KEGG   Vulpes vulpes (red fox): 112908300
Entry
112908300         CDS       T05911                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta type isoform X1
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp04010  MAPK signaling pathway
vvp04012  ErbB signaling pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04020  Calcium signaling pathway
vvp04062  Chemokine signaling pathway
vvp04064  NF-kappa B signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04070  Phosphatidylinositol signaling system
vvp04071  Sphingolipid signaling pathway
vvp04150  mTOR signaling pathway
vvp04270  Vascular smooth muscle contraction
vvp04310  Wnt signaling pathway
vvp04370  VEGF signaling pathway
vvp04510  Focal adhesion
vvp04540  Gap junction
vvp04613  Neutrophil extracellular trap formation
vvp04650  Natural killer cell mediated cytotoxicity
vvp04662  B cell receptor signaling pathway
vvp04666  Fc gamma R-mediated phagocytosis
vvp04670  Leukocyte transendothelial migration
vvp04713  Circadian entrainment
vvp04720  Long-term potentiation
vvp04723  Retrograde endocannabinoid signaling
vvp04724  Glutamatergic synapse
vvp04725  Cholinergic synapse
vvp04726  Serotonergic synapse
vvp04727  GABAergic synapse
vvp04728  Dopaminergic synapse
vvp04730  Long-term depression
vvp04750  Inflammatory mediator regulation of TRP channels
vvp04911  Insulin secretion
vvp04912  GnRH signaling pathway
vvp04916  Melanogenesis
vvp04918  Thyroid hormone synthesis
vvp04919  Thyroid hormone signaling pathway
vvp04921  Oxytocin signaling pathway
vvp04925  Aldosterone synthesis and secretion
vvp04928  Parathyroid hormone synthesis, secretion and action
vvp04929  GnRH secretion
vvp04931  Insulin resistance
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04935  Growth hormone synthesis, secretion and action
vvp04960  Aldosterone-regulated sodium reabsorption
vvp04961  Endocrine and other factor-regulated calcium reabsorption
vvp04970  Salivary secretion
vvp04971  Gastric acid secretion
vvp04972  Pancreatic secretion
vvp04973  Carbohydrate digestion and absorption
vvp05017  Spinocerebellar ataxia
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05031  Amphetamine addiction
vvp05032  Morphine addiction
vvp05140  Leishmaniasis
vvp05143  African trypanosomiasis
vvp05146  Amoebiasis
vvp05161  Hepatitis B
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05170  Human immunodeficiency virus 1 infection
vvp05171  Coronavirus disease - COVID-19
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05214  Glioma
vvp05223  Non-small cell lung cancer
vvp05225  Hepatocellular carcinoma
vvp05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112908300 (PRKCB)
   04012 ErbB signaling pathway
    112908300 (PRKCB)
   04014 Ras signaling pathway
    112908300 (PRKCB)
   04015 Rap1 signaling pathway
    112908300 (PRKCB)
   04310 Wnt signaling pathway
    112908300 (PRKCB)
   04370 VEGF signaling pathway
    112908300 (PRKCB)
   04064 NF-kappa B signaling pathway
    112908300 (PRKCB)
   04066 HIF-1 signaling pathway
    112908300 (PRKCB)
   04020 Calcium signaling pathway
    112908300 (PRKCB)
   04070 Phosphatidylinositol signaling system
    112908300 (PRKCB)
   04071 Sphingolipid signaling pathway
    112908300 (PRKCB)
   04150 mTOR signaling pathway
    112908300 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112908300 (PRKCB)
   04540 Gap junction
    112908300 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    112908300 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    112908300 (PRKCB)
   04662 B cell receptor signaling pathway
    112908300 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    112908300 (PRKCB)
   04670 Leukocyte transendothelial migration
    112908300 (PRKCB)
   04062 Chemokine signaling pathway
    112908300 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    112908300 (PRKCB)
   04929 GnRH secretion
    112908300 (PRKCB)
   04912 GnRH signaling pathway
    112908300 (PRKCB)
   04921 Oxytocin signaling pathway
    112908300 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    112908300 (PRKCB)
   04918 Thyroid hormone synthesis
    112908300 (PRKCB)
   04919 Thyroid hormone signaling pathway
    112908300 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    112908300 (PRKCB)
   04916 Melanogenesis
    112908300 (PRKCB)
   04925 Aldosterone synthesis and secretion
    112908300 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112908300 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    112908300 (PRKCB)
   04971 Gastric acid secretion
    112908300 (PRKCB)
   04972 Pancreatic secretion
    112908300 (PRKCB)
   04973 Carbohydrate digestion and absorption
    112908300 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112908300 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    112908300 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    112908300 (PRKCB)
   04727 GABAergic synapse
    112908300 (PRKCB)
   04725 Cholinergic synapse
    112908300 (PRKCB)
   04728 Dopaminergic synapse
    112908300 (PRKCB)
   04726 Serotonergic synapse
    112908300 (PRKCB)
   04720 Long-term potentiation
    112908300 (PRKCB)
   04730 Long-term depression
    112908300 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    112908300 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112908300 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112908300 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112908300 (PRKCB)
   05206 MicroRNAs in cancer
    112908300 (PRKCB)
   05205 Proteoglycans in cancer
    112908300 (PRKCB)
   05231 Choline metabolism in cancer
    112908300 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112908300 (PRKCB)
   05214 Glioma
    112908300 (PRKCB)
   05223 Non-small cell lung cancer
    112908300 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    112908300 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    112908300 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    112908300 (PRKCB)
   05032 Morphine addiction
    112908300 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    112908300 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112908300 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112908300 (PRKCB)
   05161 Hepatitis B
    112908300 (PRKCB)
   05171 Coronavirus disease - COVID-19
    112908300 (PRKCB)
   05164 Influenza A
    112908300 (PRKCB)
   05163 Human cytomegalovirus infection
    112908300 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112908300 (PRKCB)
   05140 Leishmaniasis
    112908300 (PRKCB)
   05143 African trypanosomiasis
    112908300 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112908300 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112908300 (PRKCB)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     112908300 (PRKCB)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   112908300 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 112908300
NCBI-ProteinID: XP_025839556
UniProt: A0A3Q7RBT0
LinkDB
Position
Unknown
AA seq 673 aa
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHRFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIEREVLIVVVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKAGVDGWFKLLSQEEGEYFNVPVPPEGSEGNEE
LRQKFERAKISQGTKAPEEKTTNTISKLDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFS
FVNSEFLKPEVKS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggctgacccggctgcggggccgccgccgagcgagggcgaggagagcaccgtgcgcttc
gcccgcaaaggcgccctccggcagaagaacgtgcacgaggtgaagaaccacagattcacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcaaggattccagtgccaagtctgctgtttcgtcgtgcacaagcggtgccatgaa
tttgtcactttctcctgcccaggcgctgacaagggcccagcctctgatgaccctcggagc
aaacacaagtttaagatccacacatactccagccccacgttctgtgaccactgtggctca
ctgctgtatggactcatccaccaggggatgaaatgtgacacctgcatgatgaacgtgcac
aagcgctgcgtgatgaacgtccccagcctgtgcggcactgaccacacggagcgccgcggt
cgcatctacatccaggcccacatcgagagggaagtcctcatcgttgtcgtaagagatgct
aaaaaccttgtacctatggaccccaatggcttgtcagacccttatgtgaagctgaaactg
attcctgaccccaagagtgagagcaagcagaagaccaaaaccatcaagtgctccctcaac
cctgagtggaatgaaacattcagattccaactgaaagaatcggacaaagacagaagactg
tctgtagagatttgggattgggatctgaccagcaggaatgacttcatgggatctttgtcg
tttgggatttctgaactgcagaaagctggtgttgatggctggtttaagttgctgagccag
gaggaaggcgagtacttcaatgtacctgtgccgccggaaggaagtgagggcaatgaggaa
ctacggcagaaattcgagagagccaagatcagccaggggaccaaggctccagaagaaaag
acgaccaacaccatatccaaacttgacaacaatggaaacagagaccgaatgaaactgacg
gattttaactttctgatggtgctggggaaaggaagctttggcaaggtcatgctctcagag
cgaaaaggcacagacgagctctatgccgtgaagatcctgaagaaggatgttgtgatccag
gatgacgatgtggaatgtacgatggtggagaaacgggtgctcgccctgcctgggaagcca
cccttcctgacccagctccattcctgcttccagaccatggaccgcctgtactttgtgatg
gagtacgtgaacgggggtgacctcatgtaccacatccaacaagttggccggtttaaggag
cctcatgctgtattttacgctgcagaaattgccatcggtctgttcttcttacagagcaag
ggcatcatttaccgtgacctcaaacttgacaatgtgatgctggattcagagggccacatc
aagattgctgattttggcatgtgtaaggaaaacatctgggatggggtgaccaccaagaca
ttctgtggcactccagactacatcgcccctgagataatcgcctatcagccctatgggaag
tctgtggattggtgggcattcggagtcctgctgtatgaaatgttggctgggcaggcaccc
tttgaaggggaggatgaggatgagctcttccagtccatcatggaacacaatgtggcttac
ccaaagtccatgtccaaggaagctgtggccatctgcaaagggctgatgaccaaacacccg
ggcaagcgtctgggttgtggacctgaaggtgaacgtgacatcaaagagcatgcatttttc
cggtacattgattgggagaaacttgaacgcaaagagattcagcccccatataagccaaaa
gcctgtgggcgaaatgctgaaaacttcgaccggtttttcactcgtcatccaccagtccta
acacctcccgaccaggaagtcatcaggaatattgaccagtcagaattcgaaggattttcc
tttgttaactctgaatttttaaaacctgaagtcaagagctaa

KEGG   Vulpes vulpes (red fox): 112909321
Entry
112909321         CDS       T05911                                 

Gene name
PRKCG
Definition
(RefSeq) protein kinase C gamma type isoform X1
  KO
K19663  classical protein kinase C gamma type [EC:2.7.11.13]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp04010  MAPK signaling pathway
vvp04012  ErbB signaling pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04020  Calcium signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04070  Phosphatidylinositol signaling system
vvp04071  Sphingolipid signaling pathway
vvp04150  mTOR signaling pathway
vvp04270  Vascular smooth muscle contraction
vvp04310  Wnt signaling pathway
vvp04370  VEGF signaling pathway
vvp04510  Focal adhesion
vvp04540  Gap junction
vvp04613  Neutrophil extracellular trap formation
vvp04650  Natural killer cell mediated cytotoxicity
vvp04666  Fc gamma R-mediated phagocytosis
vvp04670  Leukocyte transendothelial migration
vvp04713  Circadian entrainment
vvp04720  Long-term potentiation
vvp04723  Retrograde endocannabinoid signaling
vvp04724  Glutamatergic synapse
vvp04725  Cholinergic synapse
vvp04726  Serotonergic synapse
vvp04727  GABAergic synapse
vvp04728  Dopaminergic synapse
vvp04730  Long-term depression
vvp04750  Inflammatory mediator regulation of TRP channels
vvp04911  Insulin secretion
vvp04916  Melanogenesis
vvp04918  Thyroid hormone synthesis
vvp04919  Thyroid hormone signaling pathway
vvp04921  Oxytocin signaling pathway
vvp04925  Aldosterone synthesis and secretion
vvp04928  Parathyroid hormone synthesis, secretion and action
vvp04929  GnRH secretion
vvp04935  Growth hormone synthesis, secretion and action
vvp04960  Aldosterone-regulated sodium reabsorption
vvp04961  Endocrine and other factor-regulated calcium reabsorption
vvp04970  Salivary secretion
vvp04971  Gastric acid secretion
vvp04972  Pancreatic secretion
vvp05017  Spinocerebellar ataxia
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05031  Amphetamine addiction
vvp05032  Morphine addiction
vvp05143  African trypanosomiasis
vvp05146  Amoebiasis
vvp05161  Hepatitis B
vvp05163  Human cytomegalovirus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05171  Coronavirus disease - COVID-19
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05214  Glioma
vvp05223  Non-small cell lung cancer
vvp05225  Hepatocellular carcinoma
vvp05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112909321 (PRKCG)
   04012 ErbB signaling pathway
    112909321 (PRKCG)
   04014 Ras signaling pathway
    112909321 (PRKCG)
   04015 Rap1 signaling pathway
    112909321 (PRKCG)
   04310 Wnt signaling pathway
    112909321 (PRKCG)
   04370 VEGF signaling pathway
    112909321 (PRKCG)
   04066 HIF-1 signaling pathway
    112909321 (PRKCG)
   04020 Calcium signaling pathway
    112909321 (PRKCG)
   04070 Phosphatidylinositol signaling system
    112909321 (PRKCG)
   04071 Sphingolipid signaling pathway
    112909321 (PRKCG)
   04150 mTOR signaling pathway
    112909321 (PRKCG)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112909321 (PRKCG)
   04540 Gap junction
    112909321 (PRKCG)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    112909321 (PRKCG)
   04650 Natural killer cell mediated cytotoxicity
    112909321 (PRKCG)
   04666 Fc gamma R-mediated phagocytosis
    112909321 (PRKCG)
   04670 Leukocyte transendothelial migration
    112909321 (PRKCG)
  09152 Endocrine system
   04911 Insulin secretion
    112909321 (PRKCG)
   04929 GnRH secretion
    112909321 (PRKCG)
   04921 Oxytocin signaling pathway
    112909321 (PRKCG)
   04935 Growth hormone synthesis, secretion and action
    112909321 (PRKCG)
   04918 Thyroid hormone synthesis
    112909321 (PRKCG)
   04919 Thyroid hormone signaling pathway
    112909321 (PRKCG)
   04928 Parathyroid hormone synthesis, secretion and action
    112909321 (PRKCG)
   04916 Melanogenesis
    112909321 (PRKCG)
   04925 Aldosterone synthesis and secretion
    112909321 (PRKCG)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112909321 (PRKCG)
  09154 Digestive system
   04970 Salivary secretion
    112909321 (PRKCG)
   04971 Gastric acid secretion
    112909321 (PRKCG)
   04972 Pancreatic secretion
    112909321 (PRKCG)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112909321 (PRKCG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    112909321 (PRKCG)
  09156 Nervous system
   04724 Glutamatergic synapse
    112909321 (PRKCG)
   04727 GABAergic synapse
    112909321 (PRKCG)
   04725 Cholinergic synapse
    112909321 (PRKCG)
   04728 Dopaminergic synapse
    112909321 (PRKCG)
   04726 Serotonergic synapse
    112909321 (PRKCG)
   04720 Long-term potentiation
    112909321 (PRKCG)
   04730 Long-term depression
    112909321 (PRKCG)
   04723 Retrograde endocannabinoid signaling
    112909321 (PRKCG)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112909321 (PRKCG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112909321 (PRKCG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112909321 (PRKCG)
   05206 MicroRNAs in cancer
    112909321 (PRKCG)
   05205 Proteoglycans in cancer
    112909321 (PRKCG)
   05231 Choline metabolism in cancer
    112909321 (PRKCG)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112909321 (PRKCG)
   05214 Glioma
    112909321 (PRKCG)
   05223 Non-small cell lung cancer
    112909321 (PRKCG)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    112909321 (PRKCG)
   05022 Pathways of neurodegeneration - multiple diseases
    112909321 (PRKCG)
  09165 Substance dependence
   05031 Amphetamine addiction
    112909321 (PRKCG)
   05032 Morphine addiction
    112909321 (PRKCG)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112909321 (PRKCG)
   05161 Hepatitis B
    112909321 (PRKCG)
   05171 Coronavirus disease - COVID-19
    112909321 (PRKCG)
   05163 Human cytomegalovirus infection
    112909321 (PRKCG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112909321 (PRKCG)
   05143 African trypanosomiasis
    112909321 (PRKCG)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112909321 (PRKCG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112909321 (PRKCG)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     112909321 (PRKCG)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   112909321 (PRKCG)
SSDB
Motif
Pfam: Pkinase C1_1 PK_Tyr_Ser-Thr C2 Pkinase_C Kinase-like
Other DBs
NCBI-GeneID: 112909321
NCBI-ProteinID: XP_025840990
UniProt: A0A3Q7SGZ7
LinkDB
Position
Unknown
AA seq 697 aa
MAGLGPGGGDSEGGPRPLFCRKGALRQKVVHEVKSHKFTARFFKQPTFCSHCTDFIWGIG
KQGLQCQVCSFVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL
LYGLVHQGMKCSCCEMNVHRRCVRSVPSLCGVDHTERRGRLQLEIRAPTADEIHVTVGEA
RNLIPMDPNGLSDPYVKLKLIPDPRNLTKQKTRTVKATLNPVWNETFVFNLKPGDVERRL
SVEVWDWDRTSRNDFMGAMSFGVSELLKAPVDGWYKLLNQEEGEYYNVPVADADNCSLLQ
KFEACNYPLELYERVRMGPSSSPIPSPSPSPTDSKRCFFGTSPGRLHISDFSFLMVLGKG
SFGKVMLAERRGSDELYAIKILKKDVIVQDDDVDCTLVEKRVLALGGRGPGGRPHFLTQL
HSTFQTPDRLYFVMEYVTGGDLMYHIQQLGKFKEPHAAFYAAEIAIGLFFLHNQGIIYRD
LKLDNVMLDAEGHIKITDFGMCKENVFPGTTTRTFCGTPDYIAPEIIAYQPYGKSVDWWS
FGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKGFLTKHPAKRLGS
GPDGEPAIRAHGFFRWMDWERLERLEIAPPFRPRPCGRSGENFDKFFTRAAPALTPPDRL
VLASIDQADFQGFTYVNPDFVHPDARSPISPPAVPVM
NT seq 2094 nt   +upstreamnt  +downstreamnt
atggcaggcctgggccccggcggaggcgattcagaggggggaccccggcccctgttttgc
agaaagggggctctgaggcagaaggtggtccacgaagtcaagagtcacaagttcaccgcc
cgcttcttcaagcagccaaccttctgcagccactgcaccgacttcatctggggcattgga
aaacagggcctgcaatgtcaagtctgcagctttgtggttcatcgacgatgccacgaattt
gtgaccttcgagtgtccaggcgctgggaagggcccccagacggatgacccccgcaacaag
cataagttccgtctacacagctacagcagccccaccttttgcgaccactgtggctccctg
ctctacgggctggtgcaccagggcatgaaatgctcctgctgcgagatgaacgtgcaccga
cgctgtgtgcgcagcgtgccttctctgtgcggggtggaccacaccgagcgccgtgggcgc
ctgcagctggaaatccgagcacctactgcagatgaaattcatgtcacagttggcgaggcc
cgtaacctcatcccaatggatcccaatggtctgtctgatccctatgtgaagctgaagctc
atcccagaccctcggaacttgacaaagcagaagacccggacggtgaaagccacgctaaac
cctgtgtggaacgagaccttcgtgttcaacctgaagccgggggacgtggagcgccggctc
agcgtggaggtgtgggactgggaccggacttcccgcaacgatttcatgggtgccatgtcc
ttcggggtctcggagctgctcaaggcacccgtggatggctggtacaagttactgaaccag
gaggagggcgagtattacaatgtgcccgtggctgatgctgacaactgcagcctcctccag
aagtttgaggcctgtaactaccccctggaactgtatgaacgggtgcggatgggtccctct
tcctctcccatcccctctccatcccctagtcccaccgactccaagcgctgtttctttggg
acaagccccggacgtctgcacatctctgacttcagcttcctcatggttctaggaaaaggc
agttttgggaaggtgatgctggctgagcgcaggggctcagatgagctctacgccatcaag
atcctgaagaaggatgtgattgtccaggatgatgatgtggactgcaccctggtggagaag
cgagtgctggccctggggggccgaggcccgggaggccggccccactttctcacccaactg
cactccactttccagaccccggatcgcctgtattttgtgatggagtatgtcaccggaggc
gacttgatgtaccacattcagcagttgggcaaatttaaggagcctcatgcagcgttctac
gctgccgaaatcgccatcgggctcttcttcctgcacaatcagggcatcatctaccgggac
ttgaagctagacaacgtgatgcttgatgccgaaggacacatcaaaatcactgactttggc
atgtgtaaggaaaacgtctttcccggaaccacaacccgcactttctgcgggaccccagac
tacatagcccctgagatcatcgcctaccagccctacgggaagtctgttgattggtggtcc
tttggggttctgctgtatgagatgctggcgggacagcccccttttgatggggaggatgag
gaagagctctttcaggccatcatggaacaaacagtcacttaccccaagtcgctttcccgg
gaagctgtggcgatctgcaaggggttcctaaccaagcacccagcgaagcgcctgggctcg
gggccagacggggagcctgccatccgtgctcacggctttttccgctggatggactgggag
cgcttggaacgactggagatcgcacctccgttcagaccccgcccgtgtggacgcagcggc
gagaacttcgacaaattcttcacgcgggccgcgccagcgctgaccccgccagaccgccta
gttttggccagcatcgaccaggccgatttccaaggcttcacctacgtcaacccggatttc
gtgcacccggacgcccgcagccccatcagcccaccggctgtgcccgtcatgtaa

KEGG   Vulpes vulpes (red fox): 112920728
Entry
112920728         CDS       T05911                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha type
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp04010  MAPK signaling pathway
vvp04012  ErbB signaling pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04020  Calcium signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04070  Phosphatidylinositol signaling system
vvp04071  Sphingolipid signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04270  Vascular smooth muscle contraction
vvp04310  Wnt signaling pathway
vvp04360  Axon guidance
vvp04370  VEGF signaling pathway
vvp04510  Focal adhesion
vvp04540  Gap junction
vvp04613  Neutrophil extracellular trap formation
vvp04650  Natural killer cell mediated cytotoxicity
vvp04664  Fc epsilon RI signaling pathway
vvp04666  Fc gamma R-mediated phagocytosis
vvp04670  Leukocyte transendothelial migration
vvp04713  Circadian entrainment
vvp04720  Long-term potentiation
vvp04723  Retrograde endocannabinoid signaling
vvp04724  Glutamatergic synapse
vvp04725  Cholinergic synapse
vvp04726  Serotonergic synapse
vvp04727  GABAergic synapse
vvp04728  Dopaminergic synapse
vvp04730  Long-term depression
vvp04750  Inflammatory mediator regulation of TRP channels
vvp04911  Insulin secretion
vvp04912  GnRH signaling pathway
vvp04916  Melanogenesis
vvp04918  Thyroid hormone synthesis
vvp04919  Thyroid hormone signaling pathway
vvp04921  Oxytocin signaling pathway
vvp04925  Aldosterone synthesis and secretion
vvp04926  Relaxin signaling pathway
vvp04928  Parathyroid hormone synthesis, secretion and action
vvp04929  GnRH secretion
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04935  Growth hormone synthesis, secretion and action
vvp04960  Aldosterone-regulated sodium reabsorption
vvp04961  Endocrine and other factor-regulated calcium reabsorption
vvp04970  Salivary secretion
vvp04971  Gastric acid secretion
vvp04972  Pancreatic secretion
vvp05017  Spinocerebellar ataxia
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05031  Amphetamine addiction
vvp05032  Morphine addiction
vvp05143  African trypanosomiasis
vvp05146  Amoebiasis
vvp05161  Hepatitis B
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05170  Human immunodeficiency virus 1 infection
vvp05171  Coronavirus disease - COVID-19
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05214  Glioma
vvp05223  Non-small cell lung cancer
vvp05225  Hepatocellular carcinoma
vvp05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112920728 (PRKCA)
   04012 ErbB signaling pathway
    112920728 (PRKCA)
   04014 Ras signaling pathway
    112920728 (PRKCA)
   04015 Rap1 signaling pathway
    112920728 (PRKCA)
   04310 Wnt signaling pathway
    112920728 (PRKCA)
   04370 VEGF signaling pathway
    112920728 (PRKCA)
   04066 HIF-1 signaling pathway
    112920728 (PRKCA)
   04020 Calcium signaling pathway
    112920728 (PRKCA)
   04070 Phosphatidylinositol signaling system
    112920728 (PRKCA)
   04072 Phospholipase D signaling pathway
    112920728 (PRKCA)
   04071 Sphingolipid signaling pathway
    112920728 (PRKCA)
   04151 PI3K-Akt signaling pathway
    112920728 (PRKCA)
   04150 mTOR signaling pathway
    112920728 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112920728 (PRKCA)
   04540 Gap junction
    112920728 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    112920728 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    112920728 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    112920728 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    112920728 (PRKCA)
   04670 Leukocyte transendothelial migration
    112920728 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    112920728 (PRKCA)
   04929 GnRH secretion
    112920728 (PRKCA)
   04912 GnRH signaling pathway
    112920728 (PRKCA)
   04921 Oxytocin signaling pathway
    112920728 (PRKCA)
   04926 Relaxin signaling pathway
    112920728 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    112920728 (PRKCA)
   04918 Thyroid hormone synthesis
    112920728 (PRKCA)
   04919 Thyroid hormone signaling pathway
    112920728 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    112920728 (PRKCA)
   04916 Melanogenesis
    112920728 (PRKCA)
   04925 Aldosterone synthesis and secretion
    112920728 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112920728 (PRKCA)
   04270 Vascular smooth muscle contraction
    112920728 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    112920728 (PRKCA)
   04971 Gastric acid secretion
    112920728 (PRKCA)
   04972 Pancreatic secretion
    112920728 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112920728 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    112920728 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    112920728 (PRKCA)
   04727 GABAergic synapse
    112920728 (PRKCA)
   04725 Cholinergic synapse
    112920728 (PRKCA)
   04728 Dopaminergic synapse
    112920728 (PRKCA)
   04726 Serotonergic synapse
    112920728 (PRKCA)
   04720 Long-term potentiation
    112920728 (PRKCA)
   04730 Long-term depression
    112920728 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    112920728 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112920728 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    112920728 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    112920728 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112920728 (PRKCA)
   05206 MicroRNAs in cancer
    112920728 (PRKCA)
   05205 Proteoglycans in cancer
    112920728 (PRKCA)
   05231 Choline metabolism in cancer
    112920728 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112920728 (PRKCA)
   05214 Glioma
    112920728 (PRKCA)
   05223 Non-small cell lung cancer
    112920728 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    112920728 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    112920728 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    112920728 (PRKCA)
   05032 Morphine addiction
    112920728 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112920728 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112920728 (PRKCA)
   05161 Hepatitis B
    112920728 (PRKCA)
   05171 Coronavirus disease - COVID-19
    112920728 (PRKCA)
   05164 Influenza A
    112920728 (PRKCA)
   05163 Human cytomegalovirus infection
    112920728 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112920728 (PRKCA)
   05143 African trypanosomiasis
    112920728 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112920728 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112920728 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvp04131]
    112920728 (PRKCA)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     112920728 (PRKCA)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   112920728 (PRKCA)
Membrane trafficking [BR:vvp04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    112920728 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 APH
Other DBs
NCBI-GeneID: 112920728
NCBI-ProteinID: XP_025855407
UniProt: A0A3Q7T5K7
LinkDB
Position
Unknown
AA seq 672 aa
MADVFPANDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVTDEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNVE
LRQKFEKAKLGPAGNKVISPSEDRRQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPGKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggctgacgttttcccggccaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcacgaggtgaaggaccacaaattcatc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggttcacaagaggtgccatgaa
tttgtcactttttcttgtccgggtgcagataagggacccgacactgatgaccccagaagc
aagcacaagtttaaaatccacacttatggaagtcccaccttctgtgatcactgtgggtca
ttgctgtatggacttatccatcaaggaatgaaatgtgacacctgtgatatgaacgtgcac
aagcagtgtgtaataaatgtccccagcctctgcgggatggaccacacggagaagaggggc
cggatctacctgaaggctgaggtcactgatgagaagctccatgtcactgtacgagatgca
aagaatctgattcctatggatccaaatgggctttcagatccttatgtgaagctgaaacta
attcctgatcccaagaatgaaagcaaacagaaaaccaaaaccatccgctctacactgaat
ccccagtggaatgagtcttttacattcaaattaaaaccttcagataaagaccgccggctg
tccgtagagatatgggactgggatcgaacaacaaggaatgatttcatgggctccctttcc
ttcggagtctcagagctgatgaagatgccagccagtggatggtacaagctgcttaaccaa
gaggaaggtgagtactacaatgtacccatcccagaaggggacgaagaaggaaacgtggag
ctcagacagaaattcgagaaagccaagcttggccccgctggtaacaaagtaatcagtcct
tcagaagacaggagacaaccttccaataacctggacagagtgaaactcacagacttcaat
ttcctcatggtgctggggaagggaagttttggaaaggtaatgcttgctgacaggaagggc
acagaggaactgtatgctatcaaaatcctgaagaaggacgtggtgattcaagatgacgac
gtggagtgcaccatggtggagaagcgagtcctggccctgcttgacaagcccccattcctg
acacagctacactcctgcttccagacagtggatcgactgtacttcgtcatggaatacgtc
aacggtggggacctcatgtaccacattcagcaagtaggaaaatttaaggaaccacaagca
gtattttatgcggcagagatttccattggattgttctttcttcataaaagaggaatcatt
tacagggatctgaagttagacaatgtcatgctggattcggaagggcatatcaagattgct
gattttggaatgtgcaaggaacacatgatggatggagtcacaaccaggaccttctgcggg
actccagattacattgccccggagataatcgcttatcagccgtatggaaaatccgtggac
tggtgggcctatggcgtcctattatatgaaatgctagccggacagcctccctttgatggt
gaagatgaagacgagctgtttcagtccataatggagcataacgtttcttatcccaaatcc
ttgtccaaggaggccgtttccatctgcaaaggactgatgaccaaacacccaggcaagcgg
ctgggttgcgggccagagggagagagagacgttcgggagcacgccttcttccggaggatc
gactgggaaaaactcgagaacagggagatccagccacccttcaagcccaaagtgtgtggc
aaaggcgcagaaaactttgacaagttcttcacacgagggcagcctgtcttaacaccacct
gatcagttggtcattgctaacatagaccagtctgatttcgaggggttctcgtatgtcaac
ccccaatttgtgcaccccatcttacagagtgcggtatga

DBGET integrated database retrieval system