KEGG   Vulpes vulpes (red fox): 112907711
Entry
112907711         CDS       T05911                                 

Gene name
ITGA10
Definition
(RefSeq) integrin alpha-10 isoform X1
  KO
K06586  integrin alpha 10
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04810  Regulation of actin cytoskeleton
vvp05165  Human papillomavirus infection
vvp05410  Hypertrophic cardiomyopathy
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112907711 (ITGA10)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112907711 (ITGA10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112907711 (ITGA10)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112907711 (ITGA10)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112907711 (ITGA10)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112907711 (ITGA10)
   05414 Dilated cardiomyopathy
    112907711 (ITGA10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112907711 (ITGA10)
Cell adhesion molecules [BR:vvp04515]
 Integrins
  Integrin alpha subunits
   112907711 (ITGA10)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2
Other DBs
NCBI-GeneID: 112907711
NCBI-ProteinID: XP_025838823
UniProt: A0A3Q7R039
LinkDB
Position
Unknown
AA seq 1165 aa
MELPLIPHLLLPVVFLTGLCSPFNLDVHHPRLFPGPPEAEFGYSVLQHVGGGRRWMLVGA
PWDGPSGDRRGDVYRCPVGGSHSAPCAKGHLGDYPLGNSSHPAVNMHLGMSLLETDNDGG
FMACAPLWSRACGSSVFSSGICARVDASFRPQGSLAPTAQRCPTYMDVVIVLDGSNSIYP
WSEVQTFLRRLVGRLFIDPEQVQVGLVQYGESPVHEWSLGDFRTKEEVVRAARNLSRREG
RETKTAQAILVACTEGFSLSRGGRPEAARLLVVVTDGESHDGEELPAALKACEAGRVTRY
GIAVLGHYLRRQRDPTSFLREIRMIASDPDERFFFNVTDEAALTDIVDALGDRIFGLEGS
HGENESSFGLEMSQIGFSTHRLKDGILFGMVGAYDWGGSVLWLEEGHHLFPPRTALEDEF
PPAFQNHAAYLGYSVSSMLLRGGRRLFLSGAPRFRHRGKVIAFQLKKDGAVRVAQSLQGE
QIGSYFGSELCPLDTDGDGTTNVLLVAAPMFLGPQNKETGRVYVYLVGQQSLLTLQGTLQ
PEPPQDARFGFAMGAIPDLNQDGFADVAVGAPLEDGHHGALYLYHGTQSGIRPRPAQRIA
AISMPQALSYFGRSVDGRLDLDGDDLVDVAVGAQGAAVLLSSRPIVHLGPSLEVTPPAIS
VVQKNCSRRGQEAACLSAALCFQVTSRTPGRWNRRFYLRFTASLDEWTAGARAVFDGSGQ
RLSPRRLQLSVGNVTCEQLHFHVLDTSDYLRPLALTVTFALDNTTKPGPVLDEGSPTSIQ
KLVPFSKDCGPDNECITDLVLRASVDIRGSRRDPFVVRGGRQKVLVSATLENRKENAYNT
SLSLSFSRNLHLASFTSQRDSPVKVECAAPSPHVRLCSVAHPVFRTGAKVTFLLEFEFSC
SSLLSQVLVRLTATSNSLEKNGTLQDNTAQISAYIQYEPHLLFSSESTLHRYEVHPYGTL
PVGPEFKTTLRVQNLGCYVVSGLIISAFLPAVAHGGNYFLSLSQVVTNNASCTVQNLTEP
PQPPVHPEEFQYMNRLNGSNTRCQVVRCHLGRLAKGTEVSVGLLRLVHNEFFRRAKFKSL
TVVSTFELGAKEGSVLRLPEASRWSESLLEVIQTRPVLISLWILIGSVLGGLLLLALLVF
CLWKLGFFTRKKIPEEEKREGKLEQ
NT seq 3498 nt   +upstreamnt  +downstreamnt
atggaactccccctcatccctcacctgcttttgcccgtggtgttcctgaccggtctgtgc
tccccctttaacctggatgtgcatcacccgcgcctcttcccagggccacctgaggcagaa
tttggatatagtgtcttacaacatgtcgggggtggccgtcgatggatgctggtgggcgcc
ccctgggatgggccttcaggagacagaaggggggatgtttatcgctgccctgtcgggggc
tcccacagtgctccatgtgccaaaggccatttgggtgactatccactgggaaattcatct
catcctgctgtgaatatgcacctgggaatgtctctgctagagacagacaacgatggggga
ttcatggcttgtgcccctctctggtctcgtgcttgcggctcctctgtcttcagttctggg
atatgtgcccgcgtagatgcttcattccggccccagggcagcctggcacccaccgcacaa
cgctgtcccacctacatggatgttgtcatcgtcttggatggctccaatagcatctatccc
tggtctgaagttcagactttcctacgaagactggtagggagactgttcattgacccagag
caagtacaggtgggactggtgcagtatggagaaagccctgtgcatgagtggtccctggga
gatttccgaaccaaggaagaagtggtgagggcagcaaggaacctgagtcggcgagaggga
cgagaaacaaagactgcacaagcaatcctggtggcctgcacagaaggattcagtctgtcc
cgtggtggccgaccagaggctgccaggctgctggtggttgtcacggatggagagtcacac
gatggggaggagcttcccgctgcactaaaggcctgtgaggctggaagagtgacccgctat
gggatcgcggtccttggccactatctccggaggcagcgagaccccacttccttcctgcgg
gaaatccgaatgattgccagtgacccagatgagagattcttcttcaatgtcacagatgaa
gctgcactgactgacattgtagatgccctgggagaccggatttttggcctcgaggggtcc
catggagaaaatgaaagctctttcgggctggaaatgtctcagattggtttctccactcat
cggctgaaggatgggattctctttggaatggtgggggcctacgactgggggggctccgta
ttgtggctcgaagagggtcaccatcttttccccccacggacagccctggaagatgagttc
ccccctgctttccagaaccatgcagcctacttgggttactctgtttcctccatgcttttg
cggggtggacgccgcctctttctctcaggagctcctcggtttagacacagaggaaaggtc
atcgctttccagcttaagaaagatggggctgtgagggttgcccagagcctccagggggag
cagattggttcctactttggcagtgagctctgcccactggatacagatggggatggaaca
accaatgtcttacttgtggctgctcccatgttcctgggaccccagaataaggagacgggg
cgtgtttatgtgtatctggtggggcagcagtccttgctgacactccagggcacgcttcag
ccagaacccccccaggatgctcggtttggctttgccatgggtgccattcctgatctgaac
caagatggttttgctgatgtggctgtgggggcgcccctggaggatgggcatcacggagcc
ctgtacctatatcatggcacccagagtggaatcaggccccgtcctgcccagaggattgct
gccatctccatgccacaggccctcagctactttggccgtagtgtggatggccggctggat
ctggatggagatgacctggttgatgtggctgtgggtgcccaaggggcagctgtcctgctc
agctcccggcccattgtccacctgggcccctccctggaagttaccccaccagccatcagt
gtggttcagaagaactgcagccggcgaggccaagaggcagcctgcctttctgcagccctt
tgcttccaagtgacctctcgcactcctggccgctggaatcgccgattctatttgcggttt
acagcatcactagatgagtggacggcaggggcgcgggctgtgtttgatggctctggccag
aggctgtcccctcggaggctccagctcagcgtagggaatgtcacctgtgagcagctgcac
ttccatgtgctggatacctcagattacctccggccactggccttgactgtgacctttgca
ttggacaacaccacgaagccagggcctgtgctggatgagggctcacccacctccatacaa
aagctggtccccttctcaaaggactgtggccctgacaatgaatgcatcacagacctggtg
cttcgagccagtgtagacatcagaggctctaggagggacccattcgtggttcgaggaggt
cggcagaaagtgctggtgtcagcaactctggagaacaggaaggaaaatgcctacaacact
agcctgagtctcagcttctccagaaacctccatctggccagtttcacatctcagagggac
agcccagtgaaggtggagtgtgcagctccttcccctcatgtccggctctgcagtgtggct
caccctgtctttcggactggagccaaggtgaccttcttgctggagtttgagtttagctgc
tcctccctcctgagccaggtccttgtgaggctgactgctacaagcaatagcctggagaaa
aatgggacccttcaagataacacagcccagatctcagcctacattcaatatgagccccac
ctcctgttctccagtgagtccactctgcaccgctatgaggttcacccatatgggaccctc
ccagtgggtcccgaattcaaaaccactcttagggttcagaaccttggctgctatgtggtc
agtggcctcatcatctcagccttccttccagctgtagcccatgggggcaactacttcctg
tcattgtctcaagtcgtcactaacaatgcaagctgcacagtacagaacctgactgagcct
ccacagccccccgtgcacccagaggagtttcagtacatgaacagactgaatgggagcaac
actcggtgtcaggtcgtgaggtgccatcttgggcgactggcaaaggggaccgaggtctct
gttggactattgagactggttcacaatgaatttttccggagggccaaattcaagtctctg
acggtggtcagcacctttgagctgggagctaaggagggcagtgtcctacggctgcctgaa
gcctctcgttggagtgagagcctgctggaggtgattcagacccgccctgtcctcatctcc
ctatggatccttattggcagtgtcctgggagggcttctcctacttgctctccttgtcttc
tgtctttggaagcttggcttctttacccgtaagaaaatccctgaggaagaaaaaagagaa
gggaaattggagcaatga

KEGG   Vulpes vulpes (red fox): 112910659
Entry
112910659         CDS       T05911                                 

Gene name
ITGA2B
Definition
(RefSeq) integrin alpha-IIb
  KO
K06476  integrin alpha 2B
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04015  Rap1 signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04611  Platelet activation
vvp04640  Hematopoietic cell lineage
vvp04810  Regulation of actin cytoskeleton
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05222  Small cell lung cancer
vvp05410  Hypertrophic cardiomyopathy
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
vvp05414  Dilated cardiomyopathy
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    112910659 (ITGA2B)
   04151 PI3K-Akt signaling pathway
    112910659 (ITGA2B)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112910659 (ITGA2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112910659 (ITGA2B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112910659 (ITGA2B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112910659 (ITGA2B)
   04611 Platelet activation
    112910659 (ITGA2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112910659 (ITGA2B)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112910659 (ITGA2B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112910659 (ITGA2B)
   05410 Hypertrophic cardiomyopathy
    112910659 (ITGA2B)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112910659 (ITGA2B)
   05414 Dilated cardiomyopathy
    112910659 (ITGA2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112910659 (ITGA2B)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112910659 (ITGA2B)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112910659 (ITGA2B)
Cell adhesion molecules [BR:vvp04515]
 Integrins
  Integrin alpha subunits
   112910659 (ITGA2B)
CD molecules [BR:vvp04090]
 Proteins
  112910659 (ITGA2B)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 112910659
NCBI-ProteinID: XP_025842677
UniProt: A0A3Q7RAW0
LinkDB
Position
Unknown
AA seq 1080 aa
MVPGPVALSSAYCSASEFQSDKKSLPVVETERKRRELAHSCPGDCERRKMARVVCPLHAL
WLLEWVQLFLGPGAIPLAWALNLDPVQLTFYTGPNGSHFGFSLDFYKDNHGRVAFVVGAP
RTLGHSQEETGGVFLCPWRAEGGQCTSLPFDLNDETRRIGSHTFQTFKSRQGLGASVVSW
NDNIVACAPWQHWNALEKTEEAEKTPVGGCFVAQLRNGHRAEYSPCRDNTMSSVYVKNPF
SEFGSLFWLPFQAGELVLGAPGGYFFLGLLVQASIDNIISSYRPGTLLWHVPFQSFTYDY
SKPEYYDGYRGYSVAVGEFDGNLNTTEYVLGAPTWSCTLGAVEILNEYHQTLHRLHGEQM
ASYFGHSIAVTDVNGDGRQDLLVGAPLFMESRADRKLAEVGRVYLFLQPRGHQALGAPSL
LLTGTQLYGRFGSAIASLGDLDRDGYNDVAVAAPYGGPSSLGQVLVYLGQSEGLSSRPSQ
ILDSPFPAGSGFGFSLRGATDIDDNGYPDLLVGAYGASKVAVYRAQPVVVAKVQLLVQDS
LNPAVKNCILPQTKTPVSCFNIQMCVGATGHNIPQQLPLNAELQLDRQKPRQGRRVLLLN
SQLASSTLHLDLGGRHSPICHTTTAFLRDEADFRDKLSPIVLSLNVSLQPRKDGVAPAIV
LHGDTHVQEQTRIILDCGEDDLCVPQLQLTAIVMGSPLLIGADNVLELQMEAANEGEGAY
EAELAVHLPPGAHYMRAVSNIEGFERLICNQKKENETKIVLCELGNPMKRNARIGITMLV
SVENLEEAGEHVSFWLQIRSKNSQNPNSEAVLLDVPVRAEAHVELRGNSFPASLVVVAEE
DNRENSSESWGPKVEHTYELHNNGPGTVSGLHLHLCFPGESQPSDLLYILDIQPEGGLQC
FPQPSINPFKLDWRQPTPSPSPTSPGYHKRERRQASLPGSSQPSGLQDPVLLSCKSGPHT
VVQCELQEMARGQRAMVKVLAFLQLPSLQQRPLDQFRLQSQAWFNVSSLPYAVPSLSLPS
GETLVQTHLLRALEERDIPIWWVLVGVLGGLLLLMLLVLAMWKGGFFKRNRPPLEEEEEE
NT seq 3243 nt   +upstreamnt  +downstreamnt
atggttccagggcctgtagccctttcctctgcctactgctcagcaagtgagttccagtct
gataagaaaagccttcctgtggtggagactgaaaggaagaggagggagctagcccattcc
tgcccaggagattgtgagagaaggaagatggccagagttgtatgtccacttcatgccctc
tggcttctggagtgggtgcagctgttcttgggacctggtgccatccctctagcctgggcc
ttgaacttggacccagtgcaactcaccttctacacaggccccaatggcagccactttggg
ttttcactggacttctacaaggacaaccatgggagagtggccttcgtggtaggagccccg
cggaccctgggccacagccaggaggagacgggcggcgtattcctgtgcccctggagggcc
gagggtggccagtgcacgtcgctgccctttgacctcaatgacgagacccgacgcataggc
tcccacaccttccaaaccttcaagtcccggcaaggactgggggcgtcggtcgtcagctgg
aacgacaacattgtggcctgcgccccctggcagcactggaacgccctagaaaagaccgag
gaggccgagaagacgcccgtaggtggctgctttgtggctcagctccggaacggccaccgc
gcggagtactcgccgtgtcgggataacaccatgagctcggtttatgtgaaaaatccgttt
agtgagttcggctccctgttttggcttccctttcaggctggagagctggtgcttggggcc
cccggcggctattttttcttaggtctcctggtgcaggcgtctattgacaatatcatctcg
agttaccgcccgggcaccctgttgtggcacgtgcccttccagagcttcacctacgactac
agcaagccagagtactacgacggctaccgggggtactcggtggctgtgggcgagttcgac
gggaatctcaacactacagagtatgtcctcggtgccccgacctggagctgtaccctagga
gcggtggaaattttgaacgagtaccaccagacgctgcacaggctgcacggagagcagatg
gcttcgtattttggacactcgatagccgtcactgatgtcaacggagacgggaggcaagac
ttgctggtgggcgcgccactgttcatggagagccgcgcggaccgcaagctggccgaggtg
gggcgcgtgtacttgttcctgcagcctcgaggtcaccaggcgctgggcgcccccagcctc
ctgctgactggcacacagctctatgggcgattcggctccgccatcgcatctctgggcgac
ctcgaccgggacggttacaacgatgttgcagtggctgccccctacggaggtcccagtagt
ctgggccaagtgctggtgtacctaggtcagagtgaggggctcagctcacgcccctcccag
atcctggacagccccttcccagcaggctctggcttcggcttctccctgcgaggtgccaca
gacatcgatgacaatggatacccagacctactggtaggagcttatggggccagcaaagtg
gctgtgtacagagctcagccagtggtggtggccaaagtccagctgctggtacaagattca
ctgaatcctgctgtgaagaactgtatcctgcctcagaccaagacaccagtgagctgcttt
aacatacagatgtgtgtgggagccactgggcacaacattcctcagcagctgcccctaaat
gccgagctgcagctggaccggcaaaagccccgccagggccggagggtgttactgctaaat
tctcagctggcgagcagcaccctgcatctggacctgggcgggaggcacagccccatctgc
cacaccaccaccgccttcctccgagatgaggccgacttccgggacaagctgagccccatt
gtacttagcttgaatgtgtcgctacagcccaggaaggatggagtagcccctgccatcgtg
ctgcatggagacacccatgtccaggagcagactcgcatcatcctagactgtggggaagat
gacctgtgtgtgccccagctccagctcaccgccatcgtgatgggctccccactcctcatt
ggagctgataatgtactggagctgcagatggaggcggccaatgagggcgagggggcctac
gaagcagagctagctgtgcacctgcccccaggtgcccactacatgcgggccgtcagcaac
attgagggctttgagagactcatttgtaaccagaagaaggagaatgagaccaagatagtg
ctgtgtgagctgggtaaccccatgaagaggaacgcccggataggaatcaccatgttggtg
agtgtggagaacctggaagaggctggggaacatgtgtccttctggctgcaaatcagaagc
aaaaacagccagaatccaaacagtgaggctgtgctgctggatgtgccagtgcgggcagag
gcccatgtggagctaagagggaactcctttccagcctccctggtggtggtggcagaagaa
gacaacagggagaacagctctgagagctggggccccaaagtggagcacacctacgagctt
cacaacaatggccctggtaccgtaagtggcctccacctccacctctgctttcctggggag
tcccagccttctgatctgctctacatcctggacatacaacctgaggggggacttcagtgc
ttcccccagccctctattaaccccttcaagctggactggaggcagcctacccccagccca
tcccccacttccccggggtatcacaagcgggagcgcaggcaggcttccctgccagggtcc
agccagccctctgggcttcaggatccagttctcctgagctgcaagtcggggccgcataca
gtggtgcagtgcgagctgcaggagatggcgcgagggcagcgagccatggtcaaggtgcta
gctttcctgcagctgcccagcctccagcagaggccgctggatcagttcaggctgcaatcg
caagcttggttcaacgtctcctcccttccctacgctgtgccctccctcagcctgcccagt
ggggaaactctggtgcagacacacctgcttcgtgccttggaggagcgggacattcccatc
tggtgggtgctggtaggcgtactcggaggcctgctgttgctcatgctcctggtcctggcc
atgtggaagggaggcttcttcaagcgcaaccggccaccgctagaagaagaggaagaggag
tga

KEGG   Vulpes vulpes (red fox): 112911311
Entry
112911311         CDS       T05911                                 

Gene name
ITGA5
Definition
(RefSeq) integrin alpha-5
  KO
K06484  integrin alpha 5
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04145  Phagosome
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04640  Hematopoietic cell lineage
vvp04810  Regulation of actin cytoskeleton
vvp05100  Bacterial invasion of epithelial cells
vvp05133  Pertussis
vvp05135  Yersinia infection
vvp05165  Human papillomavirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05410  Hypertrophic cardiomyopathy
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112911311 (ITGA5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112911311 (ITGA5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112911311 (ITGA5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112911311 (ITGA5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112911311 (ITGA5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112911311 (ITGA5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    112911311 (ITGA5)
   05205 Proteoglycans in cancer
    112911311 (ITGA5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112911311 (ITGA5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112911311 (ITGA5)
   05414 Dilated cardiomyopathy
    112911311 (ITGA5)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112911311 (ITGA5)
   05133 Pertussis
    112911311 (ITGA5)
   05100 Bacterial invasion of epithelial cells
    112911311 (ITGA5)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112911311 (ITGA5)
   05165 Human papillomavirus infection
    112911311 (ITGA5)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112911311 (ITGA5)
Cell adhesion molecules [BR:vvp04515]
 Integrins
  Integrin alpha subunits
   112911311 (ITGA5)
CD molecules [BR:vvp04090]
 Proteins
  112911311 (ITGA5)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Other DBs
NCBI-GeneID: 112911311
NCBI-ProteinID: XP_025843569
UniProt: A0A3Q7RCE7
LinkDB
Position
Unknown
AA seq 1262 aa
MVGVAAALGPGKAHTPAAARWPPRTSVHKHGKKPREEGHGRPGRGAMGAEEAASETGTRQ
AGPLSVHPFAPYRLPGLNSREGPEPPPPSRLAAATRHHPPPQPSPGQRRAPFGARESHGK
GSKPAGQAAPPLASPRALKSNQGSSPEVREVEAKGQSPLDLRCRAGSRRHPDPLQGSLTP
HVPPDSAPQQAGSPRGEGQGLDLFLARPQVFPPSTEASDTPFLSRGPRGRPAPPLPPLLL
LLLLLPPPPRAAGFNLDAQAPAVLSGPPRSFFGFAVDFYRPGARGVSVLVGAPKANTSQP
GVLQGGAVYLCPWGAGRGHCTPIEFDSKGSRVLESSVSSPDGEEPVEYKSLQWFGATVRA
HGSSILACAPLYSWRTEKEPLSDPVGTCYLSTDNFTRILEYAPCRSDFSWAAGQGYCQGG
FSAEFTKTGRVVLGGPGSYFWQGQILSATQEQIAESYYPEYLINLVQGQLQTRQASSIYD
DSYLGERAGGHLGGAPQEDFVAGVPKGNLTYGYVTILNGSDIRSLYNFSGEQMASYFGYA
VAATDTNGDGLDDLLVGAPLLMERTADGRPQEVGRVYIYLQHPAGMDPTPTLTLTGQDEF
GRFGSSLTPLGDLDQDGYNDVAVGAPFGGETQQGVVLIFPGGPGGPGSQPSQVLLPLWAA
GHTPHFFGSALRGGRDLDGNGYPDLIVGSFGVDKAVVYRGRPIVSTSASLTIFPAMFNPE
ERSCSLEGNPVACINLSFCLNASGKHVPDSIGFTVELQLDWQKQKGGVRRALFLASRQAT
LTQTLLIQNGAREDCREMKVYLRNESEFRDKLSPIHIALNFSLDPRAPVDAHGLRPVLHY
QSKSRIEDKAQILLDCGEDNICVPDLQLEVFGDQNRVYLGDKNSLNLTFHAQNVGEGGAY
EAELRVTAPPEAEYSGLVRNPGNFSSLSCDYFAVNQSRLLVCDLGNPMKAGASIWGGLRF
TVPHLRDTKKTIQFDFQILSKNLNNSQSEVVSFPLSVEASAQVSLNGVSKPEAVLFPASD
WRPREQPQEEGDVGPAVQHVYELINQGPSSISRGVLELSCPRALEGQQLLYVTRVAGLGN
CTSSHPPNPESLELDPEGPQHHRLQRREAPGRGPGSSGPQILKCPEAECFRLRCELGPLH
RQESRSLQLHFRVWAKTFLQREHQPFSLQCEAVYEALRMPYRILPQQLPRRELQVATAVQ
WTKAEGSHGVPLWIIILAILAGLLLLGLLIYILYKLGFFKRSLPYGTAMEKAQLKPPATS
DA
NT seq 3789 nt   +upstreamnt  +downstreamnt
atggtgggggtggcggccgccctggggcccggcaaggcccacaccccagccgcggcccgc
tggccccccaggacgtctgtgcacaagcacggaaagaagcccagagaagaggggcacggg
agaccgggccgcggtgcgatgggggccgaggaggctgcttcagagaccggtacccggcag
gcggggcccctgtctgtccacccctttgctccttaccggctccctggcctgaactcccgg
gaaggcccagagccccctccaccttcccggctggccgccgccacccgccaccacccgccg
ccccagccaagcccaggtcagagacgggcccccttcggagcccgggagagccacggaaag
ggctccaagccagcaggtcaggcagctcctcccctggcctcgccccgggccctgaagtcc
aaccaagggtcaagcccggaggtgagagaggtggaggctaaagggcaaagccccctggac
ctccgctgcagggctggctcccggcgacacccggaccccttgcaggggtcactaaccccc
catgtgcccccagactcagcaccccagcaggctggatctccccgaggggaagggcagggg
ctggacctattcctagcccgcccccaggtttttccccccagcacagaagcttcagacact
cctttcctctccagaggtccccgcgggcgcccggccccgccgctgccgccgctgctgctg
ctgctgctcctgctgccgccaccgccccgggccgcgggcttcaacctggacgcgcaggcc
cccgccgtgctctcggggccgccgcgctccttcttcggcttcgccgtggacttctaccgg
ccgggggcgcgcggggtcagcgtgctggtgggcgcgcccaaggctaacaccagccagccg
ggggtgctgcaggggggtgccgtctacctctgcccctggggcgccggccggggccactgc
acacccattgaatttgacagtaaaggctctcgggtcctggagtcgtcggtgtccagcccg
gacggggaggagcctgtggagtacaagtccttgcagtggttcggagcgacggttcgagcc
cacggctcctccatcctggcctgtgcgcccctgtatagctggcgcacggagaaggagccg
ctgagcgatcccgtgggcacctgctacctctccacggacaatttcacccgaattctggag
tacgcaccttgccgctcagacttcagctgggccgcgggacagggctactgccaagggggc
ttcagtgcggagttcaccaagaccggacgtgtggtcctgggtgggccagggagctacttc
tggcaaggccagatcctgtctgccacgcaggagcagatcgcagagtcctattaccccgag
tatctgatcaacctggttcaggggcagctgcagacccgccaggccagctccatctacgac
gacagctacctgggtgagcgagctggggggcacctcgggggagcccctcaggaagacttt
gtcgctggcgtgcccaaggggaacctcacctacggttacgtcaccatcctcaatggctcg
gacatccggtccctctacaacttctcaggagaacagatggcctcctacttcggctacgcg
gtggctgccacagacaccaacggggacgggctggacgacttgctggtgggggcacctctg
ctcatggagcggacggctgacgggcggcctcaggaggtgggcagggtctacatctacctg
cagcacccagctggcatggaccccacacccaccctgaccctcactggccaagatgaattt
ggccgatttggcagctccttgacgcccctgggggacctggaccaggacggctacaacgac
gtcgccgtcggagcgccctttggcggagagacccagcagggagtggtgcttatcttcccc
gggggccccggggggccgggctctcagccgtcccaggttctgctgcccctgtgggcagcc
ggccacacgccacacttcttcggctcagcgcttcgaggaggccgagacctggacggcaac
ggatacccggatctgattgtgggctccttcggtgtggacaaggctgtggtgtacaggggt
cgccccattgtgtctaccagcgcctccctcaccatcttccccgccatgttcaaccccgag
gagcgcagctgcagcttggaggggaaccccgtggcctgcatcaacctcagcttctgcctc
aacgcttccgggaagcacgttcctgattccatcggcttcacggtggagctccagctggac
tggcagaagcagaaggggggcgttcggcgggcactgttcctggcctccagacaggcgacc
ctgacccagaccctcctcatccagaacggggctcgggaggactgcagagagatgaaggtc
tacctcaggaacgagtccgagttccgcgacaagctgtccccgattcacatcgccctcaac
ttctccctggacccccgagcccccgtggacgcccatggcctccggccagtcttgcattat
cagagcaagagccgcatagaagacaaggctcagatcttgctggactgtggagaagacaac
atctgcgtgccggacctgcagctggaagtgttcggggaccagaaccgcgtgtacctgggc
gacaagaactccttgaacctgactttccatgcccagaacgtgggtgagggcggcgcctat
gaggccgagctgcgggtcacggcccctccagaggccgagtactcaggactcgtcagaaac
ccggggaacttctccagcctgagctgtgactactttgccgtgaaccagagccgcctgctg
gtgtgtgacctgggcaaccccatgaaggccggagcgagtatctggggtggcctccggttc
acggtccctcatctccgggacacgaagaaaaccatccagttcgacttccagattctcagc
aagaatctcaacaactcccaaagcgaagtggtttccttcccgctctcggtggaggcttcc
gcccaggtctcccttaacggggtctccaagcccgaggcagtgctcttcccagcgagcgac
tggcgtccccgagagcagcctcaggaggagggagacgtgggccctgctgtgcagcacgtc
tatgagctcatcaaccagggccccagctccatcagccggggtgtgctggagctcagctgt
ccccgggccctggagggtcagcagcttctctacgtgaccagggttgcaggcctcggcaac
tgcaccagcagtcacccccccaacccagagagcctggagttggatccggagggtccccag
caccaccggctacaaagacgggaagcgccaggccggggcccgggctcctcgggacctcag
atcctgaaatgccccgaggccgagtgcttcaggctgcgctgtgagctggggccgctgcac
cgccaggagagccgaagtctgcagctgcatttccgagtctgggccaagaccttcctgcaa
cgggagcaccagccgttcagcctgcagtgcgaagctgtgtacgaagccctgaggatgccc
taccggatcctgccccagcagcttccccgacgggaacttcaggtggccacggctgtgcag
tggaccaaggcggaaggcagccacggcgtcccgctgtggatcattatcctagccatcctc
gctggcctcctgctcctagggctgctcatctatatcctctacaagctcggattcttcaaa
cgctccctcccatacggcaccgccatggaaaaagctcaactcaagccacctgccacctct
gatgcctga

KEGG   Vulpes vulpes (red fox): 112916402
Entry
112916402         CDS       T05911                                 

Gene name
ITGA6
Definition
(RefSeq) integrin alpha-6 isoform X1
  KO
K06485  integrin alpha 6
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04514  Cell adhesion molecules
vvp04640  Hematopoietic cell lineage
vvp04810  Regulation of actin cytoskeleton
vvp05145  Toxoplasmosis
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05222  Small cell lung cancer
vvp05410  Hypertrophic cardiomyopathy
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112916402 (ITGA6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112916402 (ITGA6)
   04514 Cell adhesion molecules
    112916402 (ITGA6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112916402 (ITGA6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112916402 (ITGA6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112916402 (ITGA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112916402 (ITGA6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112916402 (ITGA6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112916402 (ITGA6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112916402 (ITGA6)
   05414 Dilated cardiomyopathy
    112916402 (ITGA6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112916402 (ITGA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112916402 (ITGA6)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112916402 (ITGA6)
  Exosomal proteins of breast milk
   112916402 (ITGA6)
Cell adhesion molecules [BR:vvp04515]
 Integrins
  Integrin alpha subunits
   112916402 (ITGA6)
CD molecules [BR:vvp04090]
 Proteins
  112916402 (ITGA6)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LRR19-TM DUF4381 FG-GAP_2
Other DBs
NCBI-GeneID: 112916402
NCBI-ProteinID: XP_025849808
UniProt: A0A3Q7S239
LinkDB
Position
Unknown
AA seq 977 aa
MGVTVQSQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSF
CDGRLRGHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFED
GPYEVGGETDHDESLVPVPANSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKR
DMKSAHLLPEYIFDGEGLASSFGYDVAVADLNKDGWQDIVIGAPQYFDRDGEVGGAVYVY
INQQGRWNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDDMGKVFIYHGSP
NGINTKPTQILEGKSPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTVFRSRPVINIQKTV
TITPDTIDLRQKTLCGAPSGICLKVKACFEYTAKPTGYNPSISILGTLEAEKERRKSGLS
SRVQFRNQGSEPRYTQELTLNRQKQKACMEETLWLQENIRDKLRPIPITASVEIQEPNTR
RRVNSLPEILPILNSNEPKTVHREVHFLKEGCGDDNICNSNLKLEYKFCTREGSQDKFSY
LPIQKGVPELVLKDQKDIALEITVTNSPSNPRDPTKDGDDAHEAKLVATFPDTLTYSAYR
ELRAFPEKQLSCVANQNGSQVDCELGNPFKRNSSVTFYLILSTTEVTFDTTDLDINLKLE
TTSNQDNLASITATAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEF
RVINLGKPLKNLGTATLNIQWPKEISNGKWLLYLVKVESKGLERIACEPRGEINFLKLKE
SHNSRRKREIAEKQIEDSRKFSLFAERKYQTLNCSTNVRCVNISCPLRGLDSKASVVLRS
RLWNSTFLEEYSKMNYLDILVRASIDVAAAAENIKLPNAGTQIRVTVFPSKTVAQYSGVP
WWIILVAILAGILMLALLVFILWKCGFFKRSRYDDSVPRYHAVRIRKEEREIKDEKYNDN
LEKKQWITSWNENESYS
NT seq 2934 nt   +upstreamnt  +downstreamnt
atgggggtcaccgtgcagagccaaggtccagggggcaaagttgtgacatgtgctcaccga
tatgaaaaaaggcaacatgtcaatacaaagcaggaatctcgagatatctttggaaggtgt
tatgtcctgagtcagaatctcaggattgaggatgacatggatggaggagactggagtttt
tgcgatggccgattgagaggccatgaaaaatttggttcttgccagcaaggagtagcagct
acttttactaaagacttccattacattgtgtttggagccccgggcacttataactggaaa
ggcattgttcgtgtagagcaaaagaataacactttttttgacatgaacatctttgaagat
gggccttatgaagttggtggagagaccgaccatgacgaaagtctagttcctgttcccgct
aacagttacttaggcttttctttggactcaggaaaaggtattgtctctaaagatgagatc
actttcgtgtctggtgctccaagagccaatcacagtggagctgtggttttgctaaaaaga
gacatgaagtctgcacatcttctccctgagtacatttttgacggggaaggtctggcttca
tcatttggttatgacgtggcagtggcggaccttaacaaagatgggtggcaggatatagtt
attggagccccacagtattttgatagagatggagaagttggaggtgctgtgtatgtttac
attaaccagcaagggaggtggaataatgtcaagccaattcgtcttaatggaaccaaagat
tccatgtttggcattgcagtaaaaaatattggtgatattaatcaagatggctacccagat
attgcagttggagctccttatgatgatatggggaaggtttttatctatcatggatccccg
aacggcataaataccaagccaacacagattcttgagggtaaatccccttattttggatat
tcaattgctggaaatatggaccttgatagaaattcctaccctgatgtcgctgttggctct
ctctcagattcagtaaccgtattcaggtcccggcctgtgattaatattcagaaaacggtc
accataacacctgacacgattgacctccgccagaaaacgttatgtggggcgcctagcggg
atatgcctcaaggtgaaggcctgttttgaatacactgccaaacccacaggttacaatcct
tcgatatcaattttgggcacactggaggctgaaaaggagagaagaaaatctgggctgtca
tcaagagttcagtttcgaaaccaaggctctgagccccggtacactcaggagctgactctg
aacagacagaagcagaaggcctgcatggaggaaaccctgtggctccaggaaaacatcaga
gataaactgcgtcccattcccataactgcttcagtagagatccaagagccaaacacgcgg
aggagagtgaattcacttccagaaattcttccaattctgaattcaaacgaacccaagaca
gttcacagagaggtgcacttcttaaaagagggatgcggagacgacaacatatgtaacagc
aaccttaaactggaatataaattttgtacccgagaaggaagtcaggacaaattttcttat
ttaccaattcaaaaaggtgtcccagaactagttctgaaagaccagaaggacattgcttta
gaaataacggtgacaaacagcccttccaatccaagggaccccacgaaggacggagatgac
gctcacgaagccaaactcgtggcaaccttcccggacactctgacttactcggcgtacaga
gaactgagggctttccctgagaagcagctgagttgtgttgccaaccagaacggctcgcaa
gtggactgtgagcttggaaatccttttaaaagaaattccagcgtgactttttatttgatt
ttaagtacaactgaggtcacctttgacaccacagacctggatattaatctgaagttggaa
acaacaagcaatcaagataatttggcttcaattacagctacggcaaaagtggttatcgaa
ctgcttttatcggtctcaggagttgctaaaccttcccaggtgtattttggaggtacagtt
gtcggtgagcaagctatgaaatctgaagatgaggtgggaagtttgatagagtatgagttc
agggtaattaacttgggtaaacctctgaaaaaccttggcacagcaaccttgaatatccag
tggccaaaagaaattagcaatggaaaatggttgctctatttggtgaaagtcgagtccaaa
ggattggagaggatagcttgtgagccacggggtgagataaacttcctgaaactaaaggag
tctcacaactcaagaaggaaacgggaaattgctgaaaaacagatagaggatagcagaaag
ttttccttatttgctgaaagaaaatatcagacccttaactgcagcacgaatgtgcgctgt
gtgaacataagctgcccgctgcgagggctggacagcaaggcctctgttgttctgcgctcg
aggttatggaacagcacgtttctagaggaatattccaaaatgaactacttggacattctc
gtgcgggcttccattgacgtagccgccgctgccgagaatatcaagctgccgaatgctggc
actcagattcgtgtgactgtgtttccctcaaagaccgtagctcagtattcaggagtacct
tggtggatcatcctagtggctatacttgctgggattttgatgcttgctctcttagtgttt
atactatggaagtgcggattctttaaacgctctaggtacgatgatagcgttccccgatac
catgctgtgaggatccggaaggaagagcgggagatcaaagatgaaaaatacaatgataac
cttgaaaaaaaacagtggatcacaagttggaatgaaaatgaaagctactcttaa

KEGG   Vulpes vulpes (red fox): 112917850
Entry
112917850         CDS       T05911                                 

Gene name
ITGA3
Definition
(RefSeq) integrin alpha-3
  KO
K06482  integrin alpha 3
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04640  Hematopoietic cell lineage
vvp04810  Regulation of actin cytoskeleton
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05222  Small cell lung cancer
vvp05410  Hypertrophic cardiomyopathy
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112917850 (ITGA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112917850 (ITGA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112917850 (ITGA3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112917850 (ITGA3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112917850 (ITGA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112917850 (ITGA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112917850 (ITGA3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112917850 (ITGA3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112917850 (ITGA3)
   05414 Dilated cardiomyopathy
    112917850 (ITGA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112917850 (ITGA3)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112917850 (ITGA3)
Cell adhesion molecules [BR:vvp04515]
 Integrins
  Integrin alpha subunits
   112917850 (ITGA3)
CD molecules [BR:vvp04090]
 Proteins
  112917850 (ITGA3)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2 MTABC_N MLANA
Other DBs
NCBI-GeneID: 112917850
NCBI-ProteinID: XP_025851648
UniProt: A0A3Q7S6Y1
LinkDB
Position
Unknown
AA seq 1030 aa
MVAAGGRVASAFNLDTRFLVVKEARNPGSLFGYSVALHRQTERQRRYLLLAGAPQDLAVP
DGYTNRTGAVYLCPLTAHKNDCERMDISEKSDPDHHIIEDMWLGVTVASQGPAGRVLVCA
HRYTQVLWSGSEDQRRMVGKCYVRGNDLELDPTDDWQTYHNEMCNSNTDYLETGMCQLGT
SGGFTQNTVYFGAPGAYNWKGNSYMIQRKDWDLSEFSYKDPEDQGNLYIGYTVQVGSAIL
HPTDITIVTGAPRHRHMGAVFLLSQEAGRDLRRRQVLEGTQVGAYFGSAIALADLNNDGW
QDILVGAPYYFERKEEVGGAIYVFMNQAGTSFPAHPSLLLHGPSRSAFGFSVASIGDINQ
DGFQDIAVGAPFEGLGKVYIYHSSSRGLLREPQQVIHGEELGLPGLATFGYSLSGQMDVD
ENLYPDLLVGSLSDRIVLLRARPVINILHKTLVARPSVLDPALCTATSCVQVELCFAYNQ
SAGNPNYRRNITLAYTLEADRDRRPPRLRFARSQSAIFHGFFSMPDMHCQKLELLLMDNL
RDKLRPIVISMNYSLPLRMPERPRLGLKSLDPYPVLNQAQALENHTEVHFQKECGQDNKC
DSNLQMQAAFVSELGQPLSRLQYSRDGRKLFLSIEVTNTPSRERAGEDAHEALLTLAVPP
ALLLSSVRPAGMCQANETIVCELGNPFKRNQRMELLIAFEVIGVTLHTRELQAQLQLSTS
SHQDNLWPMTLTLLVDYTLQASLSIMNHRLQSFFGGTVMGESGMKTVEDVGSPLKYEFQV
GPVGEGLAALGTLVLGLEWPYEVINGKWLLYPTEITIHGNGSWPCRPPGDLVNPLNLTLS
VPEDRPPSPQRRRRQLDPGGDQGPPPVTLAAAKKAQSEQKLTCGSDHTRCVWLECPIPDS
PVVTNVTVQARVWNSTFIEDYRDLDRVSVASWATLFLRTSIPTINMENKTVWFSVDIDSD
LVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCGFFKRARTRALYEAKRQKAEMKSQP
SETERLTDDY
NT seq 3093 nt   +upstreamnt  +downstreamnt
atggtggccgccggcggccgcgtcgcctccgccttcaacctggacacccgattcctggtg
gtgaaagaggccaggaacccgggcagcctcttcggctactcggtcgccctccatcggcag
acggagcggcagcggcgctacctgctcctggctggtgctccccaggacctcgctgtgcct
gatggctataccaaccggaccggtgccgtgtacctgtgcccactcactgcccacaagaac
gactgtgagcggatggacatctcagagaaaagtgaccctgaccatcacattattgaggac
atgtggctcggggtgactgtggccagccagggccctgcgggcagagtcctggtctgcgcc
caccgctacacccaggtgctatggtcaggatcggaggaccagcggcgcatggtgggcaag
tgctatgtgcggggcaatgacctcgagctggaccccactgatgattggcagacctaccac
aatgagatgtgtaatagcaacactgactacctggaaacaggcatgtgccagctgggcacc
agtggtggcttcacccagaataccgtgtacttcggtgctcctggtgcctacaactggaaa
ggaaacagctacatgattcagcggaaggactgggatttatccgaatttagttataaggac
ccagaggaccaaggaaacctctatattggatacacggtgcaggtgggcagcgccatcctg
catcccacggacatcaccattgtgacaggtgctccccggcaccgacatatgggtgctgtc
ttcttgttgagccaggaggcaggccgagacctgcggaggaggcaggtgctggagggtacg
caggtgggcgcctattttggcagcgccattgccctggcagacctgaacaatgatgggtgg
caggacatcctggtgggagccccatactactttgagcggaaagaagaggtagggggtgcc
atctatgtcttcatgaaccaggcaggcacctccttccctgcccacccctccctccttctt
catggcccgagtcgctccgcctttggcttctccgtggccagcattggtgacatcaaccag
gatggattccaggacattgctgtgggagccccgttcgagggcttgggcaaagtgtacatc
taccacagcagctccagggggctcctcagagagccgcagcaggtaatccatggggaggag
ctgggactgcctggcttggccacctttggctactcactgagtgggcaaatggatgtggat
gagaacttgtacccagacctgctagtggggagcctgtcagaccgcattgtcctgctgcgg
gcacggcctgtcatcaacatcctccacaagacactggtggccaggccatccgtgctggat
cctgcactctgcacagccacctcctgtgtgcaggtggagctgtgctttgcttacaaccag
agtgctgggaaccccaactacaggcgaaacatcactctggcctacacactggaggccgac
cgggaccgccgcccccctaggcttcgctttgcacgcagccagtcagctatcttccacggc
ttcttctccatgccagacatgcactgccagaagctggaactgctcctgatggacaacctc
cgcgacaaactccgtcccatcgtcatctccatgaactactctctacctttgaggatgcct
gagcgcccccggctggggctgaagtccctggacccctatccggtcctgaaccaggcgcag
gctctggagaaccacaccgaggtccacttccagaaagagtgcggccaggacaacaaatgc
gacagtaacttgcagatgcaggcggccttcgtgtccgagctgggacagccgctgagcagg
ctgcagtacagcagagacggccggaaactgttcctgagcatcgaagtgaccaacaccccg
agcagggagcgtgctggggaagatgcccacgaggcgctgctcaccctggcggtgcctccc
gccctgctgctgtcctcagtgcgccccgctgggatgtgccaggccaatgagaccattgtc
tgtgaactggggaaccccttcaaacggaaccagaggatggagctgctcattgccttcgag
gtcatcggagtgaccctgcacacaagggagctccaggcgcagctgcagctctctacgtca
agtcaccaggacaacctgtggcccatgaccctgactctgctggtggactacacactccag
gcctcactcagcataatgaatcaccggctacaaagtttctttggggggacagtgatgggt
gaatctggcatgaaaactgtggaggatgtgggaagccccctcaagtatgagttccaggtg
ggcccagtaggagaagggctggcagccctggggaccctggtcctagggctggagtggccc
tacgaagtcatcaatggcaagtggctgctgtaccccacagagatcaccatccacggcaat
gggtcctggccctgccgaccacctggagaccttgtcaaccctttgaatctgactctctct
gtccctgaggacagacccccatctccacagcggaggcggagacagctggacccaggggga
gaccagggccccccaccagtcactctggctgctgccaaaaaagcccagtctgagcaaaag
ctgacctgtggcagtgaccacacgcgctgcgtgtggctggagtgtcccattcctgatagt
cctgtcgtcaccaatgtgacagtgcaggcgcgagtctggaatagcaccttcattgaggat
tacagagacttggacagagtcagtgtagccagctgggctaccttgttcctccgaaccagc
attcccaccatcaacatggagaacaagaccgtgtggttctccgtggacattgactctgac
ctggtggaggagctgccagcggagatcgagctgtggctggtgcttgtggctgtgggtgcc
ggactgctgctcctggggctgatcatcctcctgctgtggaagtgcggcttcttcaagcga
gcccgcactcgcgccctgtatgaagctaagaggcagaaggcggagatgaagagccagccg
tcagagacagagaggctgaccgacgactactga

KEGG   Vulpes vulpes (red fox): 112921662
Entry
112921662         CDS       T05911                                 

Gene name
ITGA9
Definition
(RefSeq) integrin alpha-9
  KO
K06585  integrin alpha 9
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04514  Cell adhesion molecules
vvp04810  Regulation of actin cytoskeleton
vvp05165  Human papillomavirus infection
vvp05410  Hypertrophic cardiomyopathy
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112921662 (ITGA9)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112921662 (ITGA9)
   04514 Cell adhesion molecules
    112921662 (ITGA9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112921662 (ITGA9)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112921662 (ITGA9)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112921662 (ITGA9)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112921662 (ITGA9)
   05414 Dilated cardiomyopathy
    112921662 (ITGA9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112921662 (ITGA9)
Cell adhesion molecules [BR:vvp04515]
 Integrins
  Integrin alpha subunits
   112921662 (ITGA9)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha FG-GAP_2
Other DBs
NCBI-GeneID: 112921662
NCBI-ProteinID: XP_025856808
UniProt: A0A3Q7SK41
LinkDB
Position
Unknown
AA seq 934 aa
MARGKNRGMPCGKTCREDRDDEWMGVSLARQPKADGLLLACAHRWKNIYYETDHILPHGF
CYIIPSNLQAKGRTLIPCYEEYKKKYGEEHGSCQAGIAGFFTEELVVMGAPGSFYWAGTV
KVLNLTDNTYFKLNDEVIMNRRYTYLGYAVTAGSFSRPFTTDVVGGAPQDEGIGKVYIFR
ADRRSGTLIKIFQASGKKMGSYFGSSLCAVDLNADGLSDLLVGAPMFSEIRDEGQVTVYI
NRGNGALEEQLALSGDGAYNAHFGESIASLGDLDDDGFPDVAIGAPKEDDFSGAVYIYHG
DAGGIVPQYSMKLSGQKISPVLRMFGQSISGGIDMDGNGYPDVTIGAFMSDSVVLLRARP
IITVDVSIFLPASINITAPQCHDGLQPVNCLNVTACFSFHGKHVPGEIGLNYILTADVAK
KAKGQLPRVYFVLPGESVGQITEKLQLVYMEETCHHYVAHVKRRVQDVISPIVFEAAYSL
GEHVTGEEERELPALTPVLRWKKGQKIAQQNQTVFERNCRSEDCAADLQLQGQLLLSSVD
GKTPYLALGAVKNISLNISISNLGDDAYDANVSFNVSRELFFINMWQKEEMGISCELLES
DFLKCSVGFPFMRSKSKYEFSVIFDTSHLSGEEEVLSFIITAQSGNVERSESLHDNTLML
TVPLMHEVDTSITGIMSPTSFVYGESVEASNFIQLEDLECHFQPLNITLQVYNTGPSTLP
GSSVSITFPNRLSSGGAEMFHVQEMLVGQEKGNCSFQKNPTPCIIPQEQENIFHTIFAFF
TKSGRKVLDCEKPGISCLTIHCNLSALAKEESRTIDIYMLLNTEILKKDSSSVIQFMTRA
KVKVDPALRVVEIANGNPEEMTVVFEALHNLEPRGYVVGWIIAISLLVGILIFLLLAVLL
WKMGFFRRRYKEIIEAEKNRKENEDSWDWVQKNQ
NT seq 2805 nt   +upstreamnt  +downstreamnt
atggctcgagggaagaatcggggcatgccatgtggaaagacctgccgggaagaccgggat
gatgagtggatgggggtgagcctggcccggcagcccaaggctgatggcctattgctggcc
tgtgcccaccgctggaagaacatctactatgaaacagaccacatcctgccccatggcttc
tgttacatcatcccgtccaacctccaggctaaaggcaggacgctgatcccttgctatgaa
gagtataagaagaagtacggcgaggaacacggctcctgccaggctgggatagcaggcttc
ttcactgaggagctggtggtgatgggtgccccaggctcattttattgggccgggacagtc
aaagtgctgaaccttacagacaacacctatttcaaactgaacgatgaagtgatcatgaac
aggcggtacacttacctgggctatgcagtaactgccggctccttctctcgcccgttcacc
accgatgtggtaggaggtgctccacaggatgaaggcattgggaaggtttatatttttaga
gctgatcgaagatcaggcacgttaattaagatttttcaggcatcaggtaaaaagatgggc
tcttacttcggctcctccttatgcgcagttgacttgaacgcagatggcctctctgacctg
ctggtgggggcccccatgttctctgagatcagagatgaggggcaggtcaccgtctacatc
aacagaggaaatggagccctggaggagcaactggccttgagtggtgacggcgcctacaac
gcacactttggggagagcatcgccagcctgggtgaccttgacgacgatgggttcccagat
gtggccattggtgcacccaaggaggacgacttctcaggggccgtctatatctatcatggt
gatgctggcgggatagtccctcagtactcaatgaaactgtctggccagaagataagtcca
gtcctgcggatgtttggtcagtccatatcaggaggcattgatatggatggaaatggctat
cctgatgtaacgattggagccttcatgtctgacagtgtggttcttctgagggcgagaccc
atcattacggtggacgtctccatcttcctcccagcctccatcaacatcacagcccctcag
tgtcacgatgggctgcagcctgtgaactgcctgaacgtcaccgcctgctttagcttccac
ggcaagcatgttccaggagaaattggcctcaattacattctgacggctgatgtggccaaa
aaggcaaagggccagttgcccagagtctactttgtgttaccgggagagtccgtgggtcag
atcacagagaagctgcagctggtctacatggaggagacgtgtcatcactacgtggcccac
gtgaagcggagagtgcaggacgtcatcagccccatcgtgtttgaagccgcctacagcctg
ggtgagcatgtgactggggaggaggagagagaactgccagccctgacaccagtgctccgc
tggaaaaagggacagaagattgcccaacagaatcagacggtctttgagaggaactgccgt
tcagaggactgtgccgccgacctgcagctccaaggtcagctgttgctctccagtgttgat
ggaaaaaccccatatctagctttgggggctgtgaagaatatttccctgaacatctccatc
tcaaaccttggggatgatgcctatgatgccaatgtgtccttcaatgtttcccgggagctc
ttcttcatcaacatgtggcagaaggaggaaatgggcatttcctgtgagctgctggaatca
gacttcctcaaatgcagtgtgggatttcctttcatgaggtcaaaatcgaagtatgaattc
agcgtgatctttgacacaagccacctgtctggggaagaggaagttcttagcttcatcatt
actgctcagagtggcaacgtggaacgctccgagtccctgcacgacaacaccctcatgctg
acagtgccgctgatgcacgaagtggacacgtccatcactggaatcatgtctccaacctcc
tttgtgtatggcgagtctgtggaggcatccaacttcattcagctggaggacctggaatgt
catttccagccgctcaacattacccttcaggtctataacactgggccaagcacccttcct
gggtcgtctgtgagcatcacttttcctaatcgattatcatctggaggtgcagagatgttt
catgttcaggagatgctggtgggccaagagaagggaaactgttctttccagaaaaaccca
accccctgcatcatccctcaggagcaagaaaatatcttccatacaatatttgcctttttc
acaaagtctggaagaaaagtcttggactgtgaaaaaccaggaatttcttgcctaacaatt
cactgtaaccttagtgcacttgctaaagaagaaagtcgtactatagacatttacatgctg
ctgaacacagaaatattgaagaaggacagttcatctgtcatccagtttatgacccgcgcc
aaggtcaaggtggaccctgccctgagggtggtggagatagccaacgggaacccagaagag
atgacggtggtcttcgaagccttgcacaatctggagccccgtggctacgtcgtggggtgg
atcattgccataagtttactggtgggaatccttatcttcctgctgctggctgtgctgctc
tggaagatgggcttctttcgccgaaggtacaaagaaattatcgaggccgagaaaaaccgg
aaggagaacgaagacagttgggactgggtccagaaaaaccagtga

KEGG   Vulpes vulpes (red fox): 112922416
Entry
112922416         CDS       T05911                                 

Gene name
ITGA7
Definition
(RefSeq) integrin alpha-7 isoform X1
  KO
K06583  integrin alpha 7
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04810  Regulation of actin cytoskeleton
vvp05165  Human papillomavirus infection
vvp05410  Hypertrophic cardiomyopathy
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112922416 (ITGA7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112922416 (ITGA7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112922416 (ITGA7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112922416 (ITGA7)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112922416 (ITGA7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112922416 (ITGA7)
   05414 Dilated cardiomyopathy
    112922416 (ITGA7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112922416 (ITGA7)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112922416 (ITGA7)
Cell adhesion molecules [BR:vvp04515]
 Integrins
  Integrin alpha subunits
   112922416 (ITGA7)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS DUF3488 Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 112922416
NCBI-ProteinID: XP_025857793
UniProt: A0A3Q7SML0
LinkDB
Position
Unknown
AA seq 1181 aa
MAGARGRGPWGAPGIRCLLGSLLAALLAPGAVAFNLDVTGALRKEGEPGSLFGFSVALHR
QLQPRPQSWLLVGAPQALALPGQQANRTGGLFACPLSLEETDCYRVDIDRGADMQKESKE
NQWLGVSVRSQGPGGKIVTCAHRYEARQRVDQILETRDVIGRCFVLSQDLAVHDELDGGE
WKFCEGRPQGHEQFGFCQQGTAAAFSPDSHYLLFGAPGTYNWKGTARVELCAQGSVDLAH
LDDGPYEAGGEKEQDPRLIPVPANSYFGLLFVTNIDSSDPDQLVYKTLDPADRLPGPAGD
LALNSYLGFSIDSGKGLVRAEELSFVAGAPRANHKGAVVILRKDSASRLVPEVMLSGERL
TSGFGYSLAVADLNNDGWTDLVVGAPYFFERQEELGGAVYVYLNQGGHWAGVSPLRLCGS
PDSMFGISLAVLGDLNQDGFADIAVGAPFDGDGKVFIYHGSSLGVVVKPSQVLEGEAVGV
KSFGYSLSGGLDVDGNHYPDLLVGSLADTAVLFRARPVLQVSHEVFIAPRAIDLEQPNCA
AGHLVCVDLRVCFSYIATPSSYSPIVALDYVLDGDTDRRLRGQIPRVTFLSRGPDDPKHQ
SSGTVWLKHQHDRVCGDTMFQLQENVKDKLRAIVVTLSYNLQTPRLRRQAPGQGLPAVTP
ILNAHQSSTQRAEIHFLKQGCGEDKVCQSNLQLVRARFCARVSDSEFQPLPMDADGTTAL
FALSGQPVIGLELTVTNLPSDPAQPQADGDDAHEAQLLVTLPASLHYSGVRALDPAEKPL
CVSNENASHVECELGNPMKRGAQVTFYLILSTSGITIETTELEVELLLATISEQELHPIS
VRARVFIELPLSIAGVAVPQQLFFSGVVRGESAMKSERDIGSKVKYEVTVSNQGQSLNTL
GSAFLNIMWPHEIANGKWLLYPMRVELEGGQGPRRKGLCSPRPNILHLDVDSRDRRRREL
EQPKQEEHPEHLEPSTSWWPVSSAEKKKNITLDCARGTANCVVFSCPLYSFDRAAVLHVW
GRLWNSTFLEEYSAVKSLEVTVRANITMKSSIKNLVLRDASTVIPVMVYLDPVAVVAEGV
PWWVILLAVLAGLLVLALLVLLMWKMGFFKRARYPEATVPQYHAVKIPREDRQQFKEEKT
GTILRNNWGSPRREGPDAHPILAADGHPEPGSDGHPMSSTA
NT seq 3546 nt   +upstreamnt  +downstreamnt
atggccggggctcggggccgtggtccctggggggcccccgggatccggtgccttctcggc
tccctgctggccgcgctgctcgccccgggggctgtcgccttcaatctggacgtgacgggc
gccctgcgcaaggagggcgagccggggagcctcttcggcttctcggtggctctgcaccgg
cagctgcagccccgaccccagagctggctgctggtgggtgctccgcaggccctggctctg
cctgggcagcaggcgaatcgcactggaggcctctttgcttgccccctgagcctggaagag
actgactgctacagagtggacatcgaccgtggagctgatatgcagaaggagagcaaggag
aaccagtggttgggagtcagcgttcggagtcagggacctggggggaagattgtcacctgc
gctcaccggtacgaggcgcggcagcgagtggaccagatcctggagaccagggatgtgatc
ggccgctgcttcgtgctgagccaagacctggccgtccacgatgagctggatggcggggag
tggaagttctgtgaggggcgcccccagggccacgaacagtttgggttctgccagcagggc
acagctgccgccttctcccccgacagccactacctcctctttggggcccccggaacctat
aactggaagggcaccgccagggtggagctctgtgcgcagggctcggtggacctggcgcac
ctggacgacgggccctacgaggcggggggagagaaggagcaggacccccgcctcatcccg
gtccctgccaacagctactttgggttgctctttgtgaccaacattgatagctcagaccct
gaccagctggtgtataaaactttggatcccgctgaccggctcccaggaccagccggagac
ttggccctgaatagctacttaggtttctccattgactcggggaagggtctggtgcgtgca
gaggagctgagctttgtggcaggggccccccgtgccaaccacaagggagctgtggtcatt
ctgcgcaaagacagcgccagccgcctggtgcccgaagtcatgctgtctggggagcgcctg
acatctggcttcggctactcactggctgtggccgatctcaacaacgatggctggacagac
ctggtagtgggtgccccctacttctttgagcgccaagaagagctggggggtgctgtctat
gtgtacctgaaccagggaggtcactgggctggggtgtcccctctccggctgtgtggttcc
cctgactccatgttcgggatcagcctggctgtcttgggagacctcaaccaagacggcttt
gcagatattgctgtgggggctccctttgatggggatgggaaagtctttatctaccatggg
agcagcctaggggttgtcgtcaaaccttcccaggtgctggagggtgaggctgtgggtgta
aagagctttggctattccctgtcgggtggcctggatgtggatgggaaccattacccggac
ctgctggttggctccctggccgacactgctgtgctcttcagggccagacccgtccttcag
gtctcccatgaggtcttcattgctccccgagccattgacctggagcagcccaactgcgct
gctggccacttggtctgtgtggacctgagggtctgtttcagctacatcgcaacacccagc
agctacagccctattgtggccctggattatgtgttagatggggacacggacaggaggctc
cggggccagatcccccgtgtgaccttcctgagccgtggcccagacgaccccaagcaccag
tcttcaggcactgtgtggctgaagcaccagcatgaccgagtctgtggagacaccatgttc
cagctacaggagaatgtcaaagacaagcttcgggccattgtggtgactctgtcctacaat
cttcagaccccgcggctccgacgacaggctcctggccaggggctgcccgcagtgaccccc
atcctcaatgctcaccagtccagcacacagcgggcagagatccacttcctgaagcaaggc
tgcggcgaggacaaggtctgccagagcaatctgcagctggtccgggcccggttctgcgcc
cgggtcagcgactcggagttccagcctctgcccatggatgcggacgggacaacagccctg
tttgccctgagtgggcagcccgtcattggcctggagctcacggtcaccaacctgccctcg
gatccagcccagccccaggctgatggggatgatgctcatgaagcccagcttctggtcacc
ctccctgcctctctgcactactcaggagtccgagccctggaccctgcggagaagccgctc
tgcgtgtccaacgagaatgcctcccatgtggagtgcgagctggggaaccccatgaagaga
ggtgctcaggtcactttttacctcatccttagcacctcagggatcactattgagaccaca
gagctggaagtggagctgctgttggccacgatcagtgagcaggagctgcaccccatctcc
gtccgagcgcgtgtcttcattgagctgccactgtccattgcaggggtggctgttccccag
cagctcttcttctctggtgtggtgcgcggtgagagcgccatgaagtctgagcgggatata
ggcagcaaggtcaagtatgaggtcacggtctccaaccaaggccagtcacttaacaccctg
ggctctgccttcctcaacatcatgtggccccatgagattgccaatgggaagtggctgctg
taccccatgcgagtggagctggagggcgggcaggggcccaggcggaagggtctctgttcc
ccaaggcccaacatcctccatctggatgtggacagcagggataggaggcggcgggaactg
gagcagcccaagcaggaggagcatcctgagcatctggagcccagcacatcctggtggcca
gtgtcctctgctgagaagaagaaaaacatcaccctggactgtgcccggggcactgccaac
tgtgtggtgttcagctgccctctatatagctttgaccgcgccgctgtgctgcatgtgtgg
ggccgcctctggaacagcactttcttggaggagtactcagctgtgaagtccctggaagtg
actgtccgagccaatatcaccatgaagtcatctatcaagaacttggtgcttagagatgcc
tccacagtgatcccagtgatggtttacctggaccccgtggctgtggtggcagaaggagtc
ccctggtgggtcatcctcctggctgtgctggcgggactactggtgctggcgctgctggtg
ctgctcatgtggaagatgggattcttcaagcgggcacggtaccccgaggccactgtgccc
cagtaccacgcggtgaagatcccgcgggaagaccggcagcagttcaaggaggagaagaca
ggcaccattctgaggaacaactggggcagcccccgccgggagggccccgatgcacacccc
atcctggctgcagatgggcaccctgagccaggctccgatgggcatcccatgtcaagcacc
gcctag

KEGG   Vulpes vulpes (red fox): 112931084
Entry
112931084         CDS       T05911                                 

Gene name
ITGAV
Definition
(RefSeq) integrin alpha-V
  KO
K06487  integrin alpha V
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04145  Phagosome
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04514  Cell adhesion molecules
vvp04810  Regulation of actin cytoskeleton
vvp04919  Thyroid hormone signaling pathway
vvp05163  Human cytomegalovirus infection
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05222  Small cell lung cancer
vvp05410  Hypertrophic cardiomyopathy
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
vvp05414  Dilated cardiomyopathy
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112931084 (ITGAV)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112931084 (ITGAV)
   04514 Cell adhesion molecules
    112931084 (ITGAV)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112931084 (ITGAV)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112931084 (ITGAV)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112931084 (ITGAV)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    112931084 (ITGAV)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112931084 (ITGAV)
   05205 Proteoglycans in cancer
    112931084 (ITGAV)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112931084 (ITGAV)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112931084 (ITGAV)
   05410 Hypertrophic cardiomyopathy
    112931084 (ITGAV)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112931084 (ITGAV)
   05414 Dilated cardiomyopathy
    112931084 (ITGAV)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    112931084 (ITGAV)
   05165 Human papillomavirus infection
    112931084 (ITGAV)
Membrane trafficking [BR:vvp04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    112931084 (ITGAV)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112931084 (ITGAV)
  Exosomal proteins of epithelial cells
   112931084 (ITGAV)
Cell adhesion molecules [BR:vvp04515]
 Integrins
  Integrin alpha subunits
   112931084 (ITGAV)
CD molecules [BR:vvp04090]
 Proteins
  112931084 (ITGAV)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 112931084
NCBI-ProteinID: XP_025869377
UniProt: A0A3Q7U7V5
LinkDB
Position
Unknown
AA seq 984 aa
MFLLVGAPKANTTQPGIVEGGQVLKCDWSAHRGCQPIEFDATGNRDYAKDDPLEFKSHQW
FGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGAKTVEYAPCRSKNIDADGQG
FCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPKVYSIKYNNQLATRTA
QAIFDDSYLGYSVAVGDFNGDGVDDFVSGVPRAARTLGMVYIYDGKNMSSLHNFTGDQMA
AYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTKLNG
FEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDQKGLVYIFNGRLTGLNAAPSQVLEG
RWAARSMPPSFGYAMKGATDIDRNGYPDLIVGAFGVDRAVLYRARPVITVNAGLEVYPSI
LNQDNKTCPLPGTELKVSCFNVKFCLKADGKGALPTKLNFQVELLLDKLKQKGAIRRALF
LHNRSPGHSKNMTISRGGQMQCEELVAYLRDESEFRDKLTPITVFMEYRLDYRAAADATG
LQPILNQFTPANISRQAHILLDCGEDNICKPKLEVSVDSDQKKIYIGDDNPLTLIVKAQN
QGEGAYEAELIVSIPPQADFIGVVRNSEALARLSCAFKTENQTRQVVCDLGNPMKAGTQL
LAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSYKVDLAVLAAVEIRGVSSPDHI
FLPIPNWEHKENPETEEDVGPVVQHIYELRNNGPSSFSKAMLNLQWPYKYNNNTLLYILQ
YDIDGPMNCTSDMEINPLRIKISDSQTEKNDTVAGQGDRNHVITKRDLTLREGDVHTLGC
GIAECLKIVCQVGRLDRGKSAILYVKSLLWTQTFMNKENQNHSYSLKSSASFNVIEFPYK
NLPIEDIFNSTLVTTNVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMHRMGFFKRV
RPPQEEQEREQLQPHENGEGNSET
NT seq 2955 nt   +upstreamnt  +downstreamnt
atgtttctcctggtgggagcgcccaaagcgaacaccacccagcctgggatcgtggaagga
ggacaagtcctcaagtgtgactggtctgctcaccgcggctgccagccaattgaatttgac
gcaacaggcaatagagattatgccaaggatgatccattggagttcaagtctcaccagtgg
tttggagcatctgtgagatcaaaacaggataagatcttggcctgcgccccgctgtaccac
tggaggactgaaatgaaacaggagagagagcccgtgggaacctgctttcttcaggacgga
gcgaagactgtggagtacgctccgtgcagatcaaaaaatattgatgctgatggacaggga
ttttgtcaaggaggattcagcattgattttaccaaagctgacagagtgcttcttggtggt
cctggtagtttttattggcaaggtcagctcatttcagatcaagtggcagaaatcgtatct
aaatatgaccccaaagtttacagcatcaagtataataaccagttagcaactcggacggct
caagctatttttgatgacagttatttaggttattccgtggctgttggggattttaacggc
gatggcgtagacgactttgtttcaggcgttccgagagcggcaaggactttgggaatggtt
tatatttatgatgggaaaaacatgtcctccttgcacaacttcaccggtgaccagatggct
gcatattttggattttctgttgctgccactgacattaatggggatgattacgcagatgtg
ttcatcggagcgcctctcttcatggatcgtggttctgacggcaaactccaagaggtgggg
caggtttccgtgtctctgcagagagcttcgggagacttccagacgaccaagctgaacggg
ttcgaggtctttgccaggttcggcagtgccatcgcccctctgggcgacctggaccaggat
ggcttcaatgatattgcgattgctgcaccgtacgggggtgaagatcagaagggcctggtt
tatattttcaacggaagactgacgggcttgaacgcagccccgtctcaggtcctggagggc
aggtgggccgctcggagcatgccgcccagcttcggctacgccatgaaaggggccacggac
atagacaggaacggatatccagacttaattgtaggcgcttttggtgtagatagagctgtg
ttatacagagccagaccagttataaccgtcaatgctggccttgaagtataccctagcatt
ttaaatcaagacaataaaacctgcccactccctgggacagagctcaaagtttcctgtttt
aatgtcaagttctgtttaaaggcagatggcaaaggagcacttcccacgaaacttaacttc
caggtggagcttcttttggataaactcaagcaaaaaggagcaattcgacgagcgctattt
ctccataaccggtctccaggtcactctaagaacatgactatttcaaggggaggacagatg
cagtgtgaggaactagtagcatatctgcgggatgaatctgaattcagagacaaactcacc
ccgattaccgtttttatggagtaccggttggattacagagcggctgctgatgcgacaggc
ctgcagcccattctcaaccagttcactcccgccaacatcagtcggcaggcccatattctg
cttgactgcggtgaggacaacatctgcaaacccaaattggaggtttccgtagatagtgat
caaaagaagatctacatcggggacgacaatcctctgaccctgatcgtcaaggcccagaac
caaggggaaggtgcctacgaagctgagctcatcgtgtccatccccccgcaggctgatttc
atcggggtcgtccgcaatagcgaagccttagcgagactttcctgcgcatttaagacggaa
aaccaaacccgccaggtagtatgtgaccttggaaacccaatgaaggctggaactcaactc
ctagctgggcttcgtttcagtgtgcaccagcaatcagagatggatacttctgtgaaattc
gacttacaaatccaaagctccaatctctttgacaaagtaagcccagttgtgtcctacaaa
gttgacctcgctgtcttagctgctgttgagataagaggagtctccagtcctgatcatatc
tttcttccaattccaaactgggagcacaaggagaaccctgagactgaagaagatgttggg
ccagttgttcagcacatctatgagctgagaaacaacggcccaagttcattcagcaaggca
atgctaaatcttcagtggccttacaaatataacaataacactttgttatacatccttcaa
tatgatattgatgggccaatgaactgcacttcggatatggagatcaaccctttgagaatt
aagatctcagattcgcaaaccgaaaagaatgacaccgttgctgggcaaggtgaccggaac
catgtcatcaccaagcgggatctcaccctccgtgaaggagacgttcacactttgggttgt
ggcattgctgagtgcctgaagatcgtctgccaggttggacggctggaccgaggaaagagt
gccatcctgtatgtgaagtccctgctgtggacgcagacctttatgaacaaagaaaaccag
aaccattcatattctctgaagtcatctgcttcttttaatgtcattgaatttccttataag
aaccttccaattgaggatatcttcaactccacattagtcaccactaacgtcacctggggc
atccagcccgcacccatgcccgtgcccgtgtgggtgatcattttagcggttctggcgggg
ttgctgttgctggctgtcctggtgtttgtgatgcacaggatgggcttttttaaacgtgtc
cggccaccgcaggaagagcaagaaagggaacagcttcaacctcatgaaaatggcgaagga
aactcagaaacttaa

KEGG   Vulpes vulpes (red fox): 112931099
Entry
112931099         CDS       T05911                                 

Gene name
ITGA11
Definition
(RefSeq) integrin alpha-11
  KO
K06587  integrin alpha 11
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04810  Regulation of actin cytoskeleton
vvp05165  Human papillomavirus infection
vvp05410  Hypertrophic cardiomyopathy
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112931099 (ITGA11)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112931099 (ITGA11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112931099 (ITGA11)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112931099 (ITGA11)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112931099 (ITGA11)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112931099 (ITGA11)
   05414 Dilated cardiomyopathy
    112931099 (ITGA11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112931099 (ITGA11)
Cell adhesion molecules [BR:vvp04515]
 Integrins
  Integrin alpha subunits
   112931099 (ITGA11)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_2 VCBS Ku_N
Other DBs
NCBI-GeneID: 112931099
NCBI-ProteinID: XP_025869421
UniProt: A0A3Q7TW20
LinkDB
Position
Unknown
AA seq 1164 aa
MDTRKPQIISGSRAAFFGYTVQQHDIGGKKWLVVGAPLETNGHQKTGDVYKCPVTHGNCT
KLNLGRVTLSNVSERKDNMRLGLSLATNPKDNSFLACSPLWSHECGSSYYTTGMCSRVNS
NFRFSKTVAPALQRCQTYMDIVIVLDGSNSIYPWVEVQHFLINILKKFYIGPGQIQVGVV
QYGEDVVHEFHLNDYRSVKDVVEAASHIEQRGGTETRTAFGIEFARSEAFQKGGRKGAKK
VMIVITDGESHDSPDLEKVIQQSERDNVTRYAVAVLGYYNRRGINPEAFLNEIKYIASDP
DDKHFFNVTDEAALKDIVDALGDRIFSLEGTNKNETSFGLEMSQTGFSSHVVEDGILLGA
VGAYDWNGAVLKETSGGKVIPLRESYLKEFPEELKNHGAYLGYTVTSVMSSRQGWVYVAG
APRFNHTGKAILFTMHNNRSLTIHQALRGEQIGSYYGSEITSVDIDSDGVTDVLLVGAPM
YFSEGRERGRVYVYNLRQNRFVYNGTLEDSHGYQNARFGACIAAVRDLNQDSYSDVVVGA
PLEDNHGGAIYIFHGFQASILKTPKQRIAASDLAPGLQYFGCSIHGQLDLNEDGLVDLAV
GALGNAVILWSRPVVQINASLHFEPSKINIFHRDCKRSGRDATCLAAFLCFTPIFLAPHF
EKDTVDIRYNATMDERRYTPRAHLDEGGDRYTNRAVLLSSGQEHCERISFHVLDTADYVK
PVTFWVEYSLEDPDHGPVLDDGWPTTLRVSVPFWNGCNEDEHCVPDLLLDARSDLPTAME
YCQRVLRKPVQDCSTYTLSFDTTVFIIESTRRRVAVEAMLENRGENAYSTVLNISQSTNL
QFASLIQKDDSDGSIECVNEERRLHKKVCNVSYPFFRAKAKVAFRLDFEFSKSVFLHHLE
IRLTTGSDSDEEESTKEDNTALLRFHLKYEADVLFTRSSSLSHYEVKPNSSLEMYDGIGP
PFSCVFKIQNLGLFPIHGVMMKITVPIATRGGNRLLMLRDFLTDQVNTSCNIWGNSTEYR
HTPTEEDLTRAPQLNHSTSDVISINCNVRLAPNQEINFHLLGNLWLRSLKALKYRLMRIT
VNAALQRQFHSPFIFREEDPSRQITFEISKQEDSQIPIWIIVGSTLGGLLLLALLVLALW
KLGFFKSAKRRREPGLDPTPKGLE
NT seq 3495 nt   +upstreamnt  +downstreamnt
atggacaccaggaagcctcaaatcatctctggctctagagctgccttctttggctacacg
gtacagcagcatgacatcggcggcaagaagtggctggtcgtgggcgctccattggaaacc
aatggccaccagaagacgggagatgtgtacaagtgtccagtgacccacgggaactgtacc
aagctcaacctgggaagggtcactctgtctaacgtgtcggagcggaaggacaacatgcgc
ctcggcctgagcctggccaccaaccccaaggacaacagcttcttggcctgcagcccactc
tggtctcacgagtgtgggagttcctactacaccacagggatgtgttcgagagtcaactcc
aacttcaggttctccaagacggtagccccagctctccaaagatgccagacctacatggac
atcgtcattgtcctggatggctccaacagcatctacccctgggtggaggttcaacacttc
ctcatcaacatcctgaagaaattttacattggccctgggcagatccaggttggagttgtc
cagtacggagaagacgtggtgcatgaatttcacctcaatgactacaggtctgtaaaagat
gtagtggaagctgccagccacattgagcagagaggagggacagagacccggacggcattt
ggcatcgaatttgctcgttccgaggctttccagaaaggcggaaggaagggagccaagaag
gtgatgatcgtcataacagatggggagtcccatgacagcccagacctggagaaggtgatc
cagcaaagcgagagagacaacgtgaccagatatgctgtggccgttctgggctactacaac
cgcagggggatcaatccagaagcttttctaaatgagatcaaatacatcgccagtgacccc
gatgacaagcatttcttcaacgtgactgatgaggcggccctgaaggacatcgttgatgcc
ctgggggacaggatcttcagcttggaaggcaccaacaaaaatgagacctccttcgggctg
gagatgtcgcagaccggcttttcgtctcacgtggtggaggacgggattctgctgggagcc
gttggcgcctatgactggaacggggccgtgctgaaggagaccagcggcgggaaggtcatc
cccctccgagagtcctacctgaaggaattccccgaggagctcaagaaccacggtgcctat
ctagggtacaccgtcacgtcggtcatgtcctccaggcaggggtgggtgtatgtggcagga
gcaccccggttcaaccacacaggcaaagccatcctgttcaccatgcacaacaacaggagt
ctcaccatccaccaggccctgcggggtgagcagataggctcctactatgggagtgagatc
acctcggtggacatcgacagcgacggggtgactgatgtcctgctggtgggcgcccccatg
tacttcagcgagggccgagagcggggccgggtgtacgtctacaacctgagacagaaccgg
tttgtttacaacgggacgctggaggattcccacggctatcagaatgcccgattcggggcg
tgcatcgccgcggtccgggacctcaatcaagattcctacagcgacgtggtggtgggagcg
cccctggaggacaaccacggaggagccatctacatcttccacggcttccaggccagcatc
ctaaagacgccgaagcagagaattgcggcctctgacttggctcctggtctccagtatttt
ggctgcagcatccatgggcaactggacctcaatgaggatgggctcgtcgacctggcagtg
ggcgccctgggcaacgctgtgattttgtggtcccgtccggtggttcagatcaatgccagc
ctccactttgagccgtccaagatcaacatcttccacagggattgcaaacgcagcggcagg
gacgccacctgcctggccgccttcctctgcttcacacccattttcctggcacctcatttc
gagaaggacacagtcgacatcaggtacaatgctaccatggatgagaggcggtacacgccg
cgggcccacctggatgagggcggcgaccggtacaccaacagagctgtcctgctctcctcc
ggccaggagcactgtgagcggatcagcttccatgtcctggacactgccgactacgtgaag
ccggtgaccttctgggtggagtactccctggaggaccccgaccatggcccggtgctggac
gacggctggcccaccaccctccgagtctcggtgcccttctggaacggctgcaacgaggat
gagcactgtgtccctgacctcctgctggatgcccgcagtgacctgcccacagccatggag
tactgccagcgagtgctgaggaagcccgtgcaggactgctccacatacaccctgtccttt
gacaccacggttttcatcatcgagagcactcgccgaagggtcgcagtggaggccatgctg
gagaacaggggcgagaatgcctatagcaccgtcctaaatatttcccagtcaacaaacttg
cagtttgccagcttgatccagaaggacgactcagacggcagcatcgagtgcgtgaatgag
gagaggagactccacaagaaagtctgcaatgtcagctaccccttcttccgggccaaggcc
aaggtggctttccggctagattttgagttcagcaaatccgtcttcctgcaccatctggag
atccggctcaccactggcagtgacagtgatgaggaggagagcaccaaggaagacaacacg
gccctcctgcgcttccacctcaaatatgaggctgatgtcctcttcaccaggagcagcagc
ttgagccactacgaggtcaagcccaacagctcactggagatgtacgatggcatcgggcct
cccttcagctgcgtcttcaaaatccaaaacttgggcttgttccccatccatggagtgatg
atgaagatcaccgtccccatcgccaccagggggggcaaccgcctgctgatgctgagggac
ttcctcactgaccaggtgaacacatcctgtaacatctggggaaacagcaccgagtaccgg
cacaccccgacggaggaagacctgacccgggccccacagctgaatcacagcacctctgat
gtcatctccatcaactgcaacgtgaggctggcccccaaccaggaaatcaatttccacctg
ctggggaacctgtggttgaggtccctaaaagcactcaagtacaggttgatgaggatcacg
gtcaatgcggccttgcagagacagttccacagtcccttcatcttccgcgaggaggatccc
agccgccagatcacatttgagatctccaagcaagaagactcgcagatccccatctggatc
attgtgggcagcaccctggggggcctcctgctgctggccctgctggtcctggcactatgg
aagctcggcttctttaaaagtgccaagcgcaggagagagcctggcctggaccccaccccc
aaagggctggagtga

KEGG   Vulpes vulpes (red fox): 112933056
Entry
112933056         CDS       T05911                                 

Gene name
ITGA8
Definition
(RefSeq) integrin alpha-8
  KO
K06584  integrin alpha 8
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04514  Cell adhesion molecules
vvp04810  Regulation of actin cytoskeleton
vvp05165  Human papillomavirus infection
vvp05410  Hypertrophic cardiomyopathy
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112933056 (ITGA8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112933056 (ITGA8)
   04514 Cell adhesion molecules
    112933056 (ITGA8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112933056 (ITGA8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112933056 (ITGA8)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112933056 (ITGA8)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112933056 (ITGA8)
   05414 Dilated cardiomyopathy
    112933056 (ITGA8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112933056 (ITGA8)
Cell adhesion molecules [BR:vvp04515]
 Integrins
  Integrin alpha subunits
   112933056 (ITGA8)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 112933056
NCBI-ProteinID: XP_025871891
UniProt: A0A3Q7U2A0
LinkDB
Position
Unknown
AA seq 1037 aa
PGSRLCPLLPPKRPFSPLAVCIAPPGEELGLSAPLCKTSFSDARASVLVGAPRANTSQPD
IVEGGAVYYCPWPAQGSAQCKQIPFDNTNNRKIRVNGTKEPIEFKSNQWFGATVKAHKGE
VVACAPLYHWRTLKPTPEKDPVGTCYVAIQNFSAYAEYSPCRNSNADPEGQGYCQAGFSL
DFYKNGDLIVGGPGSFYWQGQVITASIADIIANYSFKDILRKLAREKQTDVAPASYDDSY
LGYSVAAGEFTGDSEQELVAGVPRGAQNFGYVSIINSTDMTFIQNFTGKQMASYFGYTVT
VSDVNNDGMDDVLIGAPLFMEREFESSPREVGQVYLYLQENTLVFRDPQILAGTEVFGRF
GSAVAHLGDLNQDGYNDIAIGAPFAGKDQRGQVLIYNGNKDGLNRKPSQILQGMWASQTI
PSGFGFTLRGDSDIDRNDYPDLIVGAFGTGKVAVYRARPVVTVDAQLLLHPMIINLENKT
CQIPESLSSVACFSLSVCASVTGQSISNTIGLTAEVHLDSLKQKGAVKRTLFLDNHESHL
IFPLTIKRQRSLQCQDFVVYLRDETEFRDKLSPINISLNYSLDESTFKEGLEVKPILNYY
RENTVTQQAHILVDCGEDNMCIPDLKLSARPDKHQVIIGDENHLTLIINARNEGEGAYEA
ELFVIIPEEADYVGIERSNKGLRPLSCEYEMENITRMVVCDLGNPMVAGTNYSLGLRFAV
PRLEKTNMSINFDLQIRSSNKDNPDSNFVSLQINITAVAQVEIRGVSHPPQIVLPIHNWE
PEEEPRKEEGIGPLVEHIYELHNIGPSTISNTLLEVGWPFSARDEFLLYIFHVQTLGPLR
CQTNPDINPQDIKPATPPEDTPELSAFLRNSTIPHLVRRRDVGVLEPHRQSPAKILNCTN
IECLQISCAVGQLEGGESAVLKVRSRLWARTFLQRKNDPYTLASLVSFKVKKMPYKDQPA
KLPEGSIAIKTSVIWATPNVSFSIPLWVIILAILLGLLVLAILTLALWKCGFFDRARPPQ
DDMNDREQLTDDKAAEA
NT seq 3114 nt   +upstreamnt  +downstreamnt
ccaggcagccggctctgccctttgcttccccccaagcgccccttctcgcctctcgctgtg
tgcatagctccacctggagaagagttaggactatctgcacccctctgcaaaaccagtttt
tcagacgcccgggccagcgtgttggtgggggcgcccagagccaacaccagccagcccgac
atcgtggaagggggagccgtctattactgcccctggcccgcccaggggtccgcgcagtgc
aagcagataccgtttgacaacaccaacaacagaaaaatcagggttaatggaaccaaggaa
cctatagaatttaaatcaaatcagtggtttggagcaacggtgaaagctcacaaaggagaa
gttgtggcctgtgctcctttatatcactggaggactcttaaaccaacaccagaaaaggac
ccagttggcacctgctatgtagcgatccagaacttcagtgcatatgcagaatattctcct
tgtcggaacagtaatgctgatccagaaggccagggttactgccaagcgggatttagtctg
gatttttataagaatggagacctcatagtaggaggaccgggaagtttctattggcaaggt
caggtgatcactgccagtattgccgatatcattgcaaattactcattcaaggatattcta
aggaaattggctcgagaaaaacagacggacgtggctccagcttcctatgatgacagttac
cttggatattcagttgctgctggggaatttactggagactctgagcaagaactggttgct
ggcgttccaagaggagcacagaattttggatatgtttcaatcattaactctacagatatg
actttcattcagaatttcactggcaaacagatggcatcttattttggatatacggtcaca
gtgtcagatgttaacaatgatggaatggatgacgtattgattggggcacctctctttatg
gaacgtgaatttgagagcagccctcgggaagtagggcaagtttatctgtatttgcaagag
aacacacttgtcttcagggacccacagatcctggccggcactgaggtcttcgggagattc
ggtagtgccgtggctcacttaggagacctgaaccaagatggatacaatgacattgccatt
ggtgcgcccttcgcaggcaaggatcaaagaggccaagtgctcatttacaacgggaacaaa
gatggcttaaacaggaagccttcccaaattctgcagggaatgtgggcctctcagaccatc
ccttcgggcttcggttttaccctaagaggagactcagacatagataggaatgattaccca
gatttaattgtaggtgcattcgggacaggaaaagtagctgtttacagggcaaggccagtt
gtcactgtagacgcccagcttttgctgcacccaatgattatcaatctggaaaataaaaca
tgccagattccagagtctctgtcatctgtggcctgcttctctttaagcgtatgtgcatct
gtaacaggccagagcatttcaaatacaataggcctgactgccgaggtgcacttggactcc
ctgaaacaaaaaggagccgtgaaacgcacgctcttccttgacaaccatgagtcacatctc
attttccccctcaccataaagcggcagagatccctccaatgccaggattttgtcgtttac
cttagagatgaaactgaattccgagataaattatctccaatcaacattagtttgaattac
agtttggacgaatccacctttaaggaaggcctggaagtgaaaccaatattgaattactac
agggaaaacactgttacccaacaggctcacatcctggtggactgtggagaagacaacatg
tgcattcctgacttgaagctctcagctagaccagataagcatcaggtcatcattggagat
gaaaaccatcttacgctcataatcaatgcaagaaatgaaggagaaggtgcctatgaagct
gaactctttgtgataataccagaagaggcagattatgttgggattgaacgcagcaacaag
gggttgcgaccactgagttgtgagtacgagatggaaaatataaccaggatggtggtgtgt
gaccttgggaaccctatggtggctggaacaaattattctctgggcctccgatttgcagtt
ccacgtcttgagaaaacaaacatgagcattaacttcgatctccaaatcagaagttccaac
aaggacaacccagacagcaattttgtgagcctgcaaatcaacatcactgctgtagctcaa
gtagaaataagaggagtatcccaccctccgcagattgttctgcccattcataactgggag
ccagaagaggagccccgcaaagaggaaggaattggtccactggtggaacatatttatgag
ctgcacaatattggaccaagtaccatcagcaacacccttctggaagtgggctggccattc
tctgcccgggacgaatttctcctctacatttttcatgtccaaactctgggacctctacgg
tgtcaaacaaatcctgatattaacccacaggatataaagcccgccacccccccagaggac
acccccgagctgagcgcctttttgcgaaactcaaccatccctcatcttgtccggaggaga
gatgtgggggtgctggagccccacagacagagccccgcaaaaatcctgaattgtacaaat
attgagtgcctacagatctcctgtgcagtggggcagctagaaggaggagaaagcgctgtc
ctaaaagtcagatcacggttatgggccaggacctttctccagagaaaaaatgatccctat
actcttgcatccctggtgtccttcaaagttaagaagatgccttataaagatcagccagca
aaactcccagagggaagcatagcaattaagacatcagttatttgggcaaccccaaatgtt
tccttttcaatcccattatgggtaataatactagcaatacttcttggattattggttctg
gccatcttaaccttagctttatggaagtgtggattctttgacagagcaagacccccccaa
gatgatatgaatgacagggagcaactgacagatgacaaagccgctgaggcatga

KEGG   Vulpes vulpes (red fox): 112933765
Entry
112933765         CDS       T05911                                 

Gene name
ITGA1
Definition
(RefSeq) integrin alpha-1
  KO
K06480  integrin alpha 1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04640  Hematopoietic cell lineage
vvp04810  Regulation of actin cytoskeleton
vvp05165  Human papillomavirus infection
vvp05410  Hypertrophic cardiomyopathy
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112933765 (ITGA1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112933765 (ITGA1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112933765 (ITGA1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112933765 (ITGA1)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112933765 (ITGA1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112933765 (ITGA1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112933765 (ITGA1)
   05414 Dilated cardiomyopathy
    112933765 (ITGA1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112933765 (ITGA1)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112933765 (ITGA1)
Cell adhesion molecules [BR:vvp04515]
 Integrins
  Integrin alpha subunits
   112933765 (ITGA1)
CD molecules [BR:vvp04090]
 Proteins
  112933765 (ITGA1)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 VCBS FG-GAP_2 HisK_sensor LYRIC Integrin_alpha Cation_ATPase_N
Other DBs
NCBI-GeneID: 112933765
NCBI-ProteinID: XP_025872798
UniProt: A0A3Q7TSK9
LinkDB
Position
Unknown
AA seq 1162 aa
LLKVVLGFCVSFNVDVKNSMTFSGPVEDMFGYTVQQYENEEGKWVLIGSPLVGQPKNKTG
DVYKCPVGRGKPLPCIKLDLPVNTSIPNVTEVKENMTFGSTLVTNPNGGFLACGPLYAYR
CGHLHYTTGICSDVSPTFQVVNSIAPVRECSTQLDIVIVLDGSNSIYPWESVTAFLNDLL
ERMDIGPKQTQVGIVQYGENVTHEFNLNKYSSTEEVLVAANQIIQRGGRQTMTALGIDTA
RKEAFTEARGARRGVKKVMVIVTDGESHDNHLLNKVIQDCEDENIQRFSIAILGSYNRGN
LSTEKFVEEIKSIASEPTEKHFFNVSDELALVTIVEALGERIFALEATADQSAASFEMEM
SQTGFSAHYSQDWVMLGAVGAYDWNGTVVMQKANQIIIPHNTTFNVESTKKNEPLASYLG
YTVNSATVSGAVLYIAGQPRYNHTGQVVIYRMDDGDIKILQTLSGEQIGSYFGSVLTTVD
IDKDSNTDILLVGAPMYMGTEKEEQGKVYVYALNQTRFEYQMSLEPIKQTCCSSLKHNSC
TKENKNEPCGARFGTAIAAVRDLNLDGFDDIVIGAPLEDDHGGAVYIYHGSGKTIRKEYA
QRIPSGGDGKTLKFFGQSIHGEMDLNGDGLTDVTIGGLGGAALFWSRDVAVVKVTMNFEP
NKVNIQKKNCRVEGKETVCINATMCFYVKLKSKEDTIYIADMQYRVTLDSLRQISRSFFS
GTQERKIQRNITVEESECTKLSFYMLDKHDFRDSVRITLDFNLTDPENGPVLDDSLPNSV
HEYIPFAKDCGNKEKCISDLALKVSTTEKGLLIVRSHNDKFNVSLTVKNKKDSAYNTRTI
VHYSPNLIFSGIEAIQKDSCESNHNLTCKVGYPFLRRGEEVTFKILFQFNTSYLMENVVI
HLSATSDSEEPPEALSDNEVNISIPVKYEVGLQFYSSASEYHISIAANETVPEVINSTED
IGDEINIFYLIRKSGHFPMPELKLSISFPNLTSDGYPVLYPSGWSSSNNANCRPSSLQDP
LGVNSGKKTIISKSEDLKRGTIPDCSTCKFATITCNLIPSDMSQINVSLIVWKPTFIKAR
FSSLNLTVRADLQSENTSLILSTGNQKREFAIQISKDGLPGRVPLWVILLSAFAGLLLLM
LLILALWKIGFFKRPLKKKMEK
NT seq 3489 nt   +upstreamnt  +downstreamnt
cttcttaaagttgttctaggcttctgcgtatcattcaatgttgatgtgaaaaattcaatg
actttcagtggccccgtggaagacatgtttggatatactgttcaacaatatgaaaatgaa
gaaggaaaatgggtgctaattggttcccctttagttggtcaacccaagaacaaaactgga
gatgtctataagtgtccagttgggagaggcaaaccattaccttgcataaagttggatcta
ccagttaacacatcaattcccaatgtcacggaagtaaaggagaacatgacatttggatca
actttagtcaccaacccaaatggagggtttctggcatgtggccccttatatgcatataga
tgtggacatttgcattacacaactggaatctgttctgatgtcagccccacatttcaagtc
gtgaactccattgctcctgtacgagaatgcagtacccagctggacatagtcatagtgctg
gatggctccaacagtatttacccttgggaaagtgttacagcttttttaaatgaccttctt
gaaagaatggatattggtcccaaacagacacaggttggaattgtacagtatggagaaaat
gtaacccatgagttcaacctcaataagtactcatcaacagaagaagtacttgttgcagca
aatcaaataatccagagaggtggccgccagactatgacagcccttggaatagacacagcc
aggaaggaagctttcactgaagcccggggtgcccgaaggggagttaaaaaagtcatggta
attgtgactgatggggagtcccatgacaaccatctactgaataaagtcatccaagactgt
gaggatgaaaacattcagcggttttccatagctattcttgggagctataacagaggaaat
ctaagcactgaaaaatttgtggaagaaataaaatcaattgcaagtgaacccaccgagaag
catttcttcaatgtctctgatgaattggctctagtcactattgttgaagctctgggagaa
agaatatttgccttggaagctacagctgaccagtcagcagcttcgtttgaaatggaaatg
tctcagacgggcttcagtgctcattattcacaggactgggtcatgcttggagcagtagga
gcctatgattggaatggaactgtcgtcatgcaaaaggctaatcaaatcataatcccccac
aacacaacctttaatgttgagtctaccaaaaagaatgaacctcttgcttcttatttaggc
tacacagtgaactctgccactgtttctggagctgtgctgtacattgctggacagccacgg
tataatcatacaggccaggttgtcatctacaggatggacgatggagacattaagattctc
cagacgctcagtggagaacagatcggttcctattttggcagtgttttaacaacagttgac
attgataaagattctaacactgacattcttctggtcggggctcccatgtacatgggaacg
gagaaagaggaacaaggaaaagtgtatgtgtatgctctgaatcagacaaggtttgaatat
caaatgagcctggaacccattaagcagacttgctgctcatctctaaagcataattcatgc
acaaaagaaaacaaaaatgagccatgtggggctcgtttcggaacagctattgctgctgtg
agagacctcaatcttgatggatttgatgacattgtgattggagctcccctggaagatgat
catgggggagctgtgtacatttatcatgggagtggcaagactataaggaaagagtatgcg
caacgtattccatcaggtggagatggcaagacactaaaattttttggccagtctatccat
ggagaaatggatttaaatggtgatggtctgactgatgtgactattgggggccttggtggt
gctgccctcttctggtcccgagatgtggctgtggttaaagtgactatgaattttgaaccc
aataaagtgaatatccaaaagaaaaactgccgcgtggaaggaaaggaaacagtatgcata
aatgctacaatgtgtttttatgtgaaattaaagtccaaagaagacacaatttacatagct
gatatgcagtaccgtgtcacactagattcactaagacagatatcacgaagctttttctct
ggaactcaagaaagaaagattcaaagaaacatcacagttgaagaatcagaatgcactaag
ctttccttctacatgttggacaagcatgactttcgggactctgtaaggataactttggat
tttaaccttaccgatccagaaaatgggcctgttcttgatgattctctaccaaattcagta
catgaatatattccctttgccaaagattgtggaaacaaggaaaaatgtatctcggacctc
gccctgaaagtatccaccacagaaaaaggcctgcttattgtcaggtcccataacgataag
ttcaatgttagtctcacagtcaaaaacaaaaaggacagcgcctataacaccagaaccata
gtgcactattctccaaatctaattttttcaggaattgaggctatccaaaaagacagttgt
gaatccaatcataatctcacatgtaaagttggatatcctttcctgagaagaggagaagag
gttactttcaaaatattatttcagtttaatacatcttatctcatggaaaatgtggtcatt
catttaagtgcaacaagtgacagtgaagaacctcctgaagccctttctgataatgaagta
aacatttctatcccagtaaaatatgaagttggacttcagttttacagctctgcaagtgaa
taccatatttcaattgcggccaatgagactgtccctgaagttattaattctactgaggac
attggagatgaaattaatatcttctacttgattagaaagagtggacattttccgatgcca
gaacttaagctgtcaatttcatttcccaacttgacatcagatggttatcctgtgctatac
ccaagtggatggtcatcttctaataatgcaaactgcagacccagtagtcttcaggaccct
cttggtgtcaactctgggaagaaaacgattatatccaaatctgaagatctcaaacgaggc
acaattccggactgcagtacatgtaaatttgctactattacatgtaatttgattccttct
gacatgagccaaatcaatgtttcacttatcgtatggaaaccaacttttataaaagcacgt
ttttccagcttaaatcttactgtaagagcagaccttcaaagtgaaaatacatccctgatt
ttaagtactggcaatcaaaaaagagaatttgccattcaaatatccaaagatgggctgcca
ggcagagtgccattatgggtcatcctgttgagtgcctttgctggattattgctattaatg
ctgcttatattagcactgtggaagattggattcttcaaaagaccactaaagaagaaaatg
gagaaatga

KEGG   Vulpes vulpes (red fox): 112933797
Entry
112933797         CDS       T05911                                 

Gene name
ITGA2
Definition
(RefSeq) integrin alpha-2
  KO
K06481  integrin alpha 2
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04145  Phagosome
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04611  Platelet activation
vvp04640  Hematopoietic cell lineage
vvp04810  Regulation of actin cytoskeleton
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05222  Small cell lung cancer
vvp05410  Hypertrophic cardiomyopathy
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112933797 (ITGA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112933797 (ITGA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112933797 (ITGA2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112933797 (ITGA2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112933797 (ITGA2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112933797 (ITGA2)
   04611 Platelet activation
    112933797 (ITGA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112933797 (ITGA2)
   05205 Proteoglycans in cancer
    112933797 (ITGA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112933797 (ITGA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112933797 (ITGA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112933797 (ITGA2)
   05414 Dilated cardiomyopathy
    112933797 (ITGA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112933797 (ITGA2)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112933797 (ITGA2)
  Exosomal proteins of bladder cancer cells
   112933797 (ITGA2)
Cell adhesion molecules [BR:vvp04515]
 Integrins
  Integrin alpha subunits
   112933797 (ITGA2)
CD molecules [BR:vvp04090]
 Proteins
  112933797 (ITGA2)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 VCBS Integrin_alpha HisK_sensor
Other DBs
NCBI-GeneID: 112933797
NCBI-ProteinID: XP_025872832
UniProt: A0A3Q7UHZ6
LinkDB
Position
Unknown
AA seq 1226 aa
MEFAVGRIILEQVHHVVEINEEVIDGDSIHFARVNSSPGDQAPGRARSVHSALHQRVCRQ
AGPAPAGILNCCMAYNVGLLEAKIFSGPSSEQFGYAVQQFINPKGNWLLVGSPWSGFPEN
RMGDVYKCPVDLSAATCEKLNLETATSIPNVTEMKTNMSLGLTLTRNMGTGGFLTCGPLW
AQQCGSQYYATGVCSDVSPDFQILTSFAPAVQTCPSLIDVVVVCDESNSIYPWEAVKNFL
EKFVQGLDIGPKKTQVGLIQYANKPRVVFNLNTFKTKAEMIEATSQTYQYGGDLTNTFKA
IQYAKDFAYAAAAGGRPGATKVMVVVTDGESHDGSMLKAVIDQCNNDNILRFGIAVLGYL
NRNALDTKNLIKEIKAIASIPTERYFFNVSDEAALLEKAGTLGEQIFSIEGTIQGGDNFQ
MEMSQVGFSADYSPQKDILMLGAVGAYGWSGTVVQQTSHGHFIFPKQAFDQILQDKNHSS
YLGYSVAMISTGKDIHFVAGAPRANYTGQIVLYSVDENGNVTVIQAHRGDQIGSYFGSVL
CSVDVNKDTITDVLLVGAPMYMNDLKKEEGKVYLFTITKGILNWHQFLEGPNGVENARFG
SAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGHKGTIRMRYSQKILGSNGAFRSQL
QYFGRSLDGYGDLNGDSITDVSIGAFGQVVQLWSQSIADVSVDASFTPDKITLFNKNADI
TLKLCFSAKFRPTKQNDQVAIIYNITIDANLYSSRVTSRGLFKENNERCLQKNMLISQAQ
SCAEYTINIQKPSDVVNSLDLYVNISLEHPGTSPALEAYSEKAKVFSIPFYKDCGDDGVC
ISDLVLNVQHLSTAQDQPFIVSNQNRRLTFSITLKNKRESAYNTRIVVDFSENLFFASWS
MPVDGTEVTCQIASSQKTVTCDVGYPALKREQQVTFTINFDFNLQNLQNQASVSFQALSE
SYEENKADNLVNFKIPLRYDADIHITRSTNINFYEVSSEGNVPSIVHSYEDIGPKFIFSI
KVTTGSVPVSMASVIIHIPQYTKEKNPLMYLTEVHTDQAGDISCNAKINPLKIGHTSPSV
SFKNENFRHMKDLNCRTASCSNVTCWLKDLQVKGEYFLNVSTRIWNGTFAASTFQTVQLT
ASAEIDTYNPQIYVIEENTVTIPITIMKPHEKAEVPTGVIIGSVIAGIILLLALVAVLWK
LGFFKRKYEKMSKNADEIDETTELNS
NT seq 3681 nt   +upstreamnt  +downstreamnt
atggaatttgctgtgggtagaatcatactggaacaggtacaccatgtagttgagatcaat
gaagaggtcattgatggcgacagtatccactttgccagagttaacagcagccctggtgac
caggcgcctggtagggcccgatccgtccactccgcccttcaccagcgtgtctgccgccag
gctggccctgcgccagcaggcattttaaattgttgtatggcatacaatgttggtctccta
gaagcaaagatattttccggtccttcaagtgaacagtttggctatgcagtccagcagttt
ataaatccaaaaggcaactggttactggttggttcaccttggagtggctttcctgaaaac
cgaatgggagatgtgtataaatgtcctgttgatttgtccgctgctacatgtgaaaaactg
aatttggaaactgccacaagcattcccaatgttaccgaaatgaaaaccaacatgagcctt
ggcttgacactcacaaggaacatgggaaccggaggatttcttacatgtggtcccctgtgg
gcacagcagtgtggaagccaatactacgccaccggtgtttgttctgatgtcagtcccgat
tttcagatcttgaccagctttgcacctgcagtccagacttgcccttccctcatagatgtt
gtggttgtatgtgatgaatcaaacagtatctatccctgggaagcagtaaagaattttttg
gaaaaatttgtccaaggcctggatataggccccaaaaaaacacaggtggggttaattcag
tatgccaacaaaccaagagttgtatttaacctgaacactttcaaaaccaaagctgaaatg
attgaagcaacatcccagacataccaatatggcggagacctcacaaatacattcaaagca
attcaatatgcaaaagattttgcttatgcagcagctgctggaggacgaccaggtgccacc
aaagtaatggtggttgtaactgatggtgaatcacatgatggttcaatgttgaaagcggtg
attgatcaatgcaacaatgacaatatactgaggtttggcatagcagttcttgggtactta
aacagaaatgcccttgatactaagaatttaataaaagaaattaaagcaattgccagtatt
ccaacagaaagatattttttcaatgtgtctgatgaagcagctctattagaaaaggctgga
acactgggagaacaaatttttagcattgaaggtactattcaaggaggagacaacttccag
atggaaatgtcacaagtgggattcagtgcagattactctcctcaaaaggatattctgatg
ctgggtgcagtaggagcttatggctggagcgggactgttgtccaacagacatctcatgga
cattttatctttcctaaacaagcctttgaccaaattctgcaagataaaaatcacagttca
tatttaggttactcggtggctatgatttctactggaaaagacatccactttgttgctggt
gctcctcgggcaaattatactggccagatagtgctatacagtgttgatgagaatggcaat
gtcacagttattcaggctcaccgaggtgaccagattggctcctattttggcagtgtgctg
tgctcggtcgatgtgaataaagacaccattacagatgtactcttggtgggtgcaccaatg
tacatgaatgacctaaagaaagaagaaggaaaagtctacctgtttactatcacaaagggc
attttgaattggcaccagtttctcgaaggccccaatggtgttgaaaatgctcggtttggt
tcagcaattgcagctctttcagatatcaatatggatggctttaatgatgtaatagttggt
tcgcctttggaaaatcagaactctggggctgtgtatatctacaatggtcacaagggcacc
attcgcatgagatattcccagaaaatcttgggatccaatggagcctttaggagccagctc
cagtactttgggagatctttggatggctatggtgatttaaatggggattccatcactgac
gtatccattggtgcctttgggcaagtggttcagctctggtcacaaagcattgctgatgta
tctgtggatgcttcattcacaccagataaaattactttgttcaacaagaatgctgacata
acactcaagctctgtttcagcgccaagtttagacctactaagcagaacgatcaagtggcc
attatatacaatatcacaattgatgcaaacttatattcatccagagtaacctccagaggt
ttatttaaagaaaataatgaaaggtgtttgcagaagaatatgctcataagtcaagcacag
agttgcgctgagtacaccatcaacatacagaagccctctgatgttgtcaattctttggat
ctgtatgtgaacatcagcctggaacaccctggcaccagccctgccctcgaagcctactct
gaaaaggccaaagtcttcagtatccctttctacaaggactgtggggatgatggagtttgc
atctcagatctagttctaaatgtccaacatctgtcaactgctcaagatcaaccttttatt
gtcagcaaccaaaacagaaggttaacattttcaataaccctgaaaaacaaaagggaaagt
gcatacaacactagaattgttgtggatttttcagaaaatttgttttttgcttcctggtcc
atgccggttgatgggacagaagtaacatgccagattgcttcatctcagaagactgtcacc
tgtgatgtaggctaccctgctttgaagagggagcaacaggtgactttcactattaacttt
gacttcaatcttcaaaaccttcagaatcaggcatctgtcagtttccaagccttaagcgaa
agctatgaagagaacaaggcagataatttggtcaacttcaaaattcccctgcggtacgac
gccgatattcacataacaagatccaccaacataaatttttatgaagtctcttcagaaggg
aatgttccttctatcgtgcacagttatgaagatattggtccaaaattcatcttctccatt
aaggtaacaacaggaagtgttccagtaagcatggcatctgtaatcatccacatccctcaa
tacaccaaagaaaagaacccattaatgtatctgactgaggtgcacacagatcaggccggt
gacatcagttgtaatgccaaaataaatccactgaaaatcggacatacatctccttctgtg
tctttcaagaatgaaaatttccggcacatgaaagacttgaactgcagaactgcttcatgt
agcaatgttacctgctggctgaaagacctccaggtcaaaggagagtacttccttaatgtg
tctaccagaatttggaacgggacttttgcagcatcaactttccagactgttcagctgaca
gcatctgcagaaatcgacacctataaccctcagatatatgtgatcgaagaaaacacagtc
acgattcccatcacgataatgaaaccccatgagaaagctgaagtacctactggagttata
ataggaagcgtaattgctggaataattttgctattagctctggttgcagttttatggaag
cttggcttcttcaaaagaaaatatgaaaaaatgtccaaaaatgcagatgagattgacgag
accacagaactcaacagctga

KEGG   Vulpes vulpes (red fox): 112934860
Entry
112934860         CDS       T05911                                 

Gene name
ITGA4
Definition
(RefSeq) integrin alpha-4
  KO
K06483  integrin alpha 4
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04514  Cell adhesion molecules
vvp04640  Hematopoietic cell lineage
vvp04670  Leukocyte transendothelial migration
vvp04672  Intestinal immune network for IgA production
vvp04810  Regulation of actin cytoskeleton
vvp05135  Yersinia infection
vvp05140  Leishmaniasis
vvp05165  Human papillomavirus infection
vvp05410  Hypertrophic cardiomyopathy
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112934860 (ITGA4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112934860 (ITGA4)
   04514 Cell adhesion molecules
    112934860 (ITGA4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112934860 (ITGA4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112934860 (ITGA4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112934860 (ITGA4)
   04670 Leukocyte transendothelial migration
    112934860 (ITGA4)
   04672 Intestinal immune network for IgA production
    112934860 (ITGA4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112934860 (ITGA4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112934860 (ITGA4)
   05414 Dilated cardiomyopathy
    112934860 (ITGA4)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112934860 (ITGA4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112934860 (ITGA4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    112934860 (ITGA4)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112934860 (ITGA4)
  Exosomal proteins of other cancer cells
   112934860 (ITGA4)
Cell adhesion molecules [BR:vvp04515]
 Integrins
  Integrin alpha subunits
   112934860 (ITGA4)
CD molecules [BR:vvp04090]
 Proteins
  112934860 (ITGA4)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha DUF11 URO-D
Other DBs
NCBI-GeneID: 112934860
NCBI-ProteinID: XP_025874171
UniProt: A0A3Q7U8E7
LinkDB
Position
Unknown
AA seq 1030 aa
MAGEARRGPGPRGGAVRELLLLLLCLRVPSGRPYNVDTESALLYRGPPNTLFGYSLVLHG
HGANRWLVVGAPTARWLANASVVNPGAIYRCRIGGNPGLTCEQLQLGSPNGEPCGKTCLE
ERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPMGVCYGMPSDLRTELSKRI
APCYQDYVRKFGENFASCQAGISSFYTEDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLD
RQNQVKFGSYLGYSVGAGHFRSPHTTEIVGGAPQHEQIGKAYIFSIEAKELSILHEMKGK
KLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGWGAVMNEMETELVG
SDKYAARFGESIVNLGDIDNDGFEDVAVGAPQEDDLRGAVYIYNGRADGISTAFSQRIEG
LQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVEASLNHPESVN
RTNFDCVENGLPSVCMDLTLCFSYKGKEVPGYIVLLYNMSLDVNRKIDSPSRFYFSSNGT
SDVITGSMKVSSKVPNCRTHQAFMRKDVRDILTPIQIEAAYRLGQHVISKRSTEEFPPLQ
PILQQKKERDIIEKTINFARFCAHENCSADLQVSARIGFLKPHENKTYVAVGSMKTVMLN
VSLFNAGDDAYETALHIRLPSGLYFIKILDLEEKQINCEVTDSSGSVKLDCSIGYIYMDR
LSRMDISFLLDVSSLSRAEEDLSLTVHATCANEREMDNLNKVTLAIPLKYEVMLTVHGFV
NPTSFIYGPKEENEPDTCMAEKMNFTFHVINTGHSMAPNVSVEIMVPNSFAPQTDKLFNI
LDVQTAGECHFKKYPRKCALEQEKGAMKILKDIFTFLSKTDKKLLFCMKADPYCLTILCH
LGKMESGKEASVHIQLEGRPYLSEMDETSALKFEVRVTAFPEPNPKVIELNKDENVAHVL
LEGLHHQRPKRHFTIAIILSSLLLGLILLLLISYVMWKAGFFKRQYKSILQEENRRDSWS
YVNSKSNDDD
NT seq 3093 nt   +upstreamnt  +downstreamnt
atggctggggaagcgaggcgcgggcccgggccccgggggggcgccgtccgcgagctgctg
ctgctgctgctgtgcctgcgggtgccgagcgggcgcccctacaacgtggacaccgagagc
gcgctgctctaccggggcccccccaacaccctgttcggctactcgctggtgctgcacggc
cacggcgccaaccgatggctcgtggtgggggcgcccacggcccgctggctggccaacgcc
tcggtggtcaaccccggcgcgatttaccgctgcaggatcggcgggaacccaggcctgacc
tgcgaacagctccagctcggtagccccaatggagaaccctgtggaaagacttgcctggaa
gaaagagacaaccagtggttgggggtcacactttccagacagccaggagaaaacggatcc
atcgtgacttgtgggcatagatggaaaaatatattttatataaagaatgaaaataagctc
cccatgggggtttgctatggaatgccctctgatttacgaacagaactgagtaaaagaata
gctccgtgttatcaagattacgtgagaaaatttggagaaaattttgcatcctgtcaagcc
ggaatatctagtttttacaccgaggatttaattgtgatgggagcccctggatcttcttat
tggactggatctctttttgtctacaatataactacgaataaatacaaggcttttttagac
agacaaaatcaagtcaaatttgggagttatttggggtactcagttggagctggtcatttt
cggagtccacatactactgaaatagttggaggagcccctcaacatgaacagattggtaaa
gcatacatattcagcatcgaggcaaaagaactaagtatcttacatgaaatgaaaggaaag
aagcttggctcttactttggagcttctgtttgtgctgtggacctcaatgcagatggcttc
tcagacctacttgtgggagctcccatgcagagcaccatcagggaggaaggcagagtgttc
gtgtacatcaactctggctggggagcagtaatgaatgaaatggaaaccgagctcgttgga
agtgacaaatacgctgcaagatttggggaatctatagttaatcttggtgacattgataat
gatggctttgaagatgtggcggttggagctccacaagaagacgacttgcgcggtgccgtt
tatatttacaacggccgagcagacgggatctccacggcattctcacagagaattgaagga
cttcaaatcagcaaatcactaagtatgtttggacagtctatatctggacaaattgatgca
gataataatggatatgtagatgtggcagttggcgcttttcgttccgattctgctgtgttg
ctaaggacaagacctgtagtgattgttgaagcgtctttaaaccatcctgagtcagtaaat
agaacaaattttgactgtgttgaaaatggattgccttctgtgtgtatggatctaacgctg
tgtttctcatataagggcaaagaggtcccaggctatattgttttgctttataacatgagt
ctggacgtgaaccggaagatagactcgccatcgagattttacttttcttctaatgggaca
tctgatgtgattacgggcagcatgaaagtgtcgagcaaagtgcctaactgcagaacccat
caggcgtttatgcggaaagatgtgcgggacatcctcaccccaattcagattgaagctgcc
taccgcctggggcagcacgtcatcagtaaacgaagtacagaggaattcccaccacttcag
ccaattctccagcagaagaaagaaagagacataattgaaaaaacaataaactttgcaaga
ttttgtgcccatgaaaattgttctgctgatttacaggtttctgcaagaattggatttttg
aagccacatgaaaataagacttatgttgctgttggaagcatgaagacagtgatgttgaat
gtgtctttgtttaatgctggagatgatgcatatgaaacggctctgcacatcagactcccc
tccggcctttacttcattaagattttagatctggaggagaaacaaataaactgcgaagta
acagacagctctggctcagtcaaacttgactgcagcattggttatatatacatggatcgt
ctctcaaggatggatatcagctttctcctggatgtgagctcactcagccgagccgaagag
gatctcagccttacagtgcatgctacctgtgcaaatgaacgggaaatggacaacctgaac
aaagtgacgttagccatccctctcaagtatgaagtcatgctgactgttcacgggtttgtc
aacccaacctcatttatatatgggccaaaagaagaaaatgagcctgatacgtgcatggca
gagaaaatgaacttcactttccatgtcatcaacactggccatagcatggctccaaatgtt
agtgtggaaataatggtaccaaattcttttgccccccaaactgataagctgttcaacatt
ttggatgtccagactgctggagaatgccattttaagaaatatccaagaaagtgtgcatta
gagcaggagaaaggtgcaatgaagatcctaaaagacattttcacgttcttgtcaaagact
gataagaagctactgttctgcatgaaagctgatccatactgtttaactattttgtgccat
ttggggaaaatggaaagtggaaaagaagccagtgttcacattcagttggaaggccggccc
tacctttcagaaatggatgagacttcagccctcaagtttgaagtaagagtaacagctttt
ccagaacccaatccaaaagttattgaactaaacaaggatgagaatgttgcacatgttcta
cttgaaggattacatcatcaaagacccaaacgtcatttcacaatagcgattattttgagc
agcttgctacttggacttattttacttctactgatttcatatgttatgtggaaggctgga
ttctttaaaagacagtacaaatctatcctacaagaagaaaacagaagagacagctggagt
tatgttaacagcaaaagcaatgatgatgattaa

DBGET integrated database retrieval system