KEGG   Vulpes vulpes (red fox): 112908063
Entry
112908063         CDS       T05911                                 

Gene name
PRKACA
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01522  Endocrine resistance
vvp04010  MAPK signaling pathway
vvp04014  Ras signaling pathway
vvp04020  Calcium signaling pathway
vvp04024  cAMP signaling pathway
vvp04062  Chemokine signaling pathway
vvp04114  Oocyte meiosis
vvp04140  Autophagy - animal
vvp04211  Longevity regulating pathway
vvp04213  Longevity regulating pathway - multiple species
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04270  Vascular smooth muscle contraction
vvp04310  Wnt signaling pathway
vvp04340  Hedgehog signaling pathway
vvp04371  Apelin signaling pathway
vvp04530  Tight junction
vvp04540  Gap junction
vvp04611  Platelet activation
vvp04713  Circadian entrainment
vvp04714  Thermogenesis
vvp04720  Long-term potentiation
vvp04723  Retrograde endocannabinoid signaling
vvp04724  Glutamatergic synapse
vvp04725  Cholinergic synapse
vvp04726  Serotonergic synapse
vvp04727  GABAergic synapse
vvp04728  Dopaminergic synapse
vvp04740  Olfactory transduction
vvp04742  Taste transduction
vvp04750  Inflammatory mediator regulation of TRP channels
vvp04910  Insulin signaling pathway
vvp04911  Insulin secretion
vvp04912  GnRH signaling pathway
vvp04913  Ovarian steroidogenesis
vvp04914  Progesterone-mediated oocyte maturation
vvp04915  Estrogen signaling pathway
vvp04916  Melanogenesis
vvp04918  Thyroid hormone synthesis
vvp04919  Thyroid hormone signaling pathway
vvp04921  Oxytocin signaling pathway
vvp04922  Glucagon signaling pathway
vvp04923  Regulation of lipolysis in adipocytes
vvp04924  Renin secretion
vvp04925  Aldosterone synthesis and secretion
vvp04926  Relaxin signaling pathway
vvp04927  Cortisol synthesis and secretion
vvp04928  Parathyroid hormone synthesis, secretion and action
vvp04934  Cushing syndrome
vvp04935  Growth hormone synthesis, secretion and action
vvp04961  Endocrine and other factor-regulated calcium reabsorption
vvp04962  Vasopressin-regulated water reabsorption
vvp04970  Salivary secretion
vvp04971  Gastric acid secretion
vvp04976  Bile secretion
vvp05012  Parkinson disease
vvp05020  Prion disease
vvp05030  Cocaine addiction
vvp05031  Amphetamine addiction
vvp05032  Morphine addiction
vvp05034  Alcoholism
vvp05146  Amoebiasis
vvp05163  Human cytomegalovirus infection
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
vvp05205  Proteoglycans in cancer
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112908063 (PRKACA)
   04014 Ras signaling pathway
    112908063 (PRKACA)
   04310 Wnt signaling pathway
    112908063 (PRKACA)
   04340 Hedgehog signaling pathway
    112908063 (PRKACA)
   04371 Apelin signaling pathway
    112908063 (PRKACA)
   04020 Calcium signaling pathway
    112908063 (PRKACA)
   04024 cAMP signaling pathway
    112908063 (PRKACA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112908063 (PRKACA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    112908063 (PRKACA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112908063 (PRKACA)
   04540 Gap junction
    112908063 (PRKACA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112908063 (PRKACA)
   04062 Chemokine signaling pathway
    112908063 (PRKACA)
  09152 Endocrine system
   04911 Insulin secretion
    112908063 (PRKACA)
   04910 Insulin signaling pathway
    112908063 (PRKACA)
   04922 Glucagon signaling pathway
    112908063 (PRKACA)
   04923 Regulation of lipolysis in adipocytes
    112908063 (PRKACA)
   04912 GnRH signaling pathway
    112908063 (PRKACA)
   04913 Ovarian steroidogenesis
    112908063 (PRKACA)
   04915 Estrogen signaling pathway
    112908063 (PRKACA)
   04914 Progesterone-mediated oocyte maturation
    112908063 (PRKACA)
   04921 Oxytocin signaling pathway
    112908063 (PRKACA)
   04926 Relaxin signaling pathway
    112908063 (PRKACA)
   04935 Growth hormone synthesis, secretion and action
    112908063 (PRKACA)
   04918 Thyroid hormone synthesis
    112908063 (PRKACA)
   04919 Thyroid hormone signaling pathway
    112908063 (PRKACA)
   04928 Parathyroid hormone synthesis, secretion and action
    112908063 (PRKACA)
   04916 Melanogenesis
    112908063 (PRKACA)
   04924 Renin secretion
    112908063 (PRKACA)
   04925 Aldosterone synthesis and secretion
    112908063 (PRKACA)
   04927 Cortisol synthesis and secretion
    112908063 (PRKACA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112908063 (PRKACA)
   04270 Vascular smooth muscle contraction
    112908063 (PRKACA)
  09154 Digestive system
   04970 Salivary secretion
    112908063 (PRKACA)
   04971 Gastric acid secretion
    112908063 (PRKACA)
   04976 Bile secretion
    112908063 (PRKACA)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    112908063 (PRKACA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    112908063 (PRKACA)
  09156 Nervous system
   04724 Glutamatergic synapse
    112908063 (PRKACA)
   04727 GABAergic synapse
    112908063 (PRKACA)
   04725 Cholinergic synapse
    112908063 (PRKACA)
   04728 Dopaminergic synapse
    112908063 (PRKACA)
   04726 Serotonergic synapse
    112908063 (PRKACA)
   04720 Long-term potentiation
    112908063 (PRKACA)
   04723 Retrograde endocannabinoid signaling
    112908063 (PRKACA)
  09157 Sensory system
   04740 Olfactory transduction
    112908063 (PRKACA)
   04742 Taste transduction
    112908063 (PRKACA)
   04750 Inflammatory mediator regulation of TRP channels
    112908063 (PRKACA)
  09149 Aging
   04211 Longevity regulating pathway
    112908063 (PRKACA)
   04213 Longevity regulating pathway - multiple species
    112908063 (PRKACA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112908063 (PRKACA)
   04714 Thermogenesis
    112908063 (PRKACA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112908063 (PRKACA)
   05205 Proteoglycans in cancer
    112908063 (PRKACA)
   05203 Viral carcinogenesis
    112908063 (PRKACA)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    112908063 (PRKACA)
   05020 Prion disease
    112908063 (PRKACA)
  09165 Substance dependence
   05030 Cocaine addiction
    112908063 (PRKACA)
   05031 Amphetamine addiction
    112908063 (PRKACA)
   05032 Morphine addiction
    112908063 (PRKACA)
   05034 Alcoholism
    112908063 (PRKACA)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    112908063 (PRKACA)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112908063 (PRKACA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112908063 (PRKACA)
   05163 Human cytomegalovirus infection
    112908063 (PRKACA)
   05165 Human papillomavirus infection
    112908063 (PRKACA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112908063 (PRKACA)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    112908063 (PRKACA)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     112908063 (PRKACA)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: AGC group
  PKA family
   112908063 (PRKACA)
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     112908063 (PRKACA)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112908063 (PRKACA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 112908063
NCBI-ProteinID: XP_025839230
UniProt: A0A3Q7SCK9
LinkDB
Position
Unknown
AA seq 343 aa
MASNTNDVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGN
HFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMVMEYVPGGE
MFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGF
AKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIY
EKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFATTDWIAIYQ
RKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggcttccaacaccaacgatgtgaaagagttcttagccaaagccaaagaagattttctt
aaaaaatgggaaaatcctgctcagaatacagcccatttggatcagtttgaacgaatcaag
accctcggcacgggctcctttgggcgggtgatgctggtgaagcacaaggagaccgggaac
cactttgccatgaagatcctcgacaaacagaaggtcgtgaagctgaaacagattgagcat
accctgaacgaaaagcgcatcctgcaagcggtcaacttcccgttcctcgtcaaactcgag
ttctccttcaaggacaactcgaatttatacatggtcatggagtatgtgcctggtggggag
atgttctcgcacctgcggcggatcggaaggttcagtgaaccgcatgcccgcttctatgcg
gcccagatcgtcctgaccttcgagtacctgcactcacttgacctcatctaccgggacctg
aagccggagaacctcctcattgaccagcagggctacattcaggtgacagacttcggtttt
gccaagcgtgtaaaaggccgcacctggaccttatgcgggacccccgagtacctggcccca
gagatcatcctgagcaaaggctacaacaaggctgtggactggtgggccctaggggttctc
atctacgagatggccgctggctacccacccttctttgctgaccagcccatccagatctac
gagaagattgtctctgggaaggtgcggttcccgtcccacttcagctctgacctgaaggat
ctgctacggaacctgttgcaggtggacctcaccaaacgcttcgggaacctcaagaatggg
gtgaatgatatcaagaaccacaagtggtttgccacaactgactggatcgccatctatcag
aggaaggtggaagctcccttcataccaaagtttaaaggccctggggacacgagtaatttt
gacgactatgaggaggaagagatccgagtctccatcaatgaaaagtgtggcaaggagttt
actgagttttag

KEGG   Vulpes vulpes (red fox): 112924478
Entry
112924478         CDS       T05911                                 

Gene name
PRKACB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01522  Endocrine resistance
vvp04010  MAPK signaling pathway
vvp04014  Ras signaling pathway
vvp04020  Calcium signaling pathway
vvp04024  cAMP signaling pathway
vvp04062  Chemokine signaling pathway
vvp04114  Oocyte meiosis
vvp04140  Autophagy - animal
vvp04211  Longevity regulating pathway
vvp04213  Longevity regulating pathway - multiple species
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04270  Vascular smooth muscle contraction
vvp04310  Wnt signaling pathway
vvp04340  Hedgehog signaling pathway
vvp04371  Apelin signaling pathway
vvp04530  Tight junction
vvp04540  Gap junction
vvp04611  Platelet activation
vvp04713  Circadian entrainment
vvp04714  Thermogenesis
vvp04720  Long-term potentiation
vvp04723  Retrograde endocannabinoid signaling
vvp04724  Glutamatergic synapse
vvp04725  Cholinergic synapse
vvp04726  Serotonergic synapse
vvp04727  GABAergic synapse
vvp04728  Dopaminergic synapse
vvp04740  Olfactory transduction
vvp04742  Taste transduction
vvp04750  Inflammatory mediator regulation of TRP channels
vvp04910  Insulin signaling pathway
vvp04911  Insulin secretion
vvp04912  GnRH signaling pathway
vvp04913  Ovarian steroidogenesis
vvp04914  Progesterone-mediated oocyte maturation
vvp04915  Estrogen signaling pathway
vvp04916  Melanogenesis
vvp04918  Thyroid hormone synthesis
vvp04919  Thyroid hormone signaling pathway
vvp04921  Oxytocin signaling pathway
vvp04922  Glucagon signaling pathway
vvp04923  Regulation of lipolysis in adipocytes
vvp04924  Renin secretion
vvp04925  Aldosterone synthesis and secretion
vvp04926  Relaxin signaling pathway
vvp04927  Cortisol synthesis and secretion
vvp04928  Parathyroid hormone synthesis, secretion and action
vvp04934  Cushing syndrome
vvp04935  Growth hormone synthesis, secretion and action
vvp04961  Endocrine and other factor-regulated calcium reabsorption
vvp04962  Vasopressin-regulated water reabsorption
vvp04970  Salivary secretion
vvp04971  Gastric acid secretion
vvp04976  Bile secretion
vvp05012  Parkinson disease
vvp05020  Prion disease
vvp05030  Cocaine addiction
vvp05031  Amphetamine addiction
vvp05032  Morphine addiction
vvp05034  Alcoholism
vvp05146  Amoebiasis
vvp05163  Human cytomegalovirus infection
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
vvp05205  Proteoglycans in cancer
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112924478 (PRKACB)
   04014 Ras signaling pathway
    112924478 (PRKACB)
   04310 Wnt signaling pathway
    112924478 (PRKACB)
   04340 Hedgehog signaling pathway
    112924478 (PRKACB)
   04371 Apelin signaling pathway
    112924478 (PRKACB)
   04020 Calcium signaling pathway
    112924478 (PRKACB)
   04024 cAMP signaling pathway
    112924478 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112924478 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    112924478 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112924478 (PRKACB)
   04540 Gap junction
    112924478 (PRKACB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112924478 (PRKACB)
   04062 Chemokine signaling pathway
    112924478 (PRKACB)
  09152 Endocrine system
   04911 Insulin secretion
    112924478 (PRKACB)
   04910 Insulin signaling pathway
    112924478 (PRKACB)
   04922 Glucagon signaling pathway
    112924478 (PRKACB)
   04923 Regulation of lipolysis in adipocytes
    112924478 (PRKACB)
   04912 GnRH signaling pathway
    112924478 (PRKACB)
   04913 Ovarian steroidogenesis
    112924478 (PRKACB)
   04915 Estrogen signaling pathway
    112924478 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    112924478 (PRKACB)
   04921 Oxytocin signaling pathway
    112924478 (PRKACB)
   04926 Relaxin signaling pathway
    112924478 (PRKACB)
   04935 Growth hormone synthesis, secretion and action
    112924478 (PRKACB)
   04918 Thyroid hormone synthesis
    112924478 (PRKACB)
   04919 Thyroid hormone signaling pathway
    112924478 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    112924478 (PRKACB)
   04916 Melanogenesis
    112924478 (PRKACB)
   04924 Renin secretion
    112924478 (PRKACB)
   04925 Aldosterone synthesis and secretion
    112924478 (PRKACB)
   04927 Cortisol synthesis and secretion
    112924478 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112924478 (PRKACB)
   04270 Vascular smooth muscle contraction
    112924478 (PRKACB)
  09154 Digestive system
   04970 Salivary secretion
    112924478 (PRKACB)
   04971 Gastric acid secretion
    112924478 (PRKACB)
   04976 Bile secretion
    112924478 (PRKACB)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    112924478 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    112924478 (PRKACB)
  09156 Nervous system
   04724 Glutamatergic synapse
    112924478 (PRKACB)
   04727 GABAergic synapse
    112924478 (PRKACB)
   04725 Cholinergic synapse
    112924478 (PRKACB)
   04728 Dopaminergic synapse
    112924478 (PRKACB)
   04726 Serotonergic synapse
    112924478 (PRKACB)
   04720 Long-term potentiation
    112924478 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    112924478 (PRKACB)
  09157 Sensory system
   04740 Olfactory transduction
    112924478 (PRKACB)
   04742 Taste transduction
    112924478 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    112924478 (PRKACB)
  09149 Aging
   04211 Longevity regulating pathway
    112924478 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    112924478 (PRKACB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112924478 (PRKACB)
   04714 Thermogenesis
    112924478 (PRKACB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112924478 (PRKACB)
   05205 Proteoglycans in cancer
    112924478 (PRKACB)
   05203 Viral carcinogenesis
    112924478 (PRKACB)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    112924478 (PRKACB)
   05020 Prion disease
    112924478 (PRKACB)
  09165 Substance dependence
   05030 Cocaine addiction
    112924478 (PRKACB)
   05031 Amphetamine addiction
    112924478 (PRKACB)
   05032 Morphine addiction
    112924478 (PRKACB)
   05034 Alcoholism
    112924478 (PRKACB)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    112924478 (PRKACB)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112924478 (PRKACB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112924478 (PRKACB)
   05163 Human cytomegalovirus infection
    112924478 (PRKACB)
   05165 Human papillomavirus infection
    112924478 (PRKACB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112924478 (PRKACB)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    112924478 (PRKACB)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     112924478 (PRKACB)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: AGC group
  PKA family
   112924478 (PRKACB)
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     112924478 (PRKACB)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112924478 (PRKACB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 112924478
NCBI-ProteinID: XP_025860569
UniProt: A0A3Q7SHG7
LinkDB
Position
Unknown
AA seq 397 aa
MAAYKELSCNQYTGTTALQKLEGFASRLFHRHSKGTSHDQKTTLENDSLHFSEHTALWDR
SMKEFLAKAKEDFLKKWENPAPNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKI
LDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYSFKDNSNLYMVMEYVPGGEMFSHLR
RIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKG
RTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSG
KVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEAP
FIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFCEF
NT seq 1194 nt   +upstreamnt  +downstreamnt
atggcagcttataaagaactatcctgtaaccagtatacaggtacaactgctcttcagaaa
ttggaaggttttgctagccgattatttcatagacattctaaaggtacttcacatgatcag
aaaacaactctggaaaatgacagccttcatttctctgaacatactgctttatgggacaga
tcaatgaaagagtttctagccaaagccaaagaagactttctaaagaaatgggaaaatcct
gctccgaataatgccgggttggaggattttgaaaggaaaaaaacccttggaacaggttca
tttggaagagtcatgttggtgaaacataaagccactgaacagtattatgccatgaagatc
ttagataagcagaaggttgttaaactgaagcaaatagagcacaccttgaatgagaaaaga
atattacaggcagtgaattttccttttcttgttcgactggagtactcttttaaggataat
tctaatttatacatggttatggaatatgtccctgggggtgaaatgttttcacatctaaga
agaattggaaggttcagtgaaccccatgcacggttctatgcagctcagatagtgctaaca
ttcgagtacctccactcactagacctcatctacagagatctaaaacctgaaaatctctta
attgaccaccaaggttatatccaggttacagactttgggtttgccaaaagagttaaaggc
agaacttggacattatgtggcactccagaatatttggctccagagataattctcagcaag
ggctacaataaggcagtggattggtgggcattaggagtgttaatctatgaaatggcagct
ggctaccccccattctttgcagatcaaccaattcaaatttatgaaaagattgtttctgga
aaggtccgattcccatcgcacttcagttcagatctcaaggaccttctaaggaacctgctg
caggtggatttgacaaagcggtttggaaacctgaagaatggtgtgagtgatataaaaact
cacaagtggtttgccacaacagattggattgctatttaccagaggaaggtggaagcacca
ttcataccaaagttcagaggctctggagataccagcaactttgatgactatgaagaagaa
gatatccgcgtctctataacagaaaaatgtgcaaaagaattttgtgaattctaa

DBGET integrated database retrieval system