KEGG   Vulpes vulpes (red fox): 112908327
Entry
112908327         CDS       T05911                                 

Gene name
EEF2K
Definition
(RefSeq) eukaryotic elongation factor 2 kinase isoform X1
  KO
K08292  elongation factor 2 kinase [EC:2.7.11.20]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04152  AMPK signaling pathway
vvp04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    112908327 (EEF2K)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    112908327 (EEF2K)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112908327 (EEF2K)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     112908327 (EEF2K)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: Other
  Alpha family [OT]
   112908327 (EEF2K)
SSDB
Motif
Pfam: Alpha_kinase Sel1
Other DBs
NCBI-GeneID: 112908327
NCBI-ProteinID: XP_025839582
UniProt: A0A3Q7R2Q2
LinkDB
Position
Unknown
AA seq 725 aa
MADEDLIFRLEGVDGGQTSQAGHDGESEADSDDEEGYFICPITDDPRSHQDVNSKVNNYY
SNLTKSEQYGSSGSPASSFHFKEAWKHAIEKAKHMPDPWAEFHLEDIATECATRHRYNAV
TGEWLEDEVLIKMASQPFGRGAMRECFRTKKLSNFLHTQQWKGASNYVAKRYIESVDRNV
YFEDVCLQMEAKLWGEEYNRHKPPKQVDIMQMCVVELKDRPGKPLFHLEHYIEGKYIKYN
SNSGFVRDDNLRLTPQAFSHFTFERSGHQLIVVDIQGVGDLYTDPQIHTEKGTDFGDGNL
GVRGMALFFYSHACNRICKSMGLAPFDLSPRERDAVNQNTKLLQSAKTILRGTEEKCGSP
RVRTLSGSRPPLLLRLSENSGDENMSDVTFDSLPSSPSSATPHSQKLDHLHWPVFSDLDS
MASREHDHLDNHRDSENSGDSGYPSEKRGELDDPEPREHGHSNGNRKYESDEDSLGSSGR
VCVDKWNLLNPSRLHLSRPSAVALEVQRLNTLNLEKKIGKSILGKVHLAMVRYHEGGRFC
EKGEDWDRESAVFHLEHAADLGELEAIVGLGLMCSQLPHHILADVSLKETEENKTKGFEY
LLKAAEAGDRQSMILVARAFDTGQNLSPDRSQDWPEALHWYNTALEMTDCDEGGEYDGMQ
DEPRYTLLAREAEMLFTGGCGLVKDPQRSGDLYTQAAEAAMEAMKGRLANQYYQKAEEAW
AQMQE
NT seq 2178 nt   +upstreamnt  +downstreamnt
atggcagatgaagacctcattttccgcctggaaggtgttgatggtggccagacctcccag
gctggtcacgacggtgagtctgaggcagacagcgacgatgaggaaggttacttcatctgc
cccatcactgatgaccccaggtcacatcaggatgtcaattccaaggttaataactactac
agcaacctaacaaagagtgagcagtatggctccagtgggtccccggcaagctccttccat
tttaaggaagcttggaagcatgcgattgagaaggccaaacacatgcctgacccctgggct
gagttccacctggaagatattgccacagaatgtgccacacgtcacaggtacaatgctgtc
actggggaatggctggaagatgaagttctgatcaagatggcatctcagcccttcggccgt
ggagcgatgagggagtgcttcaggacaaagaagctctccaactttctgcacactcagcag
tggaaaggagcctccaactacgtggcaaagcgctacattgagtctgtggacaggaatgtg
tactttgaggatgtgtgtctacagatggaggccaagctctggggagaggagtataatcga
cacaagccccccaagcaggtggacatcatgcagatgtgcgtggtagagctgaaggacaga
ccaggcaagccgctcttccacctggagcactacattgagggcaaatacatcaagtacaac
tccaactcaggctttgttcgcgatgacaacctgcgtctgacaccacaggccttcagccac
ttcacatttgagcgttctgggcatcagctgattgtggtagacatccagggtgtgggcgac
ctctacactgacccacagatccacaccgaaaagggcactgacttcggagatggcaaccta
ggtgtccgggggatggcgcttttcttctactctcatgcctgcaaccggatttgcaagagc
atgggcctcgctccctttgacctctcacccagagagagggacgcagtgaatcagaacacc
aagttgctgcagtccgccaagaccatcttgagggggacagaggaaaagtgtgggagcccc
cgagtcaggaccctctctgggagtcgccctcccttgctccttcgcctttcagagaactct
ggagatgagaacatgagtgatgtgacctttgactctctcccttcctccccatcttcggcc
acaccacacagccagaaactggaccacctccattggcctgtgttcagcgaccttgacagc
atggcatcccgagagcatgaccatctggacaaccaccgggactctgagaacagtggagac
agtggataccccagtgagaagcggggtgagctggatgacccagagccccgagaacatggc
cactcaaacggtaaccggaagtacgagtcagacgaagacagcctgggcagctctggacgg
gtctgcgtggacaagtggaatctcctcaacccctcccgcctccacctgtcaagaccttct
gctgtggccctggaagtgcaaaggcttaatactctgaaccttgaaaagaaaatcgggaag
tccattctggggaaggtgcatctggctatggtgcgctaccatgagggtggacgcttctgt
gagaagggcgaggactgggaccgcgagtcagccgtcttccacttggagcacgcagccgac
ctgggcgaactggaggccattgtgggcctggggctgatgtgctcacagctgccccaccac
atcctggctgatgtctctttgaaggagacagaagagaataaaaccaaaggattcgaatac
ttactgaaggcagctgaagctggcgacagacagtccatgatcctggtggctcgggctttt
gacaccggccagaatctcagcccagacaggtcccaggactggccagaggctctgcactgg
tacaacactgccctggagatgacagattgtgatgagggaggcgagtatgatgggatgcaa
gatgagcctcggtacacgctgctggcccgggaggctgagatgctgttcaccggcggctgc
gggctagtgaaggacccacagagatcaggcgacttgtacacacaggcagccgaagcggcg
atggaagccatgaagggccggctggccaaccagtactaccagaaggcggaggaggcctgg
gcgcagatgcaggagtag

DBGET integrated database retrieval system