KEGG   Vulpes vulpes (red fox): 112907938
Entry
112907938         CDS       T05911                                 

Gene name
WNT2B
Definition
(RefSeq) protein Wnt-2b isoform X1
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112907938 (WNT2B)
   04390 Hippo signaling pathway
    112907938 (WNT2B)
   04150 mTOR signaling pathway
    112907938 (WNT2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112907938 (WNT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112907938 (WNT2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112907938 (WNT2B)
   05205 Proteoglycans in cancer
    112907938 (WNT2B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112907938 (WNT2B)
   05226 Gastric cancer
    112907938 (WNT2B)
   05217 Basal cell carcinoma
    112907938 (WNT2B)
   05224 Breast cancer
    112907938 (WNT2B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112907938 (WNT2B)
   05022 Pathways of neurodegeneration - multiple diseases
    112907938 (WNT2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112907938 (WNT2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112907938 (WNT2B)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Morphogens
   112907938 (WNT2B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 112907938
NCBI-ProteinID: XP_025839071
UniProt: A0A3Q7RAF8
LinkDB
Position
Unknown
AA seq 393 aa
MLEPGGAEDAAQLPPRRARAPVPTLAPGPVAPDGARASSRLGLACLLLLLLLTLPARVDT
SWWYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNC
TTLDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHD
QRGDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECK
CHGVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVTATQDGANFTAARQGYRRATRTD
LVYFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECK
FHWCCAVRCKECRNTVDVHTCKAPKKAEWLDQT
NT seq 1182 nt   +upstreamnt  +downstreamnt
atgctggagccgggcggtgcggaggacgccgcgcagctgccccccaggcgcgcccgcgcc
cctgtgcccacgctcgcgccaggccccgtggcccccgacggcgcccgggcttcttcccgc
ctcggtcttgcctgcctgctgctgctgctgctgctgacgctgccggcccgtgtagacacg
tcctggtggtacatcggggcactgggggcccgagtgatctgtgacaacatccctggtctg
gtgagtcggcagcggcagctgtgccagcgttacccagatatcatgcgctcagtgggcgag
ggtgcccgagaatggatccgagagtgtcagcaccagttccgccaccaccgctggaactgc
accacgctggaccgggaccacactgtctttggccgagtcatgctcagaagtagccgggaa
gcagcatttgtatatgccatctcatcagcaggggtggtccatgctatcacccgtgcctgt
agccagggtgaactgagtgtgtgcagctgtgacccctacacccgtggccgacaccatgac
caacgtggggattttgactggggtggctgcagtgacaacatccactatggtgttcgtttt
gccaaggcctttgtggacgccaaggaaaagaggcttaaggatgcccgggccctcatgaac
ttacataacaaccgctgtggtcgcacggctgtgcggcggtttctgaagctcgagtgtaag
tgccatggcgtaagtggctcctgtactctacgcacctgctggcgtgcgctctcagacttc
cgccgcacaggtgactacctgcggcggcgctatgatggtgctgtgcaggtgacagcaacc
caggatggtgccaacttcacagcagcccgccaaggctaccgccgtgccacccggactgac
cttgtctactttgacaactccccagattactgtgtcttggacaaggctgcaggttcccta
ggcactgcgggccgagtctgcagcaagacatctaaagggacagatggttgtgaaatcatg
tgctgtggccgaggatatgacacaactcgagtcacccgtgtcacccagtgtgaatgcaaa
ttccactggtgctgtgcagtgcggtgcaaggagtgcagaaacactgtggacgtccatact
tgcaaggcccccaagaaggcagagtggctggaccagacctga

KEGG   Vulpes vulpes (red fox): 112909974
Entry
112909974         CDS       T05911                                 

Gene name
WNT5A
Definition
(RefSeq) protein Wnt-5a isoform X1
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04360  Axon guidance
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112909974 (WNT5A)
   04390 Hippo signaling pathway
    112909974 (WNT5A)
   04150 mTOR signaling pathway
    112909974 (WNT5A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112909974 (WNT5A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112909974 (WNT5A)
  09158 Development and regeneration
   04360 Axon guidance
    112909974 (WNT5A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112909974 (WNT5A)
   05205 Proteoglycans in cancer
    112909974 (WNT5A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112909974 (WNT5A)
   05226 Gastric cancer
    112909974 (WNT5A)
   05217 Basal cell carcinoma
    112909974 (WNT5A)
   05224 Breast cancer
    112909974 (WNT5A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112909974 (WNT5A)
   05022 Pathways of neurodegeneration - multiple diseases
    112909974 (WNT5A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112909974 (WNT5A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112909974 (WNT5A)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Morphogens
   112909974 (WNT5A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 112909974
NCBI-ProteinID: XP_025841969
UniProt: A0A3Q7R770
LinkDB
Position
Unknown
AA seq 380 aa
MKKSIGILRPGVALGTAGSAMSSKFFLMALAIFFSFAQVVIEANSWWSLGMNNPVQMSEV
YIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDN
TSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWG
GCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKC
HGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
YIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFH
WCCYVKCKKCTEIVDQFVCK
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaagaagtcgattggaatattaaggccaggagttgctttggggacggctggaagtgca
atgtcttccaagttcttcctaatggctttggccatatttttctccttcgcccaggttgta
atagaagccaattcttggtggtcgctaggtatgaataaccctgttcagatgtcagaagta
tatatcataggagcgcagcctctctgcagccagctggcaggactttctcaaggacagaag
aaactgtgccacttgtatcaggaccacatgcagtacattggagaaggcgcaaagacgggc
atcaaagagtgccagtatcaattccggcatcggaggtggaactgcagcaccgtggataac
acctccgtttttggcagggtcatgcagataggcagccgcgagacggccttcacgtacgcg
gtgagcgccgcgggggtggtgaacgccatgagccgcgcgtgccgcgagggcgagctgtcc
acctgcggctgcagccgggccgcgcgccccaaggacctgccgcgggactggctgtggggc
ggctgcggggacaacatcgactacggctaccgcttcgccaaggagttcgtggacgcgcgc
gagcgggagcgcatccacgccaagggctcctacgagagcgcgcgcatcctcatgaacctg
cacaacaacgaggccggccgcaggacggtgtacaacctggccgacgtggcctgcaagtgc
cacggggtgtcgggctcgtgtagcctcaagacgtgctggctgcagctggccgacttccgc
aaggtgggcgacgccctgaaggagaagtacgacagcgcagcggccatgcggctcaacagc
cggggcaagctggtgcaggtcaacagccgcttcaactcgcccaccacgcaggacctggtc
tacatcgaccccagccccgactactgcgtgcgcaacgagagcaccggctcgctgggcacg
cagggccgcctgtgcaacaagacgtccgagggcatggacggctgcgagctcatgtgctgc
ggccgcggctacgaccagttcaagaccgtgcagacggagcgctgccactgcaagttccac
tggtgctgctacgtcaagtgcaagaagtgcacggagatcgtggaccagttcgtgtgcaaa
tag

KEGG   Vulpes vulpes (red fox): 112910612
Entry
112910612         CDS       T05911                                 

Gene name
WNT16
Definition
(RefSeq) protein Wnt-16
  KO
K01558  wingless-type MMTV integration site family, member 16
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05202  Transcriptional misregulation in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112910612 (WNT16)
   04390 Hippo signaling pathway
    112910612 (WNT16)
   04150 mTOR signaling pathway
    112910612 (WNT16)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112910612 (WNT16)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112910612 (WNT16)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112910612 (WNT16)
   05202 Transcriptional misregulation in cancer
    112910612 (WNT16)
   05205 Proteoglycans in cancer
    112910612 (WNT16)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112910612 (WNT16)
   05226 Gastric cancer
    112910612 (WNT16)
   05217 Basal cell carcinoma
    112910612 (WNT16)
   05224 Breast cancer
    112910612 (WNT16)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112910612 (WNT16)
   05022 Pathways of neurodegeneration - multiple diseases
    112910612 (WNT16)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112910612 (WNT16)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112910612 (WNT16)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Morphogens
   112910612 (WNT16)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 112910612
NCBI-ProteinID: XP_025842602
UniProt: A0A3Q7RAQ0
LinkDB
Position
Unknown
AA seq 302 aa
MRGRQPWKGPSAQPGACDPLAPHIPRDQKEDLLWTKPDRDTALSFSNLCFVLGTKETAFI
YAVMAAGLVHSVTRSCSAGNMTECSCDTTLQNGGSASEGWHWGGCSDDVQYGMWFSRKFL
DFPIRNTTGKESKVLLAMNLHNNEAGRQAVAKLMSVDCRCHGVSGSCAVKTCWKTMSSFE
KVGRLLKDKYENSIQISDKIQRKVRRRDKDQRRVPIRKDDLLYVNKSPNYCVEDKKLGIP
GTRGRECNRTSEGAGGCNLLCCGRGYNTHVVRHVERCECKFIWCCYVRCRRCESMTDVHT
CK
NT seq 909 nt   +upstreamnt  +downstreamnt
atgcgaggccgccagccctggaaaggtccatcggcccagcccggagcctgcgaccccctc
gctcctcacatcccaagggaccaaaaggaagatttgttatggacaaaaccagacagagat
acggctctttcattcagcaatttatgttttgttctaggcaccaaggaaacagcatttatt
tatgctgtgatggctgcaggcctggtgcattctgtgaccaggtcatgcagtgccggcaac
atgacggagtgctcctgtgacaccaccctacagaacggtggctcagcgagcgaaggctgg
cactgggggggctgctctgatgatgtccagtatggcatgtggttcagcagaaagttccta
gatttccccatcagaaacaccacaggaaaagaaagcaaagtactgttagcaatgaacctg
cacaacaacgaagctggaaggcaggctgtcgccaagctcatgtcggtggactgccgctgt
cacggggtctcgggctcctgcgccgtgaagacctgctggaaaaccatgtcctcgttcgag
aaggtcggccggctgctgaaggacaagtacgaaaacagtatccagatctcagacaaaata
cagcggaaggtgcgcaggagagacaaagaccagaggcgggtccccattcgcaaggacgac
ctgctgtacgtcaacaagtcccccaactactgcgtggaggacaagaagctgggcatcccg
ggcacgcggggccgcgagtgcaaccgcacctccgagggcgccggcggctgcaacctgctg
tgctgcggccgcggctacaacacgcacgtggtcaggcacgtggagaggtgcgagtgcaag
ttcatctggtgctgctacgttcgctgccggcgctgtgagagcatgaccgacgtgcacacc
tgcaagtag

KEGG   Vulpes vulpes (red fox): 112911970
Entry
112911970         CDS       T05911                                 

Gene name
WNT3A
Definition
(RefSeq) protein Wnt-3a
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112911970 (WNT3A)
   04390 Hippo signaling pathway
    112911970 (WNT3A)
   04150 mTOR signaling pathway
    112911970 (WNT3A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112911970 (WNT3A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112911970 (WNT3A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112911970 (WNT3A)
   05206 MicroRNAs in cancer
    112911970 (WNT3A)
   05205 Proteoglycans in cancer
    112911970 (WNT3A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112911970 (WNT3A)
   05226 Gastric cancer
    112911970 (WNT3A)
   05217 Basal cell carcinoma
    112911970 (WNT3A)
   05224 Breast cancer
    112911970 (WNT3A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112911970 (WNT3A)
   05022 Pathways of neurodegeneration - multiple diseases
    112911970 (WNT3A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112911970 (WNT3A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112911970 (WNT3A)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Morphogens
   112911970 (WNT3A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 112911970
NCBI-ProteinID: XP_025844475
UniProt: A0A3Q7SQN2
LinkDB
Position
Unknown
AA seq 352 aa
MALLGYFLFLYGLKQALGSYPIWWSLAVGPQYSSLGTQPILCASIPGLVPKQLRFCRNYV
EIMPSVADGMKISIQECQHQFRGRRWNCTTVNNSLAIFGPVLDKATRESAFVHAIASAGV
AFAVTRSCAEGSAAICGCSSRHQGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDAR
SAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRSIGDFLKDKYDSASE
MVVEKHRESRGWVETLRPRYSYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVS
SHGIDGCDLLCCGRGHNARTEQRREKCHCVFHWCCYVSCQECARVYDVHTCK
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggccctgctcgggtacttcttattcctctacggcctgaagcaggcgctgggcagctac
ccgatctggtggtccctggccgtcgggccccagtactcatccctgggcactcagcccatc
ctgtgcgccagcatcccaggcctggtacccaagcagctgcgcttctgccggaactacgtg
gagatcatgcccagcgtggcggacggcatgaagatcagcatccaggagtgccagcaccag
ttccgcgggcgccgctggaactgcaccacagtcaacaacagcctggccatcttcggccct
gtgctggacaaagccacccgggagtctgcctttgtgcacgccatcgcctcggccggcgtg
gccttcgctgtgacacgctcatgtgcggagggctccgctgccatctgtggctgcagcagc
cgccaccagggctcaccaggtgagggctggaagtggggaggctgcagcgaggacatcgag
tttggtggcatggtgtcccgggaattcgctgacgcacgggagaaccggccagacgcccgc
tccgccatgaaccgccacaacaatgaggccggacgccaggccatcgccagccacatgcat
ctcaagtgcaagtgccacgggctgtcgggcagttgcgaggtgaagacctgctggtggtca
cagcccgacttccgctccatcggagacttcctcaaggacaagtacgacagcgcctccgag
atggtggtggagaagcaccgcgagtcgcgcggctgggtggagacgctgcggccccgctac
agctacttcaaggtgcccacggagcgcgaccttgtgtactacgaggcctcgcccaacttc
tgcgagcccaaccccgagaccggctcgttcggcacccgcgaccgcacgtgcaacgtgagc
tcgcatggcatcgacggctgcgacctgctgtgctgtggccgcggccacaacgcgcgcacc
gagcagcgccgagagaagtgccactgcgtcttccactggtgctgctacgtgagctgccag
gagtgcgcgcgcgtctacgacgtgcacacctgcaagtag

KEGG   Vulpes vulpes (red fox): 112911976
Entry
112911976         CDS       T05911                                 

Gene name
WNT9A
Definition
(RefSeq) protein Wnt-9a
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112911976 (WNT9A)
   04390 Hippo signaling pathway
    112911976 (WNT9A)
   04150 mTOR signaling pathway
    112911976 (WNT9A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112911976 (WNT9A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112911976 (WNT9A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112911976 (WNT9A)
   05205 Proteoglycans in cancer
    112911976 (WNT9A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112911976 (WNT9A)
   05226 Gastric cancer
    112911976 (WNT9A)
   05217 Basal cell carcinoma
    112911976 (WNT9A)
   05224 Breast cancer
    112911976 (WNT9A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112911976 (WNT9A)
   05022 Pathways of neurodegeneration - multiple diseases
    112911976 (WNT9A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112911976 (WNT9A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112911976 (WNT9A)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Morphogens
   112911976 (WNT9A)
SSDB
Motif
Pfam: wnt Clr5
Other DBs
NCBI-GeneID: 112911976
NCBI-ProteinID: XP_025844488
UniProt: A0A3Q7RGT8
LinkDB
Position
Unknown
AA seq 388 aa
MAVWPQVHGESRQPGSQLCLPALPPAQPRVCLLGFRHTLRLSAACLLPALLLCGGLTGSE
PLTILPLTLEPEAAAQAHYKACDRLKLERKQRRMCRRDPGVAETLVEAVSMSALECQYQF
RFERWNCTLEGRYRASLLKRGFKETAFLYAISSAGLTHALAKACSAGRMERCTCDEAPDL
ENREAWQWGGCGDNLKYSSKFVKEFLGRRSSKDLRARVDFHNNLVGVKVIKAGVETTCKC
HGVSGSCTVRTCWRQLAPFHEVGKRLKHKYETALKVGSTTNEATGEAGAISPPRGRATGT
SGSDPLPRTPELVHLDDSPSFCLASRFSPGTAGRRCHREKNCESICCGRGHNTQSRVVTR
PCQCQVRWCCYVECRQCTQREEVYTCKS
NT seq 1167 nt   +upstreamnt  +downstreamnt
atggccgtctggccgcaggtccacggtgagtcacggcagcccggcagccagctgtgcctt
cccgctctgccgccggcccagcctcgggtctgcttactaggcttcagacacaccctacgc
ttgtctgcagcatgtctgctgccagccctgctgctgtgtggagggctgactggcagcgag
cccctgaccatcctcccgctgaccctggagcccgaggctgcagcgcaggcacactacaag
gcctgcgaccgactgaagctggagcgcaagcagaggcgcatgtgccgccgagacccaggt
gtggccgagacgctggtggaggcggtcagcatgagcgccctggagtgccagtaccagttc
cggttcgagcgctggaactgtactctggagggtcgctaccgggccagcctgctcaagcga
ggcttcaaggagactgccttcctctacgccatctcatctgcgggcctgacccatgcgctg
gccaaggcgtgcagcgcgggccgcatggagcgctgcacctgcgacgaggccccagacctg
gagaaccgggaggcctggcagtggggtggctgcggggacaacctcaagtacagcagcaag
ttcgtcaaggagttcctgggccggaggtcgagcaaggacctgcgagcacgcgtggacttc
cacaacaacctcgtgggtgtgaaggtaatcaaagccggggtggagaccacgtgtaagtgc
catggtgtgtcaggctcctgcaccgtgcggacatgctggcggcagctggcacccttccat
gaggtgggcaagcgcctgaaacacaagtatgagacggcgctcaaggtgggcagcaccacc
aacgaggccactggtgaggccggtgccatctcgccacctcggggccgggctacagggaca
agcggcagtgacccgttgccccgcacaccagagctcgtgcacctggatgactcgccgagc
ttctgcttggccagccgcttttccccaggcactgctggccgcaggtgccaccgggagaag
aactgtgagagcatctgctgtgggcgtggccacaacacgcagagccgggtggtgacacgg
ccgtgccagtgccaggtgcgctggtgctgctatgtggagtgcaggcagtgtacccagcgt
gaggaggtctacacctgcaagagctga

KEGG   Vulpes vulpes (red fox): 112914456
Entry
112914456         CDS       T05911                                 

Gene name
WNT7A
Definition
(RefSeq) protein Wnt-7a
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112914456 (WNT7A)
   04390 Hippo signaling pathway
    112914456 (WNT7A)
   04150 mTOR signaling pathway
    112914456 (WNT7A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112914456 (WNT7A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112914456 (WNT7A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112914456 (WNT7A)
   05205 Proteoglycans in cancer
    112914456 (WNT7A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112914456 (WNT7A)
   05226 Gastric cancer
    112914456 (WNT7A)
   05217 Basal cell carcinoma
    112914456 (WNT7A)
   05224 Breast cancer
    112914456 (WNT7A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112914456 (WNT7A)
   05022 Pathways of neurodegeneration - multiple diseases
    112914456 (WNT7A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112914456 (WNT7A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112914456 (WNT7A)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Morphogens
   112914456 (WNT7A)
SSDB
Motif
Pfam: wnt COG6
Other DBs
NCBI-GeneID: 112914456
NCBI-ProteinID: XP_025847338
UniProt: A0A3Q7RQ31
LinkDB
Position
Unknown
AA seq 349 aa
MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAII
VIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAIT
AACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLM
NLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEP
VRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQ
ASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEVYTCK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgaaccggaaagcgcggcgctgcctgggccacctctttctcagcctgggcatggtctac
ctccggatcggtggcttctcctccgtggtagctctgggcgcgagcatcatctgtaacaag
atcccgggcctggctcccagacagcgggcgatatgccagagccgccccgacgccatcatc
gtcataggagaaggctcgcaaatgggcctcgacgagtgtcagtttcagttccgcaatggc
cgctggaactgctcagccctgggggagcgcaccgtcttcgggaaggagctcaaagtgggg
agccgggaggctgccttcacctacgccatcatcgctgccggcgtggcccacgccatcacg
gccgcctgcacccaaggcaacctgagtgactgtggctgcgacaaggagaagcaaggccag
taccaccgggacgagggctggaagtggggtggctgctctgccgacatccgctacggcatc
ggcttcgccaaggtctttgtggatgcccgggagatcaagcagaatgcccggactctcatg
aacttgcacaataacgaggcgggccgaaagatcctggaggaaaacatgaagctggagtgc
aagtgccacggtgtgtccggctcgtgcaccaccaagacgtgctggaccacactgccacag
ttccgcgagctgggctacgtgctcaaggacaagtacaacgaggccgtccacgtggagccg
gtgcgcgccagccgcaacaagcggcccaccttcctgaagatcaagaagccgctgtcctac
cgcaagcccatggacacagacctggtgtacatcgagaagtcgcccaactactgcgaggag
gacccggtgacgggcagcgtgggcacgcagggccgcgcctgcaacaagacggccccgcag
gccagcggctgtgacctcatgtgctgcggtcgcggctacaacacccaccagtacgcccgc
gtgtggcagtgcaactgcaagtttcactggtgctgttatgtcaagtgcaacacctgcagc
gagcgtaccgaggtgtacacgtgcaagtga

KEGG   Vulpes vulpes (red fox): 112914893
Entry
112914893         CDS       T05911                                 

Gene name
WNT8B
Definition
(RefSeq) protein Wnt-8b
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112914893 (WNT8B)
   04390 Hippo signaling pathway
    112914893 (WNT8B)
   04150 mTOR signaling pathway
    112914893 (WNT8B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112914893 (WNT8B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112914893 (WNT8B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112914893 (WNT8B)
   05205 Proteoglycans in cancer
    112914893 (WNT8B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112914893 (WNT8B)
   05226 Gastric cancer
    112914893 (WNT8B)
   05217 Basal cell carcinoma
    112914893 (WNT8B)
   05224 Breast cancer
    112914893 (WNT8B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112914893 (WNT8B)
   05022 Pathways of neurodegeneration - multiple diseases
    112914893 (WNT8B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112914893 (WNT8B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112914893 (WNT8B)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Morphogens
   112914893 (WNT8B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 112914893
NCBI-ProteinID: XP_025847988
UniProt: A0A3Q7RS55
LinkDB
Position
Unknown
AA seq 351 aa
MLLTKPSVCIFLFTCILRLGYTWSVNNFLMTGPKAYLIYSSSVAAGAQSGIEECKYQFAW
DRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNG
QLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTC
KCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRS
ISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEE
RRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPRGGAAHKPGRKS
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgttgcttacgaagccttctgtgtgcatcttccttttcacctgtatcctccgacttggc
tacacctggtcagtgaacaatttcctgatgactggtccaaaggcttacctgatctattcc
agcagtgtggcagctggtgcccagagtggtattgaagaatgcaaatatcagtttgcctgg
gaccgatggaactgccctgagagagccctgcagctgtccagccatggcggccttcgcagt
gctaatcgggagacagcgtttgtacacgccatcagttctgctggggtcatgtacactctg
actaggaactgcagccttggagactttgacaactgtggctgtgacgactcccgcaacggg
cagctgggtggccaaggctggctgtggggaggctgtagtgacaacgtgggcttcggagaa
gcaatatccaagcagttcgtcgatgccctagagacaggacaggatgcccgggcagccatg
aacctgcacaacaatgaggctggccgcaaggcggtgaagggcaccatgaaacgcacgtgt
aagtgccacggtgtgtctggcagctgcaccacgcagacctgctggctgcagctgcctgag
ttccgcgaggtgggcgcacacctgaaggagaagtaccacgcagctctcaaggtggacctg
ctgcagggcgctggcaacagtgctgccggccggggtgccatcgccgacaccttccgctcc
atctccacgcgggagctggtgcacttggaggactccccggactactgcctggagaacaaa
acgctaggactgctgggtactgaaggccgagagtgcctgcggcgtgggcgggccctgggc
cgctgggagcgccgcagctgccgccggctctgcggggactgcgggctggcggtggaggag
cgccgggccgagaccgtgtccagctgcaactgcaagttccactggtgctgcgccgtccgc
tgcgagcagtgccgccggcgggttaccaagtacttctgcagccgcgctgagcggccgcgg
gggggcgcagcgcacaagcccgggagaaaatcctga

KEGG   Vulpes vulpes (red fox): 112917420
Entry
112917420         CDS       T05911                                 

Gene name
WNT5B
Definition
(RefSeq) protein Wnt-5b
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04360  Axon guidance
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112917420 (WNT5B)
   04390 Hippo signaling pathway
    112917420 (WNT5B)
   04150 mTOR signaling pathway
    112917420 (WNT5B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112917420 (WNT5B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112917420 (WNT5B)
  09158 Development and regeneration
   04360 Axon guidance
    112917420 (WNT5B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112917420 (WNT5B)
   05205 Proteoglycans in cancer
    112917420 (WNT5B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112917420 (WNT5B)
   05226 Gastric cancer
    112917420 (WNT5B)
   05217 Basal cell carcinoma
    112917420 (WNT5B)
   05224 Breast cancer
    112917420 (WNT5B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112917420 (WNT5B)
   05022 Pathways of neurodegeneration - multiple diseases
    112917420 (WNT5B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112917420 (WNT5B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112917420 (WNT5B)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Morphogens
   112917420 (WNT5B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 112917420
NCBI-ProteinID: XP_025851259
UniProt: A0A3Q7RZZ2
LinkDB
Position
Unknown
AA seq 358 aa
MPSRLLLTAALLSSWAHLPAEASSWWSLAMSPVQRPEMFIIGAQPVCSQLPGLSPGQRKL
CQLYQEHMAYIGEGAKTGIKECQYQFRQRRWNCSTVDNMSVFGRVMQIGSRETAFAYAVS
AAGVADAVSRACREGELSTCGCSRAARPQDLPRDWLWGGCGDNVDYGYRFAKEFVDARER
EKNFAKGSEEQARVLMNLQNNEAXRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRKV
GDQLKEKYDSAAAMRITRKGKLELVNSRFNQPTPEDLVYVDSSPDYCLRNETTGSLGTQG
RLCNKTSEGMDGCELMCCGRGYDQFKSVQVERCHCKFHWCCYVKCKKCTEIVDQYVCK
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgcccagccggctgctgctcaccgctgcactgctgtccagctgggctcatcttccggcc
gaagccagctcctggtggtcattagctatgagccctgtacagagacctgagatgtttatc
atcggtgcccagcccgtgtgcagccagcttcctgggctctcccctggccagaggaagctg
tgccagttgtaccaggagcacatggcctacatcggggagggagccaagacgggcatcaag
gagtgccagtaccagttccgtcagaggcggtggaactgcagcactgtggacaacatgtct
gtctttgggagagtcatgcagatagggagccgggagaccgccttcgcctacgcggtgagc
gccgcgggcgtggcggacgccgtgagccgggcctgccgcgagggcgagctgtccacctgc
ggctgcagccgggccgcgcggccccaggacctgccccgggactggctgtggggcggctgc
ggggacaacgtggactacggctaccgctttgctaaagagttcgtggacgcccgcgagcgg
gagaagaacttcgccaaggggtcggaggagcaggcccgagtgctcatgaacctgcagaac
aacgaggcggngcggagggctgtgtataagatggcagatgtagcctgcaagtgccacggc
gtctcagggtcctgcagcctcaagacctgctggctccagctggccgagttccgcaaagta
ggggaccagctgaaggagaagtatgacagcgcagccgccatgcgcatcacccgcaagggc
aaactggagctggtcaacagccgcttcaaccagcccacccctgaggacctggtctatgtg
gactccagcccagactactgtctgcgcaatgagaccacgggctccctgggtacccagggc
cgcctctgcaacaagacctcggagggcatggatggctgcgagctcatgtgctgtggccgt
ggctatgaccagttcaagagcgtccaggtggagcgctgccactgcaagttccactggtgc
tgctatgtcaagtgcaagaagtgcaccgagatcgtcgaccagtatgtctgtaaatag

KEGG   Vulpes vulpes (red fox): 112920632
Entry
112920632         CDS       T05911                                 

Gene name
WNT9B
Definition
(RefSeq) protein Wnt-9b
  KO
K01064  wingless-type MMTV integration site family, member 9
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112920632 (WNT9B)
   04390 Hippo signaling pathway
    112920632 (WNT9B)
   04150 mTOR signaling pathway
    112920632 (WNT9B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112920632 (WNT9B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112920632 (WNT9B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112920632 (WNT9B)
   05205 Proteoglycans in cancer
    112920632 (WNT9B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112920632 (WNT9B)
   05226 Gastric cancer
    112920632 (WNT9B)
   05217 Basal cell carcinoma
    112920632 (WNT9B)
   05224 Breast cancer
    112920632 (WNT9B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112920632 (WNT9B)
   05022 Pathways of neurodegeneration - multiple diseases
    112920632 (WNT9B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112920632 (WNT9B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112920632 (WNT9B)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Morphogens
   112920632 (WNT9B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 112920632
NCBI-ProteinID: XP_025855233
UniProt: A0A3Q7SG22
LinkDB
Position
Unknown
AA seq 448 aa
MRPEGLHVPPARPPAGAASEQGRLRPPAGPGRAGPRTQTLAAGGPQSRRAAGVRAPARPR
LPRPGSGPGAPSGNSLQSKDCVIIQGSSSYRELQGAAANTTYRQYFPDFPHHRSCPSLTG
REVLTPFPGLGTATAPAQGGAHLKQCDLLKLSRRQKQLCRREPGLAETLQDAAHLSLLEC
QFQFRHERWNCSLEGRTGLLKRGFKETAFLYAVSSAALTHTLARACSAGRMERCTCDDSP
GLESRQAWQWGVCGDNLKYSTKFLSNFLGPKRGSKDLRARVDAHNTHVGIKAVKSGLRTT
CKCHGVSGSCAVRTCWKQLSPFRETGQALKLRYDSAVKVSSATNEALGRLELWAPVRPGS
PAKGLAPRPGDLVYMEDSPSFCRPSKYSPGTAGRVCSREASCSSLCCGRGYDTQSRLVAF
SCHCQVQWCCYVECQQCVQEELVYTCKH
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgcggcccgagggcctccacgttccgcccgcgcgtcccccggcgggcgccgcgtcagag
cagggccgacttcgccctcccgctggccccggccgcgcgggacctcgaactcagacctta
gccgccggcgggccgcagtcccggcgcgctgcgggggttcgcgccccagctcggcctcgg
ctgccccggcccggctccggcccgggcgccccgtccgggaacagtctccagagcaaagac
tgtgtgatcatccaggggagcagcagctacagggagctgcagggggcagcagccaatact
acctacaggcagtactttccagacttccctcaccataggagctgcccaagcctgaccggg
cgggaggtcctgacccccttcccagggctgggcaccgccacggccccagcacagggtggg
gcccacctgaagcagtgtgacctgctgaagctgtcccgccggcagaagcagctctgccgg
agggagcccggcctggccgagaccctgcaggacgctgctcacctcagcctgctggagtgc
cagttccagttccgacatgagcgttggaactgcagcctggaggggaggacaggcctgctc
aagagaggtttcaaggagacggccttcctgtatgcagtgtcctcggccgccctcacccac
acgctggcccgggcctgcagtgccgggcgcatggagcgctgcacctgtgatgactctccg
ggcctggagagccgacaggcctggcagtggggcgtgtgcggcgacaacctcaagtacagc
accaagttcctgagcaacttcctggggcccaagagaggaagcaaagacctgagggcacgg
gtggatgctcacaatacccacgtgggcatcaaggcagtaaagagtggcctcaggaccaca
tgtaagtgccacggtgtttcgggctcctgcgccgtgcgcacctgctggaagcagctctcc
ccgttccgagagacaggccaggcgctaaagctgcgctatgactcagctgtcaaggtgtcc
agtgctaccaacgaggccttgggccgcctggagctgtgggcacctgtccggcctggcagc
cccgccaaaggcctggccccacggcctggggacctggtctacatggaagactcgcccagt
ttctgccggcccagcaagtactcaccaggcacagcgggcagggtgtgttctcgggaggcc
agctgcagcagcctgtgctgcgggcggggctatgacacccagagccgcctggtggccttc
tcctgccactgccaggtgcagtggtgctgctacgttgagtgccagcagtgcgtgcaggag
gagctcgtgtatacctgcaaacactag

KEGG   Vulpes vulpes (red fox): 112920633
Entry
112920633         CDS       T05911                                 

Gene name
WNT3
Definition
(RefSeq) proto-oncogene Wnt-3
  KO
K00312  wingless-type MMTV integration site family, member 3
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112920633 (WNT3)
   04390 Hippo signaling pathway
    112920633 (WNT3)
   04150 mTOR signaling pathway
    112920633 (WNT3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112920633 (WNT3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112920633 (WNT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112920633 (WNT3)
   05206 MicroRNAs in cancer
    112920633 (WNT3)
   05205 Proteoglycans in cancer
    112920633 (WNT3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112920633 (WNT3)
   05226 Gastric cancer
    112920633 (WNT3)
   05217 Basal cell carcinoma
    112920633 (WNT3)
   05224 Breast cancer
    112920633 (WNT3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112920633 (WNT3)
   05022 Pathways of neurodegeneration - multiple diseases
    112920633 (WNT3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112920633 (WNT3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112920633 (WNT3)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Morphogens
   112920633 (WNT3)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 112920633
NCBI-ProteinID: XP_025855234
UniProt: A0A3Q7S7B0
LinkDB
Position
Unknown
AA seq 531 aa
MGAAGPTSWSCGEEASVRCQAGCARGTAVALTAGLACGRGGPEGICLGRRRLQSQGLSVL
QRRGKERGISLLREVWGATLALAASQCPGLGASAGLGRPTCRGLMRPGSGHPFGVLGQKW
PHRVETKRQWGGPHPSASLSTAPKCQRREWKGLRFFPGEPCSPAALSGWRCADHPARTLG
SVPAPGIAELLGQPCHRPLSACRSLALGQQYTSLGSQPLLCGSIPGLVPKQLRFCRNYIE
IMPSVAEGVKLGIQECQHQFRGRRWNCTTIDDSLAIFGPVLDKATRESAFVHAIASAGVA
FAVTRSCAEGTSTICGCDSHHKGPPGEGWKWGGCSEDADFGVLVSREFADARENRPDARS
AMNKHNNEAGRTTILDHMHLKCKCHGLSGSCEVKTCWWAQPDFRAIGDFLKDKYDSASEM
VVEKHRESRGWVETLRAKYALFKPPTERDLVYYENSPNFCEPNPETGSFGTRDRTCNVTS
HGIDGCDLLCCGRGHNTRTEKRKEKCHCIFHWCCYVSCQECIRIYDVHTCK
NT seq 1596 nt   +upstreamnt  +downstreamnt
atgggggcggcagggcccacctcctggagctgtggtgaggaagcatccgtgaggtgccag
gccgggtgtgcgagaggaacggctgtcgctctgactgctggccttgcatgtggccgcggg
gggccagagggaatctgcttgggtcgaaggagactacagtctcaggggctcagtgtcctt
cagaggaggggcaaggaacgaggcatctccctgctgagggaggtttggggagcaactctg
gccttggcagccagccagtgcccggggctgggggcttctgctgggctggggaggcccacc
tgcagggggctgatgagaccagggagtgggcacccctttggagtgctgggacagaagtgg
cctcaccgagtggaaacgaagaggcagtgggggggtccccacccctcggcatccctctcc
acggctcctaaatgccagagaagggagtggaaaggcctgcgcttcttcccaggggagccc
tgctccccagctgccctctcaggatggcgctgtgccgaccatccagcccgaaccctgggc
tccgttccggctccagggattgcagagttgctggggcagccgtgccaccgccctctgtct
gcctgcaggtccctggccctgggccagcagtacacatccctgggctcacagcccctgctc
tgcggctccatcccaggcctggtccccaagcagctgcgcttctgccggaattacatcgaa
atcatgcccagcgtggccgagggagtgaagttgggcatccaggagtgccagcaccagttc
cggggccgccgctggaactgcaccaccatagatgatagcctggccatcttcggtcctgtc
ctggacaaagccacccgcgagtcggccttcgtgcacgccatcgcctcggccggcgtggcc
ttcgccgtcacgcgctcctgcgccgagggcacctccaccatctgcggctgcgactcgcat
cacaaggggccgcccggcgagggctggaagtggggcggctgcagcgaggacgccgacttc
ggggtgctcgtgtcccgggagttcgcggatgcgcgtgagaacaggccggacgcacgctcg
gccatgaacaagcacaacaacgaggcgggccgcacgaccatcctggaccacatgcacctt
aaatgcaagtgccacgggctgtcgggcagctgcgaggtcaagacctgctggtgggcccaa
cccgacttccgcgctatcggcgacttcctcaaggacaagtacgacagtgcctcggagatg
gtggtggagaagcaccgtgaatcccgtggctgggtggagaccctccgcgccaagtacgcg
ctgttcaagccgcccaccgagagggacctggtctactatgagaactcccccaacttctgc
gagcccaatcccgagacgggctcctttggcaccagggaccggacttgcaatgtcacctct
cacggcatcgatggctgcgacctgctgtgctgtggccgtggccacaacacgaggacggag
aagcggaaggagaaatgccactgcatcttccactggtgctgctacgtgagctgccaggag
tgcatccgcatctacgacgtgcacacctgcaagtag

KEGG   Vulpes vulpes (red fox): 112921097
Entry
112921097         CDS       T05911                                 

Gene name
WNT10B
Definition
(RefSeq) protein Wnt-10b
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112921097 (WNT10B)
   04390 Hippo signaling pathway
    112921097 (WNT10B)
   04150 mTOR signaling pathway
    112921097 (WNT10B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112921097 (WNT10B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112921097 (WNT10B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112921097 (WNT10B)
   05205 Proteoglycans in cancer
    112921097 (WNT10B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112921097 (WNT10B)
   05226 Gastric cancer
    112921097 (WNT10B)
   05217 Basal cell carcinoma
    112921097 (WNT10B)
   05224 Breast cancer
    112921097 (WNT10B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112921097 (WNT10B)
   05022 Pathways of neurodegeneration - multiple diseases
    112921097 (WNT10B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112921097 (WNT10B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112921097 (WNT10B)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Morphogens
   112921097 (WNT10B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 112921097
NCBI-ProteinID: XP_025856017
UniProt: A0A3Q7T6P6
LinkDB
Position
Unknown
AA seq 389 aa
MPEEPRPRPPPSGFAGLLLLALCSRALSNEILGLKLPGEPPLTANTVCLTLSGLSKRQLG
LCLRSPDVTASALQGLHIAVHECQHQLRDQRWNCSALEGGGRLPHHSAILKRGFRESAFS
FSMLAAGVMHAVATACSLGRLVSCGCGWKGSGEQDRLRAKLLQLQALSRGKSFPHSLPSP
GPGSVPSPGPQDTWEWGGCNHDMDFGEKFSRDFLDSREAPRDIQARMRIHNNRVGRQVVT
ENLKRKCKCHGTSGSCQFKTCWRAAPEFRAVGAALRERLGRAIFIDTHNRNSGAFQPRLR
PRRLSGELVYFEKSPDFCERDPTVGSPGTRGRACNKTSRLLDGCGSLCCGRGHNMLRQTR
VERCHCRFHWCCYVLCDECKVTEWVNVCK
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgccggaggagccccggccgcggcctccgccctcgggcttcgcgggtctcctgctcctg
gcgctgtgcagtcgggccctcagcaatgagatcctgggcctgaagctgcccggggagccg
ccgctgaccgccaacaccgtgtgcctgacgctgtcgggcctgagcaagcggcagctgggc
ctctgcctgcgcagccccgacgtgacggcatccgcgctgcagggcctgcacatcgcggtc
cacgagtgtcagcaccagctgcgcgaccagcgctggaactgctcggcgctcgagggcggc
ggccgcctgccgcaccacagcgccatcctcaagcgcggtttccgtgagagtgctttttcc
ttctccatgctggcggcaggggtcatgcacgcggtcgccacggcctgcagcctgggcagg
ctagtgagctgcggctgcggctggaagggcagtggtgagcaggaccggctgagggccaag
ctgctgcagctgcaggctctgtcccggggcaagagtttcccccactccctgcccagccct
ggccccggctcagttcccagccctggcccccaggacacatgggaatggggtggctgtaac
catgacatggactttggagagaagttctctcgggatttcttggattccagggaagctccc
cgggacatccaggcaagaatgcgaatccacaacaacagggtggggcgacaggtggtaact
gaaaacctgaagcggaaatgcaagtgccacggcacgtcgggcagctgccagttcaagacg
tgctggagggcggccccagagttccgggcagtgggggcagccctgagggagcggctgggt
cgggccatcttcatcgatacccacaaccgcaactccggagccttccagccccgcctgcgt
ccccgccgcctctcaggagagctggtttacttcgagaagtctccggacttctgcgagcga
gaccctaccgtgggctcccccggcactcggggccgggcctgcaacaagaccagccggctg
ctcgatggctgtggcagcctgtgctgcggccgtgggcacaacatgctccggcagacacga
gttgagcgctgtcactgccgcttccactggtgctgctatgtgctgtgcgatgagtgcaag
gtcacggagtgggtcaacgtgtgtaagtga

KEGG   Vulpes vulpes (red fox): 112921098
Entry
112921098         CDS       T05911                                 

Gene name
WNT1
Definition
(RefSeq) proto-oncogene Wnt-1 isoform X1
  KO
K03209  wingless-type MMTV integration site family, member 1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112921098 (WNT1)
   04390 Hippo signaling pathway
    112921098 (WNT1)
   04150 mTOR signaling pathway
    112921098 (WNT1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112921098 (WNT1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112921098 (WNT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112921098 (WNT1)
   05205 Proteoglycans in cancer
    112921098 (WNT1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112921098 (WNT1)
   05226 Gastric cancer
    112921098 (WNT1)
   05217 Basal cell carcinoma
    112921098 (WNT1)
   05224 Breast cancer
    112921098 (WNT1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112921098 (WNT1)
   05022 Pathways of neurodegeneration - multiple diseases
    112921098 (WNT1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112921098 (WNT1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112921098 (WNT1)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Morphogens
   112921098 (WNT1)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 112921098
NCBI-ProteinID: XP_025856019
UniProt: A0A3Q7S8W4
LinkDB
Position
Unknown
AA seq 370 aa
MGHWALLPGGVSAALLLALAALPAALAANSSGRWWGIVNVASSTNLLTDSKSLQLVLEPS
LQLLSRKQRRLIRQNPGILHSVSGGLQSAVRECKWQFRNRRWNCPTASGPHLFGKIVNRG
CRETAFIFAITSAGVTHSVARSCSEGSIESCTCDYRRRGPGGPDWHWGGCSDNIDFGRLF
GREFVDSGEKGRDLRFLMNLHNNEAGRTTVFSEMRQECKCHGMSGSCTVRTCWMRLPTLR
AVGDVLRDRFDGASRVLYGNRGSNRASRAELLRLEPEDPAHKPPSPHDLVYFEKSPNFCT
YSGRLGTAGTAGRACNSSSPALDGCELLCCGRGHRTRTQRVTERCNCTFHWCCHVSCRNC
THTRVLHECL
NT seq 1113 nt   +upstreamnt  +downstreamnt
atggggcactgggcgctgctgcccggcggggtttctgctgcgctcttgctggcgctggcc
gctctgcccgcagccctggccgccaacagcagcggccgatggtggggcatcgtgaacgtc
gcctcctccacgaacctgctgaccgactccaagagtctgcaactggtgctcgagcccagt
cttcagctgctgagccgcaaacagcggaggctgatccgtcagaacccggggatcctgcac
agcgtgagcggggggctgcagagcgctgtgcgagagtgcaagtggcagttccgcaaccgc
cgctggaactgccccacggcttcggggccccacctcttcggcaagatcgtcaaccgaggc
tgtcgggaaaccgcatttatcttcgccatcacctccgccggggttacccattcagtggca
cgctcctgctcagagggctccatcgagtcctgcacgtgcgactaccggcggcgcggcccc
gggggccccgactggcactgggggggctgcagcgacaacatcgacttcggccgcctcttc
ggcagggagtttgtggactccggggagaaggggcgggacctgcgcttcctcatgaacctg
cacaacaacgaggcgggccgcacgacggtgttctccgagatgcgccaggagtgcaagtgc
cacgggatgtcgggctcgtgcacggtgcgcacgtgctggatgcggctgcccacgctgcgc
gccgtgggcgacgtgctgcgcgaccgcttcgatggggcctcgcgcgtcctctacggcaac
cgcggcagcaaccgcgcctcccgggcggagctgctgcgcctggagcccgaagaccccgcg
cacaagccgccctccccccacgacctcgtctactttgagaaatcgcccaatttctgcacc
tacagcggacgcctggggacggcgggcacggcggggcgcgcctgcaacagctcctcgccc
gcgctggacggctgcgagctgctctgctgcggccggggccaccgcacgcgcacacagcgc
gtcaccgagcgctgcaactgcaccttccactggtgctgccacgtcagctgccgcaactgc
acgcacacgcgcgtactgcacgagtgtctgtga

KEGG   Vulpes vulpes (red fox): 112921902
Entry
112921902         CDS       T05911                                 

Gene name
WNT8A
Definition
(RefSeq) protein Wnt-8a
  KO
K00714  wingless-type MMTV integration site family, member 8
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112921902 (WNT8A)
   04390 Hippo signaling pathway
    112921902 (WNT8A)
   04150 mTOR signaling pathway
    112921902 (WNT8A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112921902 (WNT8A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112921902 (WNT8A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112921902 (WNT8A)
   05205 Proteoglycans in cancer
    112921902 (WNT8A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112921902 (WNT8A)
   05226 Gastric cancer
    112921902 (WNT8A)
   05217 Basal cell carcinoma
    112921902 (WNT8A)
   05224 Breast cancer
    112921902 (WNT8A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112921902 (WNT8A)
   05022 Pathways of neurodegeneration - multiple diseases
    112921902 (WNT8A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112921902 (WNT8A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112921902 (WNT8A)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Morphogens
   112921902 (WNT8A)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 112921902
NCBI-ProteinID: XP_025857082
UniProt: A0A3Q7T8N8
LinkDB
Position
Unknown
AA seq 352 aa
MGDLFMLRVAVGICYATFSASAWSVNNFLITGPKAYLTYTTSVALGAQSGIEECKFQFAW
ERWNCPESALQLSTHNRLRSATRETSFIHAISSAGVMYIITKNCSMGDFENCGCDESKNG
KTGGHGWIWGGCSDNVEFGERISKLFVDSLEKGKDARALMNLHNNRAGRLAVRAIMKRTC
KCHGISGSCSIQTCWLQLADFREMGDYLKAKYKQALKIEMDKRQLRAGNSAEGHWAPTEA
FLPSAEAELIFLEESPDYCTRNSSLGIYGTEGRECLQDSHNTSRWEQHSCGRLCTECGLQ
VEERRTEAISSCNCKFQWCCTVRCDQCRHVVNKYYCTSSLGSALARGKGSAS
NT seq 1059 nt   +upstreamnt  +downstreamnt
atgggggacctgtttatgctcagggtggccgtgggcatatgctacgccaccttcagtgcc
tctgcctggtcagtgaacaatttcctgataacaggtcccaaggcctatctgacctacacc
accagcgtggccctgggcgcccagagtggcatagaggagtgtaaattccaatttgcttgg
gaacgctggaactgcccggaaagtgctctccagctctccactcacaacaggctgagaagt
gccaccagggagacttctttcattcatgccatcagctctgctggagtcatgtacatcatc
accaagaactgcagcatgggcgactttgaaaactgtggctgtgatgagtcaaaaaacgga
aaaacaggaggtcacggctggatctggggaggctgcagcgacaatgtggaatttggggaa
aggatctccaaactctttgtggatagcctggaaaagggaaaagatgcgagagccctgatg
aaccttcacaacaacagggcaggcaggctggcagtgagagccatcatgaaaaggacctgc
aaatgtcatggcatctctgggagctgcagcatccaaacatgctggctgcagctggctgac
ttccgggaaatgggagactacctgaaagccaagtacaagcaggccctgaaaattgagatg
gataagcggcagttgagggctgggaacagtgctgagggccactgggcccccactgaggcc
ttccttcctagtgcagaggctgagctgatctttttagaggaatcaccagattactgtacc
cgtaattccagtctgggcatctatggcacagaaggccgggagtgtctgcaggacagccac
aacacatccaggtgggagcaacacagctgcgggcgcctatgcaccgagtgtggcctgcag
gtggaagagagaagaactgaggctatcagcagctgtaactgcaaattccagtggtgctgt
acagtcaggtgcgaccagtgtaggcacgtagtgaacaagtactactgcacaagctccctg
ggcagcgctttggccagaggcaagggcagtgcttcatag

KEGG   Vulpes vulpes (red fox): 112922477
Entry
112922477         CDS       T05911                                 

Gene name
WNT10A
Definition
(RefSeq) protein Wnt-10a
  KO
K01357  wingless-type MMTV integration site family, member 10
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112922477 (WNT10A)
   04390 Hippo signaling pathway
    112922477 (WNT10A)
   04150 mTOR signaling pathway
    112922477 (WNT10A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112922477 (WNT10A)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112922477 (WNT10A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112922477 (WNT10A)
   05205 Proteoglycans in cancer
    112922477 (WNT10A)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112922477 (WNT10A)
   05226 Gastric cancer
    112922477 (WNT10A)
   05217 Basal cell carcinoma
    112922477 (WNT10A)
   05224 Breast cancer
    112922477 (WNT10A)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112922477 (WNT10A)
   05022 Pathways of neurodegeneration - multiple diseases
    112922477 (WNT10A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112922477 (WNT10A)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112922477 (WNT10A)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Morphogens
   112922477 (WNT10A)
SSDB
Motif
Pfam: wnt Ebola_NP
Other DBs
NCBI-GeneID: 112922477
NCBI-ProteinID: XP_025857832
UniProt: A0A3Q7TA10
LinkDB
Position
Unknown
AA seq 417 aa
MGSTHPCPRLRLRPRPQPRPALCALLFFLLLLAAAVPRSAPNDILGLRLPPEPVLNANTV
CLTLPGLSRRQMEVCVRHPDVAASAIQGIQIAIHECQHQFRDQRWNCSSLETRNKIPYES
PIFSRGFRESAFAYAIAAAGVVHAVSNACALGKLKACGCDASRRGDEEAFRRKLHRLQLD
ALQRGKGLSHGVPEHPALPPASPGLQDSWEWGGCSPDVGFGERFSKDFLDSREPHRDIHA
RMRLHNNRVGRQAVMENMRRKCKCHGTSGSCQLKTCWQVTPEFRAVGALLRSRFHRATLI
RPHNRNGGQLEPGPAGAPSPAPGAPGPRRRASPADLVYFEKSPDFCEREPRLDSAGTVGR
LCNKSSAGPDGCGSMCCGRGHNILRQTRSERCHCRFHWCCFVVCEECRITEWVSVCK
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgggcagcacccacccttgcccccggctgcggctccgacctcggccccagccgcggccc
gcgctctgcgcgctcctgttcttcctactgctgctggctgccgccgtgcccaggtctgca
cccaacgacattctgggcctccgcctccccccggagcctgtgctcaatgccaacacggtg
tgcctaacgttgccgggcctgagcaggaggcagatggaagtgtgtgtgcgccacccagac
gtggctgcctcagccatccagggcatccagatcgccatccatgagtgccagcaccagttc
cgggaccagcgctggaactgctccagtctggagactcgcaacaagatcccctacgagagt
cccatcttcagcagaggttttcgcgagagcgccttcgcctatgccatcgcggcagctggg
gtcgtgcatgccgtgtccaatgcctgtgccctaggcaaactgaaggcctgcggctgcgat
gcctcccggcgcggggacgaggaggccttccgccggaagctgcaccgcctgcagctggac
gcgctgcagcgtggtaagggcttgagccatggggtcccagaacacccggccctgccccct
gccagccccggcctgcaggactcctgggagtggggcggctgtagccccgacgtgggcttc
ggggagcgcttctctaaggactttctggactcccgggagcctcacagagacatccacgca
cgcatgagactccacaacaaccgagttgggagacaggcggtgatggagaacatgcggcgg
aagtgcaagtgccacggcacgtcgggcagctgccagctcaagacgtgctggcaggtgacg
ccggagttccgcgcggtgggggcgctgctgcgcagccgcttccaccgcgccacgctcatc
cggccgcacaaccgcaacggcggccagctggagcccggccccgcgggggcgccctcgccg
gcccccggcgcccccggcccgcggcgccgcgccagccccgccgacctggtctacttcgag
aagtcgcccgacttctgcgagcgcgagccgcgcctggactcggcgggcaccgtgggccgc
ctgtgcaacaagagcagcgcgggccccgacggctgcggcagcatgtgctgcggccgcggc
cacaacatcctgcgccagacgcgcagcgagcgctgccactgccgcttccactggtgctgc
ttcgtggtgtgcgaggagtgccgcatcaccgagtgggtcagcgtgtgcaagtga

KEGG   Vulpes vulpes (red fox): 112922542
Entry
112922542         CDS       T05911                                 

Gene name
WNT6
Definition
(RefSeq) protein Wnt-6
  KO
K00445  wingless-type MMTV integration site family, member 6
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112922542 (WNT6)
   04390 Hippo signaling pathway
    112922542 (WNT6)
   04150 mTOR signaling pathway
    112922542 (WNT6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112922542 (WNT6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112922542 (WNT6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112922542 (WNT6)
   05205 Proteoglycans in cancer
    112922542 (WNT6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112922542 (WNT6)
   05226 Gastric cancer
    112922542 (WNT6)
   05217 Basal cell carcinoma
    112922542 (WNT6)
   05224 Breast cancer
    112922542 (WNT6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112922542 (WNT6)
   05022 Pathways of neurodegeneration - multiple diseases
    112922542 (WNT6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112922542 (WNT6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112922542 (WNT6)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Morphogens
   112922542 (WNT6)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 112922542
NCBI-ProteinID: XP_025857927
UniProt: A0A3Q7TA64
LinkDB
Position
Unknown
AA seq 365 aa
MLPPAPSLLGLLLLLLLCPAHVGGLWWAVGSPLVMDPTSICRKARRLAGRQAELCQAEPE
VVAELARGARLGVRECQFQFRFRRWNCSSHSKAFGRILQQDIRETAFVFAITAAGASHAV
TQACSMGELLQCGCQAPRGRAPPRPPGLPGTPGPPGPSGSPDGSATWEWGGCGDDVDFGD
EKSRLFMDARHKRGRGDIRALVQLHNNEAGRLAVRSHTRTECKCHGLSGSCALRTCWQKL
PPFREVGARLLERFHGASRVMGTNDGKALLPAVRTLKPPGRADLLYAADSPDFCAPNRRT
GSPGTRGRACNSSAPDLSGCDLLCCGRGHRQESVQLEENCLCRFHWCCVVQCHRCRVRKE
LSLCL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgctgccgcccgcgccctccctgctcgggctgctgctgctgctgctcctgtgccccgcg
cacgtcggtggactgtggtgggcggtgggcagccccctggtcatggaccctaccagcatc
tgcaggaaagcgcggcggctggcagggcggcaggctgagctgtgccaggctgagccagaa
gtggtggcggagctagcccggggcgcccggcttggggtgcgagagtgccagttccagttc
cgtttccgccgctggaactgttccagccacagcaaggccttcgggcgcatcctgcagcag
gacatccgggagacggcctttgtgtttgccatcacggctgcgggcgccagccacgcagtc
acccaggcctgctccatgggggagctgctgcagtgcggctgccaggcgccccgcggccgg
gccccgcccaggccccctggcctgcctggcaccccggggcccccggggccctccggctcc
cccgatggcagcgccacctgggagtggggaggctgtggcgacgacgtggacttcggggac
gagaaatcaaggctctttatggatgcccggcacaagcggggtcgtggagacatccgtgca
ttggtgcaacttcacaacaatgaggcaggccgtctggccgtgcggagccacacgcgcacc
gagtgcaagtgccacggactgtcgggctcgtgcgcgctgcgaacctgctggcagaagctg
cccccgttccgcgaggtgggcgcgcggctgctcgagcgcttccacggcgcctcgcgcgtc
atgggaaccaacgacggcaaggccctgctgcccgccgtccgcaccctgaagccgccgggc
cgcgccgacctcctctacgccgccgactcgcccgacttctgcgcgcccaaccggcgcacc
ggctctccgggcacgcgaggccgcgcgtgcaacagcagcgccccggacctcagcggctgc
gacctgctgtgctgcggccgcgggcaccgccaggagagcgtgcagctcgaggagaactgc
ctgtgccgcttccactggtgctgcgtcgtgcagtgccaccgctgccgcgtgcgcaaggag
ctcagcctctgcctctga

KEGG   Vulpes vulpes (red fox): 112928634
Entry
112928634         CDS       T05911                                 

Gene name
WNT11
Definition
(RefSeq) protein Wnt-11
  KO
K01384  wingless-type MMTV integration site family, member 11
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112928634 (WNT11)
   04390 Hippo signaling pathway
    112928634 (WNT11)
   04150 mTOR signaling pathway
    112928634 (WNT11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112928634 (WNT11)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112928634 (WNT11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112928634 (WNT11)
   05205 Proteoglycans in cancer
    112928634 (WNT11)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112928634 (WNT11)
   05226 Gastric cancer
    112928634 (WNT11)
   05217 Basal cell carcinoma
    112928634 (WNT11)
   05224 Breast cancer
    112928634 (WNT11)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112928634 (WNT11)
   05022 Pathways of neurodegeneration - multiple diseases
    112928634 (WNT11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112928634 (WNT11)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112928634 (WNT11)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Morphogens
   112928634 (WNT11)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 112928634
NCBI-ProteinID: XP_025866236
UniProt: A0A3Q7TLQ1
LinkDB
Position
Unknown
AA seq 354 aa
MRARPRVCEALLFALALQTGVCYGIKWLALSKTPAALALNQTQHCKQLEGLVSAQVQLCR
SNLELMHTIVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAA
AISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKK
TGSQANKLMRLHNSEVGRQALRASLEMKCKCHGVSGSCSIRTCWKGLQELRDVAADLKTR
YLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCN
KTSHGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK
NT seq 1065 nt   +upstreamnt  +downstreamnt
atgagggcgcggccgcgggtgtgcgaggcgctcctcttcgccctggcgctccagaccggc
gtgtgctacggcatcaaatggctggcgctgtccaagaccccggcggccctggcgctgaac
cagacgcagcactgcaagcagctggaggggctggtgtctgcgcaggtgcagctctgccgc
agcaacctggagcttatgcacaccatcgtgcacgctgcccgcgaggtcatgaaggcctgc
cgcagggcctttgcggacatgcgctggaactgctcctccatcgagcttgcccccaactac
ctgcttgacctggagagagggacccgggagtcggccttcgtgtatgcgctgtcggcggcc
gccatcagccacgccatcgcccgggcctgcacctccggggacctgcccggctgctcctgc
ggccccgtcccaggtgagccacccgggcccgggaaccgctggggaggatgtgcggacaac
ctcagctacgggcttctcatgggagccaagttttccgatgctcctatgaaggtgaaaaaa
acaggatcccaagccaataaactgatgcgtctacacaacagtgaagtggggagacaggct
ctgcgcgcctctctggaaatgaagtgtaagtgccatggggtatctggctcctgctccatc
cgcacctgctggaaggggctgcaggagcttcgagatgtggctgccgacctcaagacccgc
tacctgtcggccaccaaggtggtgcaccgccccatgggcacccgcaagcacctggtgccc
aaggacctggacatcaggcctgtgaaggactcagagcttgtctatctgcagagttcgccc
gacttctgcatgaagaacgagaaggtgggctcccacgggacgcaagacaggcagtgcaac
aaaacatcccatggcagtgacagctgtgacctcatgtgctgcggccgtggctacaacccg
tacacagaccgcgtggtcgagcgctgccactgcaagtatcactggtgctgctacgttacc
tgccgccgctgcgagcgcacagtggagcgctacgtttgcaagtga

KEGG   Vulpes vulpes (red fox): 112929848
Entry
112929848         CDS       T05911                                 

Gene name
WNT4
Definition
(RefSeq) protein Wnt-4 isoform X1
  KO
K00408  wingless-type MMTV integration site family, member 4
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04360  Axon guidance
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04919  Thyroid hormone signaling pathway
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112929848 (WNT4)
   04390 Hippo signaling pathway
    112929848 (WNT4)
   04150 mTOR signaling pathway
    112929848 (WNT4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112929848 (WNT4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    112929848 (WNT4)
   04916 Melanogenesis
    112929848 (WNT4)
  09158 Development and regeneration
   04360 Axon guidance
    112929848 (WNT4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112929848 (WNT4)
   05205 Proteoglycans in cancer
    112929848 (WNT4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112929848 (WNT4)
   05226 Gastric cancer
    112929848 (WNT4)
   05217 Basal cell carcinoma
    112929848 (WNT4)
   05224 Breast cancer
    112929848 (WNT4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112929848 (WNT4)
   05022 Pathways of neurodegeneration - multiple diseases
    112929848 (WNT4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112929848 (WNT4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112929848 (WNT4)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Morphogens
   112929848 (WNT4)
SSDB
Motif
Pfam: wnt MEF2_binding
Other DBs
NCBI-GeneID: 112929848
NCBI-ProteinID: XP_025867920
UniProt: A0A3Q7UKT0
LinkDB
Position
Unknown
AA seq 360 aa
MRRFPEPWAGHSLGLAVEGGGRSTARRSTPRPLPRYLAKLSSVGSISEEETCEKLKGLIQ
RQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAF
VYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVD
VRERSKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVG
HALKEKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDMRSGVLGT
RGRTCNKTSKAIDGCELLCCGRGFHTAQVELAERCSCKFHWCCFVKCRQCQRLVELHTCR
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaggcggttcccagagccctgggctgggcacagcctgggcctggcagtggaaggagga
ggaaggagcactgcacggcgttccaccccccgccctctccccaggtacctggccaagctg
tcctcggtggggagcatctcggaggaggagacgtgcgagaagctcaagggcctgatccag
aggcaggtgcagatgtgtaagcggaacctggaggtgatggactcggtgcgccggggcgcc
cagctggccatcgaggagtgccagtaccagttccggaaccggcgctggaactgctccacg
ctcgactccctgcccgtcttcggcaaggtggtgacgcaagggactcgggaggcggccttc
gtgtacgccatctcgtcagcaggtgtggccttcgccgtgacgcgggcgtgcagcagtggg
gagctggagaagtgcggctgtgaccggacggtgcacggggtcagcccgcagggcttccag
tggtcggggtgctcggacaacatcgcctacggcgtggccttctcccagtccttcgtggac
gtgcgggagagaagcaagggggcctcgtccagccgcgccctcatgaacctccacaacaac
gaggctggcaggaaggctatcctgacacacatgcgggtggagtgcaagtgccacggggtg
tcgggctcctgtgaggtaaagacgtgctggcgagccgtgccgcccttccgccaggtgggc
cacgcactgaaggagaagttcgatggcgccaccgaggtggagccgcgccgtgtgggctcc
tccagggcactggtgccacgcaacgcacagttcaagccgcacacggacgaggacctggta
tatttggagcccagcccggacttctgcgagcaggacatgcgcagcggcgtgctgggcacg
cggggccgcacgtgcaacaagacgtccaaggccatcgacggctgtgagctgctgtgctgt
ggccgcggcttccacacggcgcaggtggagctggccgagcgctgcagctgcaagttccac
tggtgctgcttcgtcaagtgccggcagtgccagcggctggtggagctgcacacgtgccgg
tga

KEGG   Vulpes vulpes (red fox): 112929869
Entry
112929869         CDS       T05911                                 

Gene name
WNT2
Definition
(RefSeq) protein Wnt-2
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112929869 (WNT2)
   04390 Hippo signaling pathway
    112929869 (WNT2)
   04150 mTOR signaling pathway
    112929869 (WNT2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112929869 (WNT2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112929869 (WNT2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112929869 (WNT2)
   05205 Proteoglycans in cancer
    112929869 (WNT2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112929869 (WNT2)
   05226 Gastric cancer
    112929869 (WNT2)
   05217 Basal cell carcinoma
    112929869 (WNT2)
   05224 Breast cancer
    112929869 (WNT2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112929869 (WNT2)
   05022 Pathways of neurodegeneration - multiple diseases
    112929869 (WNT2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112929869 (WNT2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112929869 (WNT2)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Morphogens
   112929869 (WNT2)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 112929869
NCBI-ProteinID: XP_025867930
UniProt: A0A3Q7UKU0
LinkDB
Position
Unknown
AA seq 360 aa
MNAPVGGTGLWLPLLLAWLAPGVGASWWYMRATGGSSRVMCDNVPGLVSRQRQLCHRHPD
VMRAIGLGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAVSSAGVV
FAITRACSQGELKSCSCDPKKKGTAKDSKGSFDWGGCSDNIDYGIKFARAFVDAKERKGK
DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
AIQVVMNQDGTGFTVANKRFKKPTKNDLVYFENSPDYCIRDRDAGSPGTAGRVCNLTSRG
MDSCEVMCCGRGYDTSRVTRMTKCECKFHWCCAVRCQDCLEALDVHTCKAPTSADWAAPT
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgaacgcccctgtcggtggaaccgggctctggctccccctgctcctggcctggctcgcc
cccggggtcggcgcctcgtggtggtacatgagagctacaggcggctcctccagggtgatg
tgtgacaatgtgccaggcctggtgagccgccagcgccagctgtgccaccgacacccggac
gtgatgcgtgccattggcctgggcgtggccgagtggacagcagagtgccagcaccagttc
cgccagcaccgctggaactgcaacacgctggacagggatcacagcctctttggcagggtc
ctgctccgaagtagtcgggaatctgcctttgtttacgccgtctcctcagctggagttgtg
tttgccatcaccagggcctgtagccaaggagagttaaaatcctgttcctgtgatccaaag
aagaagggaaccgccaaggacagcaagggcagtttcgactggggtggctgcagcgataac
attgactatgggatcaaatttgcccgagccttcgtggatgccaaggaaaggaagggaaag
gatgccagagccctgatgaaccttcacaacaacagagccggccggaaggcggtgaagcgg
ttcttgaagcaggaatgcaagtgtcacggcgtgagcggctcgtgtacgctgaggacatgc
tggctggccatggcggacttcagaaaaacgggcgattacctctggaggaagtacaacggg
gccatccaggtcgtcatgaaccaggatggcacggggttcacggtggctaacaagaggttc
aagaagccaaccaaaaatgacctcgtgtattttgagaattctccagactattgtatcagg
gaccgagacgcaggctccccggggacggcgggccgcgtgtgcaacctgacttcccgcggc
atggacagctgcgaggtcatgtgctgcgggagaggctacgacacgtcccgcgtcacgcgg
atgaccaagtgcgagtgtaagttccactggtgctgcgccgtgcgctgtcaggactgcctg
gaggccctagacgtgcacacatgcaaggcccccacgagcgccgactgggcggctcccaca
tga

KEGG   Vulpes vulpes (red fox): 112935842
Entry
112935842         CDS       T05911                                 

Gene name
WNT7B
Definition
(RefSeq) protein Wnt-7b isoform X1
  KO
K00572  wingless-type MMTV integration site family, member 7
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112935842 (WNT7B)
   04390 Hippo signaling pathway
    112935842 (WNT7B)
   04150 mTOR signaling pathway
    112935842 (WNT7B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112935842 (WNT7B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112935842 (WNT7B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112935842 (WNT7B)
   05205 Proteoglycans in cancer
    112935842 (WNT7B)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112935842 (WNT7B)
   05226 Gastric cancer
    112935842 (WNT7B)
   05217 Basal cell carcinoma
    112935842 (WNT7B)
   05224 Breast cancer
    112935842 (WNT7B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112935842 (WNT7B)
   05022 Pathways of neurodegeneration - multiple diseases
    112935842 (WNT7B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112935842 (WNT7B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112935842 (WNT7B)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Morphogens
   112935842 (WNT7B)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 112935842
NCBI-ProteinID: XP_025875562
UniProt: A0A3Q7UQQ4
LinkDB
Position
Unknown
AA seq 356 aa
MAQPPSLDHAQKLSQVDFLRVSLLWRPLREARSAVIRCGPGSQHHLQQDSWLGPAAARHL
PEPARCHHRDRGGGTDGHQRVPVPVPLRTLELLRPRREDCLRARAPRSREAAFTYAITAA
GVAHAVTAACSQGNLSNCGCDREKQGYYNQAEGWKWGGCSADVRYGIDFSRRFVDAREIK
KNARRLMNLHNNEAGRKVLEERMKLECKCHGVSGSCTTKTCWTTLPKFREVGHMLKEKYN
AAVQVEVVRASRLRQPTFLRIKQLRSYQKPMETDLVYIEKSPNYCEEDAATGSVGTQGRL
CNRTSPGADGCDTMCCGRGYNTHQYTKVWQCNCKFHWCCFVKCNTCSERTEVFTCK
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggcgcagcccccctccctggatcatgcacagaaactttcgcaagtggattttctacgt
gtttctctgctttggcgtcctctacgtgaagctcggagcgctgtcatccgttgtggccct
gggagccaacatcatctgcaacaagattcctggcttggccccgcggcagcgcgccatctg
ccagagccggcccgatgccatcatcgtgatcggggagggggcacagatgggcatcaacga
gtgccagtaccagttccgcttcggacgctggaactgctccgccctcggcgagaagactgt
cttcgggcaagagctccgaggagccgcgaggcggccttcacctacgccatcactgcggcc
ggggtggcccatgccgtgacggccgcctgcagccagggtaacctgagcaactgcggctgt
gaccgcgagaagcagggctactacaaccaggccgagggctggaagtggggtggctgctcc
gccgacgtgcgctacggcatcgacttctcccggcgcttcgtggacgcccgtgagatcaag
aagaacgcgcggcgcctcatgaacctgcacaacaacgaggccggcaggaaggtcctggag
gagcgcatgaagctggagtgcaagtgccacggcgtgtcgggctcatgcaccaccaagacg
tgctggaccacgctgcccaagttccgcgaggtgggccacatgctgaaggagaagtacaac
gcggcggtgcaggtggaggtggtgcgggccagccgcctgcggcagcccaccttcctgcgc
atcaagcagctgcgcagctaccagaagcccatggagacggacctggtgtacatcgagaag
tcgcccaactactgcgaggaggacgcggccacgggcagtgtgggcacgcagggccgcctg
tgcaaccgcacgtcgccgggcgcggatggctgcgacaccatgtgctgcggccgaggctac
aacacgcaccagtacaccaaggtgtggcagtgcaactgcaagttccactggtgctgcttc
gtcaagtgtaacacctgcagcgagcgcaccgaggtcttcacctgcaagtga

DBGET integrated database retrieval system