KEGG   Vulpes vulpes (red fox): 112908560
Entry
112908560         CDS       T05911                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform
  KO
K21289  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp00562  Inositol phosphate metabolism
vvp01100  Metabolic pathways
vvp04022  cGMP-PKG signaling pathway
vvp04062  Chemokine signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04371  Apelin signaling pathway
vvp04611  Platelet activation
vvp04725  Cholinergic synapse
vvp04921  Oxytocin signaling pathway
vvp05132  Salmonella infection
vvp05145  Toxoplasmosis
vvp05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112908560 (PIK3CG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112908560 (PIK3CG)
   04072 Phospholipase D signaling pathway
    112908560 (PIK3CG)
   04022 cGMP-PKG signaling pathway
    112908560 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    112908560 (PIK3CG)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112908560 (PIK3CG)
   04062 Chemokine signaling pathway
    112908560 (PIK3CG)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    112908560 (PIK3CG)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112908560 (PIK3CG)
  09156 Nervous system
   04725 Cholinergic synapse
    112908560 (PIK3CG)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112908560 (PIK3CG)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    112908560 (PIK3CG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112908560 (PIK3CG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvp04131]
    112908560 (PIK3CG)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     112908560 (PIK3CG)
Membrane trafficking [BR:vvp04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112908560 (PIK3CG)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 112908560
NCBI-ProteinID: XP_025839840
UniProt: A0A3Q7SE35
LinkDB
Position
Unknown
AA seq 1103 aa
MEPQGREPRVVLREDRRRRRRMKARGPAAGLPSMELIPIEFVLPTSQRGSKAPETALLHV
AGHGNVEQMKAQVWLRALETSAAADFYQRLGPDHFVLLYQKKGQWYEIYDRYQVVQTLDC
LRYWQLLRRSPGQIHVVQRRAPSAATRAFQRQLTALIGYDVTDVSNVHDNELEFTRRRLV
TPRMLEVAGRDPRLYAMHPWVTSKPLPDYLRKRIPNNCVFIVIHRGTTSQTVKVSADDTP
GAILRGFFAKMAKKKALMGIPEGQSERDFVLRVCGRDEYLVGDTPLQNFQWVRQCLKNGE
EMHLVLDAPPDPALDEVRKEEWPLVDDCTGATGYHEQLTIHGKDHESVFTVSLWDCDRRF
RVKIRGIDIPVLPRHADLTVFVEANIQHGQQVLCQRRTSPKLFTEEVLWNVWLEFSIKIK
DLPRGALLNLQVYCSKAPTPAAKASADAPGPGSEARGKAQLLYYVNLLLIDHRFLLRRGE
YVLHMWQISGKGEDQGSFNADKLTSATNPDKENSMSISILLDNYCHPIALPKHRPTPDPE
ADRVRAEMPNQLRKQLEAIIATDPLNPLTAEDKELLWHFRYESLKHPKAYPKLFSSVKWG
QQEIVAKTYQLLARREVWDQSALDVGLTMQLLDCNFSDENVRAIAVQKLESLEDDDVLHY
LLQLVQAVKFEPYHDSALARFLLKRGLRNKRIGHFLFWFLRSEIAQSRHYQQRFAVLLEA
YLRGCGTAMLHDFTQQVQVIEMLQKVTIDIKSLSAEKYDVSSQVISQLKQKLENLQNLNL
PESFRVPYDPGLKAGALVIEKCKVMASKKKPLWLEFKCADPTALSNETIGIIFKHGDDLR
QDMLILQILRIMESIWETESLDLYLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNT
GAFKDEVLNHWLKEKCAIEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGN
LFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSLHFQKFQDVCVKAYLA
LRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEEAKKYFLDQIEVCRDKG
WTVQFNWFLHLVLGIKQGEKHSA
NT seq 3312 nt   +upstreamnt  +downstreamnt
atggagccgcagggccgtgagccgcgcgtggtgctgagggaggaccgccgccgccgccgg
aggatgaaggcgcgcggccccgcggccggcctgccgtccatggagctcatccccatcgag
ttcgtgctgcccaccagccagcgcggcagcaaggcccccgagacggcgctgctgcacgtg
gcgggccacggcaacgtggagcagatgaaggcgcaggtgtggctgcgcgcgctggagacg
agcgcggcggccgacttctaccagcgcctcgggcccgaccacttcgtgctgctctaccag
aagaagggccagtggtacgagatctacgaccgctaccaggtggtgcagacgctcgactgc
ctgcgctactggcagctgctgcgccgcagccccggccagatccacgtggtgcagcggcgc
gcgccctccgccgccacgcgcgccttccagcggcagctcacggcgctcatcggctacgac
gtcaccgacgtcagcaacgtgcacgacaacgagctcgagttcacgcgccgccgcctggtc
acgccgcgcatgctcgaggtggccggccgcgacccccggctctacgccatgcacccgtgg
gtgacgtccaagccgctgcccgactacctgcggaagaggatccccaacaactgcgtcttc
atcgtcatccaccgcggcaccaccagccagacggtcaaggtgtcggccgacgacacgccg
ggcgccatcctccggggcttcttcgccaagatggccaagaagaaggccctgatgggcatc
cccgagggccagagcgagcgggacttcgtgctgcgcgtgtgcggccgcgacgagtacctg
gtgggggacacgccgctgcagaacttccagtgggtgaggcagtgcctcaagaacggagag
gagatgcacctggtgctcgacgcgcctccggacccggccctggacgaggtgaggaaggag
gagtggccgctcgtggacgactgcacgggggccaccggctaccacgagcagctcaccatc
cacggcaaggaccacgagagcgtgttcaccgtgtccctgtgggactgcgaccgcaggttc
agggtcaaaatccggggcatcgacatccccgtgctgccccgccacgccgacctcaccgtc
ttcgtggaggccaacatccagcacgggcagcaggtcctctgccagcggaggaccagcccc
aagctcttcacggaggaggtgctctggaacgtgtggctggagttcagcatcaagatcaag
gacctgccgcggggggccctgctgaacctgcaggtctactgcagcaaggcccccacgccg
gccgccaaggcctcggccgacgcgcccggccccgggtccgaggccaggggcaaagctcag
ctcctctactacgtgaacctgctgctcatagaccaccgcttcctgctgcgccgcggggag
tacgtgctccacatgtggcagatctccgggaagggcgaggaccagggcagcttcaacgcc
gacaagctcacgtcggccaccaaccccgacaaggagaactccatgtccatctccattctt
ctggacaattactgtcaccccatagccttgcccaagcatcggcccacccctgaccccgaa
gcggaccgggttcgagcagaaatgcccaaccagcttcgcaagcagctggaggcgatcata
gccacggatccacttaaccctctcacggccgaggacaaggaattgctctggcatttccga
tacgaaagtctcaagcatccaaaggcctatcctaagctgtttagctccgtaaaatgggga
cagcaagagatcgtggccaaaacataccagctgttggccagacgggaggtctgggaccaa
agcgctttggacgtgggcttaaccatgcaactcctggactgcaacttttccgatgagaac
gtcagagccatcgcagttcagaaactggagagcttggaggacgatgatgtcctgcattac
ctgctgcagctggtccaggctgtgaaatttgaaccatatcatgacagcgccctcgcccga
tttctgctgaagcgtggcttaagaaacaaaagaattggtcatttcttgttttggttcttg
agaagcgagatagcccagtccaggcactaccagcagaggtttgccgtgctactggaagcc
tatctaaggggctgcggcactgccatgctgcacgacttcactcaacaagttcaagtgatt
gagatgctacagaaggtcaccattgatatcaaatcactctctgctgaaaaatacgatgtc
agttcccaagttatttcacaacttaagcaaaagcttgagaacctgcagaatttgaatctc
ccagaaagctttcgagtgccgtatgatcctggactgaaggcaggagcactagtgattgaa
aaatgtaaagtgatggcctccaagaaaaagcccctatggcttgagtttaaatgtgctgac
cctacagccctatcgaatgaaacgattgggatcatctttaaacacggggacgatctgcgc
caagacatgctgattttacagattctacgaatcatggaatccatttgggagacggaatct
ttggatctgtacctcctgccatatggttgcatttcaactggtgacaaaatagggatgatt
gagatcgtgaaagatgccacaacaattgccaaaattcagcaaagcacagtgggcaacaca
ggcgcattcaaagatgaagtcctgaatcactggctcaaagaaaaatgtgctattgaagaa
aagtttcaggcagctgtggagagatttgtttactcctgtgctggctactgtgtggctacc
ttcgtcctgggaataggcgacaggcacaatgacaatattatgatcacagagacaggaaat
ctatttcatattgactttggacacattcttgggaattacaaaagtttcctgggcattaat
aaagagagagtgccatttgtgctaaccccagacttcctgtttgtgatgggaacttcggga
aagaagacaagcctacacttccagaaatttcaggacgtctgcgttaaggcttacctcgcc
cttcgccaccacacaaacctactgatcatcctgttctccatgatgctgatgacgggaatg
ccccagttaacaagcaaagaagatatcgaatatattcgggatgctctaacagtggggaag
aacgaagaggaagctaagaagtattttctcgatcagatcgaggtttgcagggacaaagga
tggactgtgcagtttaactggttcctgcatctcgtcctgggcatcaaacaaggagagaaa
cattctgcctag

KEGG   Vulpes vulpes (red fox): 112924887
Entry
112924887         CDS       T05911                                 

Gene name
PIK3R6
Definition
(RefSeq) phosphoinositide 3-kinase regulatory subunit 6
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04022  cGMP-PKG signaling pathway
vvp04062  Chemokine signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04371  Apelin signaling pathway
vvp04611  Platelet activation
vvp04725  Cholinergic synapse
vvp04921  Oxytocin signaling pathway
vvp05145  Toxoplasmosis
vvp05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112924887 (PIK3R6)
   04072 Phospholipase D signaling pathway
    112924887 (PIK3R6)
   04022 cGMP-PKG signaling pathway
    112924887 (PIK3R6)
   04151 PI3K-Akt signaling pathway
    112924887 (PIK3R6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112924887 (PIK3R6)
   04062 Chemokine signaling pathway
    112924887 (PIK3R6)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    112924887 (PIK3R6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112924887 (PIK3R6)
  09156 Nervous system
   04725 Cholinergic synapse
    112924887 (PIK3R6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    112924887 (PIK3R6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112924887 (PIK3R6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvp04131]
    112924887 (PIK3R6)
Membrane trafficking [BR:vvp04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112924887 (PIK3R6)
SSDB
Motif
Pfam: PI3K_1B_p101
Other DBs
NCBI-GeneID: 112924887
NCBI-ProteinID: XP_025861276
UniProt: A0A3Q7TIX2
LinkDB
Position
Unknown
AA seq 755 aa
MESSDVELDLQRSVQAVLRELSAQAPALQSNQGMWRWSLHKKVERDPAKSPALVRILLRE
LEKAESEDLRHVIIPLLHTLMYVLTKATGITEELYRRTYTFCTRLLTLPAPYCTVALDCA
IRLKTETAVPGTLYQRLVIAEQNLTSELYPYQERVFLFVDPELVSPSVCSALLLEIEAAQ
VQQTPEACMRHVVSHALQAALGDACHASALQRKLKASPRGALERYFHAVVAAVEQMASDP
SPSREGHQERLEEIYCSLLGPAAAARGRYCGDPLQDPQPSIPLPSPHITFHLWTDEEQLW
KELVLFLRPRSQVRLSADLEALDLQGLWPDRELARASMLSTDSGIERDLPSGADEPPGPG
SPETERAGLQRKGGIRKRVWPPDVAMPECWAGPQGLHRRTGVPGGVGELVPGVSRLHTAR
VLVLGDDRMLGRLAQAYHSLRKRETQKFCLTPRLSLQLYYIPVLAPEKPASCRHSELREL
ATFLGRADPWYESTVNTLCPAIHKLAEMPPSLDTSRTVDPFILDVITYYVRMGTQPIYFQ
IYTVKIFRDLSQDPAEDIFLTELNVKIQDSKLPKDGFSPRRRGVAEGPGAELSICYQKAL
LSHRAQEVTSSVRATGLVLKALPASDTEVSGPTHTPPSAAPITDHTCLNVSVTEVVKSSN
LAGRSFSTVTNTFRTATIQIQSQDQRLLTLLLDKDGRRMFRDVVRFEVAPCPEPCSGARK
TKAPWLGSHQLEVEGTKAKPKPLLMPINTFSGIVQ
NT seq 2268 nt   +upstreamnt  +downstreamnt
atggagagctcagatgtggagctggacctccagcggagcgtgcaggccgtgctccgggag
ctcagcgcccaggctcccgccctgcagagcaaccaaggcatgtggagatggtccctgcac
aagaaggtcgagcgagatccggccaagagtccggcgctggtccgcatcctactcagagaa
ctggagaaggcagaaagtgaagacctccggcacgtcatcatccccttgctgcacactcta
atgtacgtgctcactaaggccactggcatcacggaggagctgtaccggagaacctacacc
ttttgcacgaggctgctaaccctgcccgccccctactgcacggttgccttggactgcgcc
ataaggctgaaaacagagacagctgtcccagggacactgtaccagaggctggtcattgcc
gaacagaacctgacgagtgagctgtacccctaccaggagagagtgttcctcttcgtggat
cctgagctggtctctccctctgtgtgcagcgctctgctgctggagatcgaggcggcgcag
gtgcagcagaccccagaggcctgcatgcgccacgtggtctcccacgccctgcaggcagcc
ctgggggacgcatgccatgccagtgccctgcagaggaagctgaaggccagccctcgcggt
gccctggagcgctatttccacgctgtggtggcagcggtggagcaaatggccagcgacccc
agcccgagccgcgagggacaccaggagaggctggaggagatctactgctcgctgctgggg
ccagcggccgccgccaggggacgctactgcggtgaccccctgcaggacccacagccaagc
atccctctgcccagcccccacatcaccttccacctgtggaccgatgaggagcagctctgg
aaggaactggtcctcttcctgcgcccgagatcccaagtgcgcctgagcgccgacctggag
gccttggacctgcagggcctgtggccagaccgggagctggcccgggcgtccatgctgtcc
accgacagtggcatcgagcgggacctcccttcgggggccgacgagcccccgggaccgggc
agccccgagacggagcgcgccgggctgcagcgcaaggggggcatcaggaagcgggtgtgg
cccccggacgtggcgatgcctgagtgctgggccgggccgcaggggctgcaccgcaggacg
ggggtgcccggcggggtcggggagctggtgcccggcgtctcccggcttcacacggccagg
gtgctggtgctgggggacgacaggatgctggggcgcctggcgcaggcctaccacagcctc
aggaaacgagagactcagaagttctgcctcacccccagactcagcctgcagctgtactac
atccccgtactggcgcctgagaagccagcgtcgtgcagacattcggagctcagggagctg
gccacgttcctgggccgcgcagacccgtggtacgagagcactgtcaacacgctgtgcccg
gccatccacaagctggcagagatgcccccttccctggacacatcccggacggtggacccc
ttcatcctggatgtcatcacctactatgttcgcatgggcacccaacccatctatttccag
atctacacagtcaagatcttcagggacctgagccaagaccctgcagaggatatcttcctc
actgagctgaacgtgaagatccaggactccaaactccccaaagatggcttttcacccagg
aggaggggtgtggctgagggcccgggggccgagctctccatctgctaccagaaggccctg
ctcagccaccgggctcaagaggtcaccagttccgtgcgggccactgggctggtcctgaaa
gcccttccagccagtgacactgaagtttcagggcccacccacaccccaccatctgctgct
cccatcacagaccacacgtgcctgaatgtcagcgtgacggaggtcgtcaagtcctccaac
ttggcgggaagatccttctctacggtgaccaataccttccggacagccaccatccagatc
cagagccaggaccagagactcctgacgctgctgctggacaaggatggtcggcgcatgttc
agggatgtggtcaggttcgaggttgctccctgcccagagccatgttctggggcgcgtaag
accaaggcgccatggctgggttcacaccagctggaggtggaaggcaccaaagccaagccc
aagccccttctaatgcccatcaacacattctccggcatcgtccaatga

KEGG   Vulpes vulpes (red fox): 112924888
Entry
112924888         CDS       T05911                                 

Gene name
PIK3R5
Definition
(RefSeq) phosphoinositide 3-kinase regulatory subunit 5 isoform X1
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04022  cGMP-PKG signaling pathway
vvp04062  Chemokine signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04371  Apelin signaling pathway
vvp04611  Platelet activation
vvp04725  Cholinergic synapse
vvp04921  Oxytocin signaling pathway
vvp05145  Toxoplasmosis
vvp05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    112924888 (PIK3R5)
   04072 Phospholipase D signaling pathway
    112924888 (PIK3R5)
   04022 cGMP-PKG signaling pathway
    112924888 (PIK3R5)
   04151 PI3K-Akt signaling pathway
    112924888 (PIK3R5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112924888 (PIK3R5)
   04062 Chemokine signaling pathway
    112924888 (PIK3R5)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    112924888 (PIK3R5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112924888 (PIK3R5)
  09156 Nervous system
   04725 Cholinergic synapse
    112924888 (PIK3R5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    112924888 (PIK3R5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112924888 (PIK3R5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvp04131]
    112924888 (PIK3R5)
Membrane trafficking [BR:vvp04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112924888 (PIK3R5)
SSDB
Motif
Pfam: PI3K_1B_p101
Other DBs
NCBI-GeneID: 112924888
NCBI-ProteinID: XP_025861279
UniProt: A0A3Q7SIR7
LinkDB
Position
Unknown
AA seq 875 aa
MQPGATTCTEDRIQHALERCLHGLSLSRCSTSWSAGLCLNCWSLQELVSRDPGHFLILLE
QILQKTREVQEKGTYDLLAPLALLFYSTVLCTPHFPPDSDLLLKAARTYHRFLTWPVPYC
SICQELLTFIDAELKAPGISYQRLVRAEQGLPIRSHRSSTVTVLLLNPVEVQAEFLAVAN
KLSTPGHSPHSAYTTLLLHAFQATFGAHCDLPGLHCRLQSKSLAELEDIFTETAEAQELA
SGIGDAAEARQWLRTKLQAVGEKAGFPGVLDTAKPGQLRTIPIPVARCHTYSWNQDSFDI
LQEILLKEQELLQPGILGHDEQEEEEEEEEEEEDLETDGHCAQRDSVLSTGSAVFHDSTL
SLSSPQASGPALSRQLLTSFVSGLSDGVDSGYMEDSEESSSEWPASPGSQERWGHRRPGQ
KFNRIYKLFKSTSQLVLRRDSRGPEGGADTALPLRRAGSLCSPLDGLGMPPARAQRSRSL
PQPKLSTQLPSWLLAPASRHQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSKLR
RLENNRPLLTRFFKLQFFYVPMKRSHGTGSSTCPAPASQAPPLPTDSPKHPSPAELESTN
DISHYLGMLDPWYERNVLGLMHLPPEVLCQQSLKAESRPLEGSSAQLPILADMLLYYCRF
AARPVLLQVYQTELTFITGEKMTEIFIHSLELGHSAATRAIKASGPGSKRLGIDGDREAV
PLTLQIIYSKGAISGRSRWSNMEKVCTSITLNKACRKQEELDSSTEALTLNLTEVVKRQN
PKSKKGFNQISTSQIKVDKVQIIGSNGCPFAVCLDQDERKILQSVVRCEVSPCYKPEKSS
LHPQPQRSPDLPAQEAPDLCSLLCLPIMTFSGALP
NT seq 2628 nt   +upstreamnt  +downstreamnt
atgcagccaggggccacgacgtgcacggaggaccgcatccagcatgccctggagcgctgc
ctacatgggctcagcctcagccgctgctctacctcctggtccgctggcctgtgtctcaac
tgctggagcctgcaggagctggtcagcagggacccgggccatttcctcatcctcctggag
cagatcctgcagaaaacccgagaggtccaagagaagggcacttatgaccttctggccccc
ctggccctgctcttctactccactgtcctctgcacgccacacttcccaccagattcagat
ctccttctgaaagcagccagaacctaccaccgattcctgacctggcctgttccctactgc
agcatctgccaggagctgctcaccttcattgatgctgaactcaaggccccaggaatctcc
taccagcgactggtgagggcggagcagggcctgcccatcagaagtcaccgcagctctacc
gtcaccgtgctgttgctgaatccagtggaggtccaagccgagttcctcgcggtggccaac
aagctgagcacgcctgggcactcgccccatagcgcctacaccaccctgctcttgcacgcc
ttccaggccacctttggggcccactgtgacctgccagggctgcactgcaggctgcagtcc
aagagcctggccgagcttgaggacatcttcacagagactgcagaagctcaggagctggcc
tcgggcattggggacgcagccgaggcccggcagtggctcaggaccaagctgcaggcagta
ggagagaaagctggcttccccggtgtcttagacactgccaaacctggccagctccgcacc
atccccatccctgttgccaggtgccacacctacagctggaaccaggacagctttgacatc
ctgcaggaaatcctgctcaaggaacaggagctgctccagccagggatcctggggcacgat
gagcaggaggaggaggaggaggaggaagaggaggaggaggacttggaaacggatgggcac
tgtgcccagagggattcggtgctctccaccggctcggcggtcttccatgactcaaccctg
tccctcagctcaccccaggcttcagggcccgccctctcccgccagctgctgacctcgttc
gtctcgggcctgtcggatggcgtggacagcggctacatggaggacagcgaggagagctcc
tccgagtggcccgcgagccctggcagccaggagcgctggggccaccgcaggccggggcag
aagttcaacaggatctataaactcttcaagagcaccagccagctggtgctgcggagggac
tcccggggccccgaggggggcgcggacacagccctgcccctgcggcgggcggggagcctc
tgcagccccctggacggcctgggaatgccccccgcgcgggcccagcgctcccgctcgctg
ccccagcccaagctcagcacccagctgcccagctggctcctggcccccgcctcgcgccac
cagcgccgccgccccttcctgagcggggacgaggaccccaaggcgtccacgctgcgcgtt
gtggtcttcggctctgatcgcatctcggggaaggtggctcgggcatacagcaagctgcgg
cggctggagaacaatcgcccactcctcacacggttcttcaagcttcaatttttctacgta
cccatgaagcgaagccatgggactggctccagcacctgccctgctcctgcaagccaggcg
cccccgctccccacggactccccaaagcaccctagccctgcggagctggagagcaccaat
gatatctcccactacctcggcatgctcgacccctggtatgagcgcaacgtactaggcctc
atgcacctgccccctgaagtcctgtgccaacagtctctgaaggccgagtcccggcccctg
gagggctcctctgcccagctgcccatcctggcggacatgctgctctactactgccgcttc
gctgcccggccggtgctgctgcaggtctatcagacggagctgactttcatcaccggggag
aagatgacagagatcttcatccactccctggagctgggtcactctgctgccacacgtgcc
atcaaggcttcgggtcctggcagcaagcgtctgggcatcgatggggaccgcgaggctgtc
cctctaacactacagattatttacagcaagggagccatcagtggacgaagccgctggagt
aacatggagaaggtgtgcacatccatcaccctgaacaaagcctgccggaagcaggaggag
ctagactccagcaccgaggctctgacgctaaatctgaccgaagtggtgaaaagacagaac
cctaagtccaagaagggcttcaaccagattagcacgtcccagatcaaagtggacaaggtg
cagatcatcggctccaacggctgcccctttgccgtgtgcctggaccaggatgagaggaag
atcctgcagagtgtggtccggtgtgaggtctcaccctgctacaagccagagaagagcagc
ctccacccccaaccccagaggtccccagacctgcccgcccaggaggcgcccgacctctgc
tccctcctctgcctgcccatcatgaccttcagcggagctctgccctaa

DBGET integrated database retrieval system