KEGG   Vulpes vulpes (red fox): 112908482
Entry
112908482         CDS       T05911                                 

Gene name
TP53I3
Definition
(RefSeq) quinone oxidoreductase PIG3
  KO
K10133  tumor protein p53-inducible protein 3 [EC:1.-.-.-]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112908482 (TP53I3)
Enzymes [BR:vvp01000]
 1. Oxidoreductases
  1.-  
   1.-.-  
    1.-.-.-  
     112908482 (TP53I3)
SSDB
Motif
Pfam: ADH_zinc_N ADH_zinc_N_2 ADH_N YjeF_N ADH_N_2
Other DBs
NCBI-GeneID: 112908482
NCBI-ProteinID: XP_025839719
UniProt: A0A3Q7R007
LinkDB
Position
Unknown
AA seq 332 aa
MLAVHFDEPGGPENLYLKEVAKPSPGEGEVLLKVAASALNRADLHQRQGQYAPPPGASSI
LGLEASGHIAELGPACQGHWKIGDPAMVLLPGGGQAQYVTVPEELLMPIPAGLTLSQAAA
IPEAWLTAFQLLHLLGNVQAGDSVLIHAGASGVGTAAIQLARMAGAIPLVTAGSQHKLQM
AEKLGAAAGFNYKEEDFSEATLKFTKGAGVNLILDCIGGSYWEKNVNCLALDGRWILYGL
MGGTDISGPLFSKLLFKRGSLITTLLRSRDKKYKQTLVEAFTEHILPHFSTESPQRLLPV
LDRVYPVTAIQEAHAYMERNQNVGKIVLQLPR
NT seq 999 nt   +upstreamnt  +downstreamnt
atgttagctgtgcacttcgacgagccgggaggacccgaaaacctttacttgaaggaggtg
gccaagcccagcccaggagagggcgaagtcctcctgaaggtggcggccagcgccctgaac
cgagccgatttacatcagagacaaggccaatacgccccacccccaggagccagcagcatt
ttaggactggaagcatctggacacatagcagagctggggcctgcctgccaggggcactgg
aagattggggacccagccatggttctgctgcccggtgggggacaggctcaatatgtcact
gtccctgaagagctcctcatgcccatcccagcgggactgaccctatcccaggctgcagcc
atcccagaggcctggcttaccgccttccagctattacatctcttgggaaacgttcaggcc
ggagactctgtgctaatccatgccggagcaagtggtgtgggcacagctgccatccaactg
gcccggatggctggagctattcctctagtcacagctggctcccagcacaagcttcagatg
gcagaaaagcttggagcagctgctggattcaattacaaagaagaggatttttctgaagca
acactgaaattcaccaaaggtgctggagtcaaccttattctagactgcataggtggatcc
tactgggagaaaaacgtcaactgcctggctcttgatggtcgctggattctctatggcctg
atgggaggaacggacatcagtggacctctattttcaaagctactttttaaacgaggaagt
ctgatcaccactctgctgagatctagggacaaaaagtacaagcagacgctggtggaggct
ttcacagaacacatcctgccccacttctccacggagagcccccaacgtctactgccggtg
ctggaccgggtgtaccccgtgactgcaatccaggaggcccacgcgtacatggagaggaac
cagaacgtgggcaagatcgtcctgcagctgcctcggtga

KEGG   Vulpes vulpes (red fox): 112920278
Entry
112920278         CDS       T05911                                 

Gene name
EI24
Definition
(RefSeq) etoposide-induced protein 2.4 homolog
  KO
K10134  etoposide-induced 2.4 mRNA
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112920278 (EI24)
SSDB
Motif
Pfam: EI24
Other DBs
NCBI-GeneID: 112920278
NCBI-ProteinID: XP_025854748
UniProt: A0A3Q7SEV3
LinkDB
Position
Unknown
AA seq 340 aa
MADSVKTFLQDLARGIKDSIWGICTISKLDARIQQKREEQRRRRASSVLAQRRAQSIERK
QESEPRIVSRIFQCCAWNGGVFWLSLLLFYRVFIPVLQSVTAQIIGDPSLHGDVWSWLEF
FLTSIFSALWVLPLFVLSKVVNAIWFQDIADLAFEVSGRKPHPFPSVSKIIADMLFNLLL
QALFLIQGMFVSLFPIHLVGQLVSLLHMSLLYSLYCFEYRWFNKGIEMHQRLSNIERNWP
YYFGFGLPLAFLTAMQSSYIISGCLFSILFPLFIISANEAKTPGKAYLFQLRLFSLVVFL
SNRLFHKTVYLQSALSSSTSAEKFPSPHPSPAKLKAAAGH
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggctgacagtgtcaaaacctttctccaggaccttgccaggggaatcaaagactccatc
tggggaatttgtaccatctcaaagctggatgctcggattcagcaaaagcgagaggagcag
cgtcgaagaagggcaagcagcgtcctggcgcagaggagagcccagagtatagaaaggaag
caagagagtgagccacgtatcgttagtagaattttccaatgctgcgcttggaatggtggt
gtcttctggttaagtctcctcctgttttatcgagtgtttattcctgttctgcagtcagtg
acagcccagattattggtgatccatcactgcatggagacgtttggtcgtggctggaattc
ttccttacgtccatcttcagtgctctttgggtgctccctctgtttgtgctcagcaaagtt
gtaaatgccatttggtttcaagacatagctgacctggcatttgaggtatcagggaggaag
cctcacccattccctagtgtcagcaaaataattgctgacatgctcttcaacctcttgctg
caggctcttttcctcatccaggggatgtttgtgagtctctttcccatccaccttgttggt
cagctggttagtcttctgcacatgtcccttctctactcactgtactgctttgaatatcgt
tggttcaataaaggaattgaaatgcaccagcggttgtcaaacatagaaaggaattggcct
tactactttggatttggtttgcccttggctttccttacagcaatgcagtcttcatacatt
atcagtggctgcctcttctccatcctctttcctctattcattatcagcgccaatgaagca
aagacacctggcaaagcataccttttccagctgcgcctcttctctttggtggttttctta
agcaacagacttttccacaagacagtctacctgcagtctgccctgagtagctcaacctct
gcagaaaaattcccttcaccgcatccatctcctgccaaactgaaggctgctgcaggccac
tga

DBGET integrated database retrieval system