KEGG   Vulpes vulpes (red fox): 112908954
Entry
112908954         CDS       T05911                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04060  Cytokine-cytokine receptor interaction
vvp04151  PI3K-Akt signaling pathway
vvp04210  Apoptosis
vvp04630  JAK-STAT signaling pathway
vvp04640  Hematopoietic cell lineage
vvp05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    112908954 (IL3RA)
   04151 PI3K-Akt signaling pathway
    112908954 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112908954 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112908954 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112908954 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112908954 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:vvp04050]
    112908954 (IL3RA)
   04090 CD molecules [BR:vvp04090]
    112908954 (IL3RA)
Cytokine receptors [BR:vvp04050]
 Interleukin receptor families
  IL3 receptor family
   112908954 (IL3RA)
CD molecules [BR:vvp04090]
 Proteins
  112908954 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind
Other DBs
NCBI-GeneID: 112908954
NCBI-ProteinID: XP_025840387
UniProt: A0A3Q7R4Y3
LinkDB
Position
Unknown
AA seq 375 aa
MASLRLAVLVTSVCLLRAEKDPDSPIKNLRMEPGSRRLTWDLSGNVSEIKCFINSKFITK
AVNGRYCQFYVLPLCEVKNFTISVKQDPPFSTGIQYVPRGTEGKPAAAAWGLDCWVHDVD
FLTCSWEVGRAAPGDVQYRLYWRDLKAYREQECPRYEADDRGVHVRCRFDDVSRLQRHIQ
LWVNGTSRRSGIPCSDLCVELPEIERLSPPHITATCNKSYSMMEWNVLSHFNHRFLYELQ
IQKGTDPASTEKLYENHFVIYNPGNYVAKLKVQGFFRKDWSEWSAPQLFVCDPKDEHRRD
WLVSVLVLLGTLLVLGLVALLCRRYSVFQKLFPPIPHMKDPIMDNFQSPKLVPWDTSRAS
REDCPVAEVHILGET
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggcctcgctgcggctcgcggtgcttgtgacgtctgtctgtctgctgcgcgcggagaaa
gatccagattcaccgattaagaacctcaggatggagccgggaagcaggagactgacctgg
gacctcagtggaaatgtctctgaaattaagtgtttcatcaactcaaaatttatcactaag
gccgtcaacggccgttactgccagttttatgtgctccccttatgtgaagtgaaaaacttc
accatctccgtgaagcaagacccgccgttctccacggggattcagtacgtcccgcgaggc
acagaaggaaagccggcggcggccgcgtggggcctggactgctgggtgcacgacgtggac
ttcctgacgtgcagctgggaggtgggcagggcggcccccggcgacgtgcagtaccgcctg
tactggcgggacctgaaggcctaccgcgagcaggagtgtccgcgatacgaggcggacgat
cggggcgtccacgtccggtgccggttcgatgacgtgtccaggttgcagaggcacatccag
ttgtgggtgaacggcaccagccgacgctccggaatcccctgctccgacctctgtgtcgaa
ttaccggaaatcgagagattaagtccaccccacatcactgcaacctgtaataaatcctat
tcaatgatggagtggaacgtattaagccacttcaatcacagatttctgtatgaacttcaa
atacaaaagggcaccgatcctgcgtccacggagaagctctacgaaaaccacttcgtgatt
tacaatcctggaaactacgtggcgaaactaaaggtgcagggtttcttccgcaaagactgg
agcgaatggagcgccccccaactctttgtgtgtgaccccaaggatgagcaccgccgtgac
tggctggtgtccgtactggtcttgctggggacactgctggtcctgggactcgtggccctg
ctgtgtagaaggtactcagttttccagaaactcttccctcccatccctcacatgaaggac
cccatcatggacaacttccagagccccaagctggtgccctgggacaccagcagagccagc
cgggaggactgtccggtggccgaggtgcacattttgggggaaacatga

DBGET integrated database retrieval system