctttggatacacacacatc
ggtgctgcactccgggaggtgggggattacttccggccagacatgggcagccggataaac
gcaggtaccccgcaggtgttgctggtcctcacagatggccagtctcaagacgaggtggct
caggctgctgaagagctgagacacaaaggtatcgacatttattctgtgggcattggggat
gtggatgaccagcagctcattcagatcaccgggactgcagataaaaaactgacggttcat
aactttgatgaactgacaaaggtcaagaaaaggatagttcgcaacatctgtacctcgggg
ggtgagagcaattgttttgtcgatgttgtggtgggatttgacatctcaactcatgagaat
gggcaaactttgctcgaaggtcagtcttggatagaaacctaccttcaagaccttttacgt
gccatcagctccctcaatggggtaagctgtgaggtgggcacagagactcaagttagcgtg
gcttttcaagtgacgaatgctgtggaaaaatattcccccaagtttgagatctatagtgaa
aacatactgaacagcttgaaggatgtaactgttaaaggaccatctctactcaatgcaaat
ctcttgagttctctgtgggatgcatttcagaataaatcagctgctcgaggaaaggtggtt
ctcttattttcagatggattggatgatgacactgaaaagcttgaacaaaaatctgatgaa
cttagaaaagaaggcctgaatgccctcataactgttgccctggatggagccactgattca
ggtgacctggctgatcttctctacattgaattcgggaaagggtttgagtacaggacgcag
ctcaccattggaatgagagaccttgggagccgactgtcaaagctactggttaatgttgct
gaaaggacatgctgctgtttgttctgcaaatgcattggaggggatggcacaatgggagat
cctggaccaccggggaaaaagggatccccaggttttaaaggcagtgagggctatctggga
gaggaaggtgttgctggagacagaggagccagtggaccaatgggagagcaaggtactaag
ggatgctatggcgccaaaggccctaagggaaacaggggactaaatggacaggagggagaa
gttggagaaagcggaattggtggattaaatggagaaccgggtgacagtggtcttcctgga
gaaaaaggagaaaagggtaatgaaggatcccagggaagcccaggaaagcgaggagtttct
ggtgaccgaggctcaaaggggcagcgaggagaccccggagttcctggatttgacaatacc
atagaaggacctaagggcttgaaaggagaacgtggaagacaaggtagaagaggctggcca
ggcccccctggaacaccaggctccagaagaaagacagcagctcatggccgaaggggacat
acaggcccacaggggaaaacaggcatcccaggcccagatggacttgaaggctcatgggga
gttaagggccctcagggtcccagaggagagactggtgtgaaaggcgaaaaaggaggtctg
ggaagtaaaggtcctcaggggcctccaggacgaggaggagaagcagggagtccaggccat
ctgggaagccaaggaactaaaggagaacctggagatttgggagaaaaaggagctattggc
ctcccgggtcctcgaggcttaccgggtgatgatggcaacccaggttatggtagcattgga
aggaaaggagcaaaggggcaagatggatttcctggagaaagtggacctaagggtgagatg
ggggaccttggtggtccaggagaaactggacccaagggagctagaggcaagaggatatcc
actgggcttccgggagagatgggatcccctggggagccaggacctcctggacgcaagggt
gtgaaaggggccagaggattggcttcattttctatgtgtgagctcattcagtatgtacgg
gatcacagccctggcggacatggaaaaccagaatgccccgtgcatcccaccgaattggtg
tttgccttggaccagtctcgggatgtcaccaagcaggaattcgagcgcatgaaggagctg
atgtcttccctggtgagaggcgtccgggtccgggagaacagctgcccggtgggcgcccgc
atcgccatcctcacctacacctctcacgcccggcacctcgtccgcttctcagacgcctac
aagaagcagcagctcctccgggagattgaagctatcccttacgagaggtcctcggacagc
agggagatcggcagagtgatgaggtttatctccaggaatgtcttcaagcgaacgcttcca
ggctctcacaccagaagaatcgccaccttcttcagcagcggtcagtctgcagatgcccag
accattgccactgcagccatggaattcagcgcccttgacatcgttccggtggtcatcgcg
ttcagcaacgtgccctccatcaagcgtgcatttgcaattgatgacactggcacattccaa
gtaataatggttccatccgggactgactacgcgccagcattagagagactacagcggtgt
actttctgctatgatgtatgcaagccagacgctttttgcgatgaagccaaaccaccccct
gcacagtcttacatggatgctgctttccttctggacagctctcggcatgtgcaaagtgct
gaatttgaagacatgagacactttttgggagcactcttagatcactttgagattagccca
gagcctgagacctctgtcactggagaccgggtggccctattaagtcatgctccccccaat
ttcctacccaacactcagaagagtcctgttaaaactgagttcaaccttaccacctacaat
agtaaacgcctcatgaagaggcacatggaacaatcagttcaacaactaaatggagatgct
tttattggtcatgccttacagtggaccctggacaatatctttttaaatacacccaacatg
agaagaaacaaagtcatatttgtcatatctgctggggaaaccaatcacttggacagagaa
accttaaagaaagaatccttaagagccaaatgtcaaggttatgccctatttgtgttttcc
cttggccctgcttggaatgacaaggaactagaagatctagccagctaccctttggatcac
cacttggtccagcttggccgaattcataaacctgaccacagatatagtgtgaattttgtg
aaatcctttgtaaactcaatcaggcgtgcaatcaacaaatatccaccaataagcttcaaa
atgaagtgcaatagactcacctctacagatgtgaagcagcctccacggcagtggagaagc
attgttcctggaccacataaaactgccctcaaagaagatgcattacagaaggcaaagttc
tttcaagataaaaaatatctttcaagagtagcaagaggcagcagagatattattcgaaat
cttaccagaaacacattccatacctttaaaaatggaaaaaaggtgataaaaactgctcca
aaacaacatgataaagcaagtgcttga

KEGG   Vulpes vulpes (red fox): 112932544
Entry
112932544         CDS       T05911                                 

Definition
(RefSeq) collagen alpha-4(VI) chain-like
  KO
K06238  collagen type VI alpha
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04974  Protein digestion and absorption
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112932544
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112932544
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112932544
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    112932544
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112932544
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112932544
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112932544
 Hyaluronan
  Extracellular matrix or blood plasma proteins
   112932544
SSDB
Motif
Pfam: VWA VWA_2 Collagen VWA_3 Kunitz_BPTI VWA_CoxE SRPRB
Other DBs
NCBI-GeneID: 112932544
NCBI-ProteinID: XP_025871312
UniProt: A0A3Q7UDL0
LinkDB
Position
Unknown
AA seq 2350 aa
MAPQPRARGGRQGGKARRTRLSADGSTAGRRTRERRKESSQVYPPRLRDESGPAAPGPAA
TPVCLGAAPHPGNRIPPPRLPAPLRRRSLALGRFYGDGAAKAGLAIVRVWWAGPGLGSAG
AHVIARAPGIGQAKAECSPGRYITRMKTWKTFWEFIFLAASFGFIKSQRIVCREASVGDV
VFLVDTSLNTQDIRSVRNFLYIMVNSFNVSKDSIRVGLAQYGDVPQSEFLLSTYPRKGDV
LKHIQKLQPKSGGHKMGLALQFLLDHHFQATAGSRASQGVPQMAMVISNSPAEDPVQEAA
KALKRAGVLLYTVGVKDAVLAELKEIASSPAEKFTSFVPNFPDLGSHAQKLRQQVCDTLA
KAAQPVDSVFPACREAALADIVFLVDSSTSIGPQNFQKVKNFLYSVILGLDISSDQVRVG
LAQYNDNIYPAFQLNQYPLKSVVLEQIQNLPYRTGDTNTGSALEFIRMHYLTEAAGSRAK
DSVPQIVILVTDGESNDEVQEAANKLKEDGVVVYVVGVNVQDVQELQKIASEPFEKFLFN
IENFNILQDFSGGILQTLCSAVEGKIKEFTQAYADVVFLADTSQNTSQTSFQWMQNFISR
VVGLLDEKGYSGFSPEKLVFKMLKGACPMAIPADLVFLVEEFSRDKQWNFQQVIDFLKTT
VSSLNVHPDGVRIGLAFYSEEPRLEFSLDTFQTPAKMLEHLDKLTYRRRSGRTKTGAALD
FLRNEVFVEERGSRSKQGVLQMAVVITEGFSQDQLSEPASLLRRAGVTIYVVGTHRASES
KDLENIASYPPWKHVISLESFLQLSVVGSKIKNQLCPETVDTSVSISGMGQVPQEDCVHI
QRADIYFLIDGSSSIKDANFLEMKVFMNEAIKRFQIGPDRVQFGVVQYSDGINIQFALSQ
YSSVAELKAAIDDIQQRKGGTMTGEALSRMAQVFVDTARSNVPWYLIIITDGKSEDPVAE
PAEALRGEGVIIYAIGVKNANVMELKEIAKDKTFFTPEFDSLKVIQRDVVQDICSSETCK
NRQADIIFLIDGSESISPNDFEKMKGFVKRMVNQANIGADEIQIGLLQFSSSPQEEFRLN
QYSSKADIHRAISKVVQMNDGTRTGKALTFTLPFFDSSRGGRPNVHQYLIVITDGVAQDD
VAIPAKALRDRNIVIFAIGVGEAKSAQLLQITDDVQKVYYEENFESLQNLEKKILLKVCI
PQECNIDLSVGIDTSTSTRQVQQKLQGLLPGVMQQLALLSNISCSGSGGLNIMFRYLVPG
SNGQLMFDSGFKKYSDEIIKTFLINQTAKNNHMDVDFLQSLGDHTVHLSSAKVKVLLVFT
DGLDDNFQRLKETSELLRSKGLSGLLFVGLEGVHKLEELQELEFGRGFIYNQPLSITLKS
LPNILLKQLDTIVERRCCNIYMKCFGEDGYQGDGGNPGNKGEKGTDGFPGYPGEEGGHGE
RGPQGLPGPRGEEGCPGVRGPKGTRGFSGEKGSPGDEGVDGLVGEQGNRGAPGSSGEKGN
RGNRGLPGPPGWPGERGEPGLRGDPGNPGADSYIQGPKGEKGRRGHQGSSSFDGPQGVPG
NVGPQGPRGRRGMPGLKGVRGESGEQGYQGELGSPGSQGLRGRQGPPGNSGHKGLPGAEG
IPGPPGPAGVKGKAGLTGMKGELGVAGATGPQGPQGLRGQPGLLGPDGYGHPGRKGKKGE
PGFPGFPGAQGEDGDPGHRGEKGAKGIRGRRGNAGFPGLIGTPGDQGPPGPVGIKGPKGL
ADVTPCEIIDVIQEKCPCSAGVSKCPVFPSEVVFALDMSNDVSQSDFERMRNILLSLLMK
MEISDSNCPTGARVAIVSYSAKTDYLIRFSDHKGKPSLLQAVRRIPLQGSSGSRNLGDAM
RFVARHVFKRVRSGLLMRKVAVFFQAGWTHGGDAFSAATLELSALDITSTVITFTEEHNL
PSALWADGTNRFHLFVWETESQQDLEHMAYCTLCYDKCRPSPECVQSVPGPLAGDIDMAF
VVDSSYGVPADVYRTALSLVDAVLEDLEVAAQPGVSHHGSRAALVMHTTPDFWPGAGHPP
VLEGFHLTSYGQKTQMRRYLHEALGHPLQGAPALGHALEWTLEKVLLAAPLPRRMQVLFA
IVASETSSWDQEKLRTLSLEAKCKGITLFVLALGPGVGTHELAELEGVVSLPSEQHLLHL
EGISGPEVAYAQGFTQAFLNLLKSGINQYPSPELIGKCGGPNRGDTLLQPFRPIRRLPKR
QFGLSGFADDLEVLEAADVLVEENRKATMKSVTQQEALENYEKNGYGAERDRQERPARRK
QTGKERNSGTAYGPCSMDPMVGECQDYILKWYYNKERKVCERFWYGSCGGNANRFETKEE
CEAWCVPTPL
NT seq 7053 nt   +upstreamnt  +downstreamnt
atggcgccgcagccccgcgcccgcggagggaggcagggagggaaggcccgacgcaccagg
ctttccgccgacggcagcaccgccgggaggcgcacccgagaacgccgtaaagagagcagc
caagtttatcctccgcggctgagggacgagagcgggcctgcagcgccagggcccgctgcg
acacccgtctgcctcggggccgccccccatccaggcaaccgcattcccccgccccgccta
ccggctccactgcgcaggcgcagcctggccctcgggcgtttctacggagacggggcggca
aaagccgggctcgcgatagtacgtgtgtggtgggcggggcctggcctggggagtgccggc
gcgcacgtgatcgccagggctcccgggattgggcaggcgaaagcagagtgtagtcccggc
cggtacataaccagaatgaagacttggaagacgttttgggagttcatcttccttgcagct
agttttggcttcatcaagtcacagagaattgtctgcagggaggcatctgtgggagatgtt
gtgtttctagtggacaccagcctcaatacccaggatatccgcagtgtgcggaacttcttg
tacatcatggtaaacagcttcaatgtcagcaaagacagcatccgcgtcgggctggctcag
tatggtgatgtgccccagtccgaattcctgctttctacctacccccgcaaaggtgatgtg
ttgaaacacattcaaaaacttcagcctaaatctgggggccacaagatgggcctggccctg
cagttccttctagatcaccacttccaggcaacagcagggagtcgggcaagccagggtgtg
cctcagatggccatggtgatcagcaacagcccagctgaggatcctgtgcaggaagctgcc
aaggcattgaagagggcaggcgtactactttataccgttggtgtcaaagatgcagttttg
gcggagctcaaggagatcgccagcagtcctgcggagaagttcacctcttttgttcccaac
ttccctgatctgggcagtcatgctcagaagctgcggcaacaggtctgtgatactttggca
aaggcagctcaacctgttgacagcgtctttccagcttgcagagaggcagctctggcagat
attgtcttcctagtagatagctcaaccagcattgggccccagaacttccagaaagtgaag
aacttcctttactctgtcatcttggggcttgacatcagcagtgaccaggtccgagtggga
cttgctcagtataatgacaacatctacccagcctttcagctgaaccagtaccctctgaag
agtgtggtcctggagcagattcagaatcttccctaccgtacaggagacacaaacacaggg
agtgccctggagtttatcaggatgcactacttgacagaggcagctggcagccgggccaag
gacagtgttcctcagatagttatcctggtgacagatggggagtcaaatgatgaagtccag
gaggcagccaacaagttaaaagaagatggagttgttgtgtatgtggtaggggtcaatgtc
caggatgtccaggaattgcaaaaaatagccagtgagccatttgagaagtttctcttcaac
atcgaaaacttcaacatccttcaggatttctcaggaggcattcttcagactctctgctca
gcagtagagggtaagataaaagaattcactcaagcttatgcagatgtggtctttcttgct
gacacctcacagaatacatcacagaccagtttccagtggatgcagaatttcatctccaga
gtggttggcctgctggatgagaaggggtattcaggcttctccccagagaagctggtgttc
aaaatgcttaagggagcatgtccaatggccatcccagctgatttagtcttccttgttgag
gaattcagcagggacaagcaatggaatttccaacaagttatcgacttcttaaagaccacc
gtcagctctctaaatgttcatcctgatggtgtgagaattggcttggccttttacagtgag
gaaccacgactggagttttccctggacacatttcagaccccagccaaaatgttggagcat
ttggacaaattaacctaccggagaagaagtggaaggaccaagactggtgctgccttggat
ttcctgagaaatgaggtttttgttgaggagaggggcagccgatccaagcagggtgtgctg
cagatggccgtggtcatcacagaaggcttctcccaagaccagttgtctgagccagcttct
ctcctccgtagggcaggggttaccatctatgtggtaggcacccaccgtgcctcagagagt
aaagacctggaaaatatagcatcatatcctccttggaagcatgtcatctcactggagtcc
tttctacaactctctgttgtgggaagcaagattaagaaccaactctgccctgagactgtg
gacacaagtgtttccatttctgggatgggccaggtcccgcaagaagactgtgtgcacatt
cagagggctgacatttacttcctcatcgatgggtctagcagcatcaaagatgccaatttt
ctcgaaatgaaggtgttcatgaatgaggcaataaagaggttccaaattgggcccgacaga
gtacagtttggagtcgttcagtactcagatggaattaatattcagtttgcccttagccag
tattccagtgtggcagagctgaaagcagccattgatgacatccagcagaggaaaggtggc
accatgactggtgaggccttgagcaggatggctcaggtctttgtggatactgctcgcagc
aatgtgccttggtatctcataatcatcactgacggtaaatctgaagatccagtggctgag
cccgcagaggcactgaggggagaaggagtcatcatttatgctattggagtcaagaatgct
aatgttatggagctcaaggagatagctaaagataagacctttttcacacctgagtttgat
tccttgaaggtcatccaaagagatgtggttcaggacatctgctcttcagagacctgtaag
aataggcaagctgatattatcttcctgatagacggttcagaatccatctccccaaatgac
tttgagaagatgaagggattcgtgaagaggatggtgaaccaagctaatattggtgctgat
gaaattcagattggccttttgcagttcagctcatccccccaggaagaattcaggctcaac
caatactcctcaaaggctgacatccacagagccatctcaaaagttgtgcaaatgaatgat
ggcactcgtactgggaaagccctgacttttactctgcctttttttgacagttcaagagga
gggagacccaatgttcatcagtatttgattgtgatcactgatggggttgcccaggatgac
gtagccataccagccaaggctctcagggacaggaacatcgttatttttgccattggggtg
ggagaagccaaaagtgctcagcttttgcagattactgatgacgtgcagaaagtgtactat
gaagagaattttgagtccctgcagaacttggagaagaaaattcttcttaaggtctgcatt
ccacaagaatgcaacatagatttgtctgtaggaattgatacttccacttccacaaggcaa
gttcagcagaagcttcaagggttactgccaggggtaatgcaacagttggccctgctttcc
aacatcagctgtagtggttctggtggcctcaacatcatgttccgctacttggtccctggt
tcaaatggccagcttatgtttgactcaggctttaagaagtatagtgatgagattattaag
accttcttaattaatcagactgccaagaacaaccatatggatgtggattttttgcagtcc
ctgggagatcatactgtccatctctcttctgctaaagtgaaggtccttctagtgtttaca
gatgggctggatgataatttccagagactgaaggaaacatcagagcttctccgcagcaaa
ggattgtctgggctcctctttgttggcctggaaggtgtgcataaattagaagagctccag
gaactagaatttggcagaggattcatatataatcaacctctgagcatcacactgaaatca
ctcccaaacattttactgaagcaacttgacacaattgtggaaagaagatgctgcaatata
tatatgaagtgttttggagaagatgggtaccagggtgatggcgggaaccctgggaacaag
ggagagaagggtactgatggatttcctggttatcctggtgaagaaggtggacatggagaa
agaggcccccaaggccttcctggaccccgaggtgaggaaggatgcccaggtgtgagagga
cctaagggaacaagaggattttcaggagagaagggaagccctggtgatgaaggtgttgat
ggcttggttggggaacagggtaatcgtggagccccagggtcatctggagaaaaaggaaac
aggggaaatcggggcttgcctggaccgcctggatggcctggagagcgcggagagcctggg
ttaaggggagaccctgggaatcctggagcagatagttacattcaaggccctaagggagaa
aaaggaaggcgtggacaccagggaagttctagttttgatgggcctcagggagtacctgga
aatgttggtcctcaggggccaagaggaagacgaggcatgccagggctaaagggtgtgcgc
ggagaatctggtgaacaaggttaccaaggagagcttggatctccaggctcacagggactg
agaggaaggcaaggaccaccaggaaattctggacacaaaggcttaccgggtgctgagggg
attcctgggcctccagggccagctggtgtgaaaggaaaagctggactaacaggaatgaag
ggagagcttggcgttgcaggagccacaggcccacagggcccacaaggactgagagggcaa
cctggtcttttaggtccagatggatatggacatccgggaagaaaaggaaaaaagggtgaa
cctggatttcctggctttcctggtgcacaaggagaagatggtgacccaggccaccgagga
gagaagggggcaaagggaatcagagggaggaggggtaatgctggctttcctggacttatt
ggaactccaggcgaccaaggccctccaggaccagtgggtatcaagggccccaaaggtttg
gcagatgtgacgccttgtgaaatcattgatgtcatacaagaaaagtgcccttgttcagca
ggtgtttccaaatgcccagtgttccctagtgaagtggtctttgccttggacatgtcgaat
gatgtttcccagtcggattttgagaggatgagaaacattctattgtctctgttgatgaag
atggaaataagtgacagtaactgcccaacgggtgccagagtggccatcgtttcgtacagt
gccaaaacagactacctgattcgcttctcagaccacaaggggaagccctcactcctgcag
gcagtcaggaggatccccctgcaagggtcatctggcagcaggaaccttggggatgccatg
aggtttgtggcaagacatgtattcaaacgtgtgcgctctggacttctcatgaggaaagtg
gctgtgttcttccaggcgggctggactcatggtggggatgcctttagcgctgccactctg
gaactcagtgcgctggatatcacctctacggtcatcaccttcacggaggaacacaacctc
cccagtgccctgtgggcggatggaaccaacagatttcatctgtttgtctgggagactgag
agtcagcaggacctggagcacatggcctactgtaccctctgctatgacaagtgcagacca
tccccagagtgtgttcagagcgtgccaggacccctggcaggggacattgacatggcgttc
gtggtggacagctcctatggcgttccggctgacgtgtaccgcacggccctgagtctagtg
gatgccgtgctcgaggacctagaggtggctgcacagcctggcgtgtcccaccatgggtca
cgtgctgccctggtgatgcacacaaccccagacttctggccgggtgcagggcacccccct
gtactggagggcttccacctgacatcctatggccaaaagacacagatgcggaggtacctt
cacgaggctttgggtcaccctctgcagggagctcccgccctgggacatgccctggagtgg
acgctggagaaggtgctcctggcagcccctctgcccaggcggatgcaggtcctctttgcc
atcgtggccagtgagaccagcagctgggaccaggagaagctaaggactctgtccctggag
gccaagtgcaagggaatcactctatttgtgctggccttgggcccaggcgtgggtacccat
gagctggccgagctagagggtgtggtcagccttccctctgagcagcacctgttgcacctg
gagggaatctcaggcccagaagtagcctatgcccagggattcacacaggctttcctgaac
cttctaaaaagtggaataaaccagtacccatcccctgaactcattggaaaatgtgggggc
ccaaaccgaggggacactctgctacaaccttttaggcctatcaggaggttgcctaagcgc
caatttggcctatctggctttgctgatgatctggaagtacttgaagcagcggatgttttg
gtagaggagaatagaaaagccacaatgaaatctgtaactcagcaagaagcacttgaaaat
tatgaaaagaatggatatggtgctgagagagaccgacaagaaaggcctgcaagacggaaa
caaaccggaaaagaaagaaattcaggcactgcctatggtccttgttccatggatccaatg
gtgggtgagtgccaggattacatcctgaaatggtactacaacaaggagaggaaggtctgt
gaacggttctggtatggaagctgtgggggcaacgctaatcggtttgaaaccaaggaagag
tgtgaggcgtggtgtgtcccaacacccttatag

KEGG   Vulpes vulpes (red fox): 112933126
Entry
112933126         CDS       T05911                                 

Gene name
VTN
Definition
(RefSeq) vitronectin
  KO
K06251  vitronectin
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04610  Complement and coagulation cascades
vvp05165  Human papillomavirus infection
vvp05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112933126 (VTN)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112933126 (VTN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112933126 (VTN)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    112933126 (VTN)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    112933126 (VTN)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112933126 (VTN)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112933126 (VTN)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   112933126 (VTN)
SSDB
Motif
Pfam: Hemopexin Somatomedin_B
Other DBs
NCBI-GeneID: 112933126
NCBI-ProteinID: XP_025871989
UniProt: A0A3Q7T4V3
LinkDB
Position
Unknown
AA seq 464 aa
MAFPRPLLVLALLAWVVLADQESCKGRCTEGFNADRKCQCDELCSYYQSCCEDYVVECKP
QVTRGDVFALPEDEYGVIDYHEGNREQSVLTQLESTTLSPGLQAHSEKHPAQVPIPIPEE
EAPGPGQGTLVLEAPDQDISESAAEEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEKA
VRPGYPKLIQDVWGIEGPIDAAFTRINCQGKTYLFKGSRYWRFEDGVLDPDYPRNISEGF
KGIPDNVDAAFALPARSYSGRERVYFFKGRQYWEYEFQQQPSQEECEGSSLSTVFEHFAL
LQRDSWETFFELLFWNRPSGGAGEPGLISQDWPGLPRQVDAAMAGRIYISGSAPRSWVKK
LNPKRRNRKRYRSRRNRGRGRSRTSQRQSRSAWLSWFSSEESGLGTYNYDDYNMDWLVPA
TCEPIQSVYFFSEDKYYRVNLRTRRVDTVSPPYPRSIAQYWLGC
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggcattccccaggcccctgctggtgctagccctgctggcatgggttgttctggctgac
caagaatcatgcaagggccgctgcacagagggcttcaatgctgacaggaagtgtcagtgc
gacgagctctgctcttactaccagagctgctgcgaggactacgtggtcgagtgcaaaccc
caagtgactcgtggggatgtatttgctctgccagaagatgagtatggggtcattgactat
catgaggggaacagagaacagagtgtcctcacacagctggagagtaccaccctgagccct
ggcctgcaggcccactctgaaaagcatcctgcccaggtacctattccgatccctgaggaa
gaggctccaggacccgggcaggggaccttagtccttgaggcccctgatcaagacatctct
gagtccgcagcagaggaggagctatgtagtgggaaaccctttgatgccttcactgacctc
aagaatggctccctcttcgccttccgagggcagtactgttatgagctggatgaaaaggca
gtgagacctgggtaccccaagcttatccaagatgtctggggcattgagggccccattgat
gcagccttcacccgcatcaactgtcaggggaagacctatctcttcaagggtagtcggtac
tggcgctttgaggatggtgttctggacccagattacccccgcaacatctctgaaggcttc
aagggcattccggacaacgtggacgcagcctttgctctccctgctcgcagctacagtggc
cgggagcgggtctacttcttcaaggggagacagtactgggagtatgagttccagcagcag
cccagtcaggaggagtgtgaaggcagctccctgtccacagtgtttgaacactttgccctg
ctgcagagggacagctgggagaccttctttgagcttctcttctggaacagaccctctggt
ggtgctggagagcccgggctcatcagccaggactggcctggtttgcctaggcaggtggac
gcggccatggctggccgcatctacatctcagggtcggcaccccgatcctgggtcaagaag
ctgaatcctaagcggcgcaaccgtaaacgctaccgttcacgccgtaaccgtggtcgaggc
cgtagccggacctcccagcggcaatcccgctcagcctggctgtcctggttctccagtgag
gagagtggcctaggcacctacaactatgatgactacaacatggactggcttgtgccggcc
acctgtgagcccatccaaagtgtttacttcttctcagaagacaagtactaccgagtcaac
cttcgcacacggcgagtggacactgtgagccctccttacccacgctccatcgcccagtac
tggctaggctgctga

DBGET integrated database retrieval system