KEGG   Vulpes vulpes (red fox): 112908961
Entry
112908961         CDS       T05911                                 

Gene name
PPP2R3B
Definition
(RefSeq) serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta isoform X1
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03015  mRNA surveillance pathway
vvp04071  Sphingolipid signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04728  Dopaminergic synapse
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112908961 (PPP2R3B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    112908961 (PPP2R3B)
   04151 PI3K-Akt signaling pathway
    112908961 (PPP2R3B)
   04152 AMPK signaling pathway
    112908961 (PPP2R3B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112908961 (PPP2R3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    112908961 (PPP2R3B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112908961 (PPP2R3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112908961 (PPP2R3B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:vvp03019]
    112908961 (PPP2R3B)
   03036 Chromosome and associated proteins [BR:vvp03036]
    112908961 (PPP2R3B)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     112908961 (PPP2R3B)
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     112908961 (PPP2R3B)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     112908961 (PPP2R3B)
SSDB
Motif
Pfam: EF-hand_13 EF-hand_7 EF-hand_5 EF-hand_1 EF-hand_8 EF-hand_6
Other DBs
NCBI-GeneID: 112908961
NCBI-ProteinID: XP_025840399
UniProt: A0A3Q7R240
LinkDB
Position
Unknown
AA seq 569 aa
MPPGKVLQPVLKMKVDELFLRWLSESSTQALLRDCLQRIKVPGRSPGALLAPAAPTCKPG
VLDGLGVPSLSPVSTALPLGAASSPRSGPHPRGTRRSTGTRAVQAKKEQPLPPAASQSIP
AFYFPRGRPTDTLHVDAVISKIERTFAQFPHERATMDDMGRVAKACGCPLYWKGPLFCSA
GGERTGSVSVHKFVAMWRKILHNCHDDAAKFLHLLMNPGCNYLVQEDFVPFLQDVVNTHP
GLAFLKEASEFHSRYITTVIQRIFYTVNRSWSGRITCAELRRSTFLQNVALLEEEADINQ
LTEYFSYEHFYVIYCKFWELDTDHDLLIDSQDLARHNDHAVSTKMIERIFSGAVTRGRKV
QKEGKISYADFVWFLLSEEDKRTPTSIENWFRCMDLDGDGALSMFELEYFYEEQCRRLDS
MAIEALPFEDCLCQMLDLVKPQSDGKITLRDLKRCKLANVFFDTFFNIEKYLDHEQKEQV
SLLRDSESEGPELSDWEKYAAEEYDILVAEEAAAEPWEDGYEAELSPVEQKLSSLRSPLA
QRPFFEAPSALGAVDLYEYACEDDDLPPS
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgccgcccggcaaagtcctgcagccggtcctcaagatgaaggtggacgagctgttcctg
cgctggctcagcgagtccagcacgcaggcgctgctgcgggactgcctgcagcggatcaag
gtgcccgggaggagccccggcgccctgctcgcccccgcagcgcccacctgcaagcccggg
gtgctggacggcctgggggtgcccagcctgtctcccgtgtccaccgcgctcccgctggga
gccgcctcaagtcccaggagcggcccacacccacgagggactcgtcgatccacggggacc
agagccgtgcaggccaagaaggagcagcccctgccgcccgccgccagccagagcattccc
gccttctacttccctcggggccgccccacggacacgctgcacgtggacgctgtcatctcc
aagatcgagcgcaccttcgcccagttcccgcatgagagagccacgatggacgacatgggc
cgcgtggccaaggcgtgcggctgcccgctctactggaaggggccgctcttctgcagcgcc
gggggagagcgcaccggctccgtctccgtccacaagttcgtcgccatgtggaggaagatc
ctccacaactgtcacgacgacgcggccaagttcctgcacctgctcatgaatcccggctgc
aactacctggtgcaagaggacttcgtccccttcctacaggacgtggtgaacacgcacccg
ggcttagccttcctgaaggaggcgtcggagttccactctcgctacatcaccacggtcata
cagaggattttctacaccgtcaacaggtcctggtcggggaggatcacgtgcgcggagctc
cggaggagcacgttcctgcagaacgtggcgctcttggaagaggaagcagacatcaaccag
ctgacggagtacttctcgtacgagcacttctacgtcatctactgcaagttctgggagctg
gacacggaccacgacctcctcatcgattcccaggacctggcccggcacaacgaccacgcc
gtctccaccaagatgatcgagaggatattctccggggccgtgacgaggggcaggaaggtg
cagaaggagggaaagatcagctacgccgacttcgtgtggtttctgctctccgaggaagac
aagagaactccgaccagcatcgagaactggttccgctgcatggacctggacggggacggg
gcgctgtccatgttcgagctcgagtacttctacgaggagcagtgccgccggctggacagc
atggccatcgaggccctgcccttcgaggactgcctgtgccagatgctggacctggtgaag
ccgcagagcgacggaaagatcaccctgcgcgacctgaagaggtgtaagctcgccaacgtg
ttcttcgacaccttcttcaacatcgagaagtacctcgaccacgagcagaaggaacaggtc
tccctgctgagggacagtgagagcgaaggcccggagctgtccgactgggagaagtacgcc
gccgaggagtatgacatcctggtggccgaggaggcggcggccgagccgtgggaggacggg
tacgaagccgagctcagccccgtggagcagaagctgagctccctgaggtctccgctggcc
cagaggcccttcttcgaggcgccgtccgccctgggcgccgtggacctgtacgagtacgcg
tgtgaggatgacgacctgccgccctcgtga

KEGG   Vulpes vulpes (red fox): 112913999
Entry
112913999         CDS       T05911                                 

Gene name
PPP2R5D
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03015  mRNA surveillance pathway
vvp04071  Sphingolipid signaling pathway
vvp04114  Oocyte meiosis
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04728  Dopaminergic synapse
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112913999 (PPP2R5D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    112913999 (PPP2R5D)
   04151 PI3K-Akt signaling pathway
    112913999 (PPP2R5D)
   04152 AMPK signaling pathway
    112913999 (PPP2R5D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112913999 (PPP2R5D)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112913999 (PPP2R5D)
  09156 Nervous system
   04728 Dopaminergic synapse
    112913999 (PPP2R5D)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112913999 (PPP2R5D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112913999 (PPP2R5D)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:vvp03019]
    112913999 (PPP2R5D)
   03036 Chromosome and associated proteins [BR:vvp03036]
    112913999 (PPP2R5D)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     112913999 (PPP2R5D)
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     112913999 (PPP2R5D)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     112913999 (PPP2R5D)
SSDB
Motif
Pfam: B56
Other DBs
NCBI-GeneID: 112913999
NCBI-ProteinID: XP_025846715
UniProt: A0A3Q7SWC0
LinkDB
Position
Unknown
AA seq 604 aa
MPYKLKKEKEPPKLAKGTAKPSSSGKDGGGESTDEAQPQPQPQPQPQPQPQPQPPSSNKR
PSNSTPPPTQLSKIKYSGGPQIVKKERRQSSSRFNLSKNRELQKLPALKDSPTQEREELF
IQKLRQCCVLFDFVSDPLSDLKFKEVKRAGLNEMVEYITHSRDVVTEAIYPEAVTMFSVN
LFRTLPPSSNPTGAEFDPEEDEPTLEAAWPHLQLVYEFFLRFLESPDFQPNIAKKYIDQK
FVLALLDLFDSEDPRERDFLKTILHRIYGKFLGLRAYIRRQINHIFYRFIYETEHHNGIA
ELLEILGSIINGFALPLKEEHKMFLIRVLLPLHKVKSLSVYHPQLAYCVVQFLEKESSLT
EPVIVGLLKFWPKTHSPKEVMFLNELEEILDVIEPSEFSKVMEPLFRQLAKCVSSPHFQV
AERALYYWNNEYIMSLISDNAARVLPIMFPALYRNSKSHWNKTIHGLIYNALKLFMEMNQ
KLFDDCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETET
PTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTAS
QEAL
NT seq 1815 nt   +upstreamnt  +downstreamnt
atgccctataaactgaagaaggagaaggagccccccaaactcgccaaaggcacggccaag
cccagcagctcgggcaaggatggtggaggcgagagcaccgatgaggcccagccccagccg
cagccccagccccagccgcagcctcagccgcagccccagccaccatcatccaacaagcgt
cccagcaatagcacgccacccccaacgcaactcagcaaaatcaagtactctgggggaccc
cagattgtcaagaaggagcgacggcaaagttcctcccggttcaatctcagcaagaaccgg
gagttgcagaagcttcctgccctgaaagattcaccaacccaggagcgggaagagctcttt
atccagaagctacgccagtgctgtgtcctctttgacttcgtatcagatccactcagtgac
ctcaaattcaaggaggtgaagcgggcaggactcaatgaaatggtggagtacattacccac
agccgcgatgttgtcactgaggccatttaccctgaggcagtcaccatgttttcagtgaat
ctcttccggacgctgccaccttcatcaaaccccactggggccgagtttgacccagaagag
gacgagcccaccctggaagctgcctggccgcatctccagctcgtgtatgagtttttctta
cgtttccttgagtctcccgatttccagccaaacatagccaagaagtatatcgaccagaag
ttcgtccttgctctcttggacctgttcgacagtgaggatcctcgagagcgggacttcctc
aagaccatcctgcatcgtatctatggcaagtttttggggctccgggcttatatccgtagg
cagatcaaccacatcttctacaggttcatctatgagacagagcatcacaatgggatcgct
gagctcctggagatccttggcagcatcatcaacggctttgccttgccccttaaagaagag
cacaagatgttcctcatccgtgtcctgcttccccttcacaaggtcaaatccctgagtgtc
taccaccctcagctggcttactgtgtggtacagttcctggagaaggagagcagtctcact
gagccggtgattgtaggacttctgaagttctggcccaagacccacagccccaaggaagtc
atgttcctgaatgagctagaggagattctggatgtcattgaaccttcagagttcagcaaa
gtgatggaacccctcttccgccagcttgccaagtgtgtctccagcccccatttccaggtg
gcagagcgtgctctctattactggaacaatgagtacatcatgagcctgataagtgacaat
gctgcccgagtcctccccatcatgttccctgcactctacaggaactccaagagccactgg
aacaagacaatccatggactgatctacaatgccctgaagctgtttatggagatgaatcag
aagctgtttgatgactgcacacaacaatacaaggcagagaaacagaagggccggttccgc
atgaaggaaagggaagagatgtggcaaaagattgaggagctggcccgacttaacccccag
tatcccatgttccgagctcctccaccactgcctcccgtgtactccatggagacagagacc
cccacagcagaggacatccagcttctgaagaggacagtggagacagaggccgtgcagatg
ctaaaggacatcaagaaggagaaggtgctgcttcggcggaagtcagagctgccccaggac
gtgtacaccatcaaggcactggaggcacacaagcgggcggaagaattcctaactgccagc
caggaggctctctga

KEGG   Vulpes vulpes (red fox): 112916103
Entry
112916103         CDS       T05911                                 

Gene name
PPP2CB
Definition
(RefSeq) serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03015  mRNA surveillance pathway
vvp04071  Sphingolipid signaling pathway
vvp04114  Oocyte meiosis
vvp04136  Autophagy - other
vvp04140  Autophagy - animal
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04350  TGF-beta signaling pathway
vvp04390  Hippo signaling pathway
vvp04530  Tight junction
vvp04728  Dopaminergic synapse
vvp04730  Long-term depression
vvp05142  Chagas disease
vvp05160  Hepatitis C
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112916103 (PPP2CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    112916103 (PPP2CB)
   04390 Hippo signaling pathway
    112916103 (PPP2CB)
   04071 Sphingolipid signaling pathway
    112916103 (PPP2CB)
   04151 PI3K-Akt signaling pathway
    112916103 (PPP2CB)
   04152 AMPK signaling pathway
    112916103 (PPP2CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112916103 (PPP2CB)
   04136 Autophagy - other
    112916103 (PPP2CB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    112916103 (PPP2CB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112916103 (PPP2CB)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112916103 (PPP2CB)
  09156 Nervous system
   04728 Dopaminergic synapse
    112916103 (PPP2CB)
   04730 Long-term depression
    112916103 (PPP2CB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    112916103 (PPP2CB)
   05165 Human papillomavirus infection
    112916103 (PPP2CB)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    112916103 (PPP2CB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112916103 (PPP2CB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:vvp03019]
    112916103 (PPP2CB)
   04131 Membrane trafficking [BR:vvp04131]
    112916103 (PPP2CB)
   03036 Chromosome and associated proteins [BR:vvp03036]
    112916103 (PPP2CB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vvp04147]
    112916103 (PPP2CB)
Enzymes [BR:vvp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     112916103 (PPP2CB)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     112916103 (PPP2CB)
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     112916103 (PPP2CB)
Membrane trafficking [BR:vvp04131]
 Autophagy
  Other autophagy associated proteins
   Others
    112916103 (PPP2CB)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     112916103 (PPP2CB)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112916103 (PPP2CB)
SSDB
Motif
Pfam: Metallophos Glyco_hydro_65N
Other DBs
NCBI-GeneID: 112916103
NCBI-ProteinID: XP_025849344
UniProt: A0A3Q7RV93
LinkDB
Position
Unknown
AA seq 244 aa
MELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHESRQITQ
VYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDR
LQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVM
EGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTP
DYFL
NT seq 735 nt   +upstreamnt  +downstreamnt
atggaactttttagaattggtggaaaatcaccagatacaaactatctgttcatgggcgac
tatgtagacagaggctattactcagtggagactgtgactcttcttgtggcattaaaggtg
cgttatccagaacgcattacaatattgagaggaaaccatgaaagccgacaaattacccaa
gtttatggcttttacgatgaatgtctacgaaagtatggaaatgccaatgtttggaaatat
ttcacagatctatttgattatcttccacttacagctttagtagatggacagatattctgc
ctccacggtggcctctctccatccatagatacactggatcatattagagctttggatcgt
ttacaagaagttccacatgagggcccaatgtgtgatctgttgtggtcagatccagatgat
cgtggtgggtggggtatttcacctcgtggtgctggctacacatttggacaagacatttct
gaaacatttaaccatgccaatggtctcacactggtttctcgagctcaccaacttgtaatg
gagggatacaattggtgtcatgatcggaatgtggttaccattttcagtgcacccaattac
tgttatcgttgtgggaaccaggctgctatcatggaattagatgatactttaaaatactcc
ttccttcagtttgacccagcacctcgtcgtggagagcctcatgttacccggcgcacccca
gactacttcctgtaa

KEGG   Vulpes vulpes (red fox): 112917055
Entry
112917055         CDS       T05911                                 

Gene name
PPP2CA
Definition
(RefSeq) serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03015  mRNA surveillance pathway
vvp04071  Sphingolipid signaling pathway
vvp04114  Oocyte meiosis
vvp04136  Autophagy - other
vvp04140  Autophagy - animal
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04350  TGF-beta signaling pathway
vvp04390  Hippo signaling pathway
vvp04530  Tight junction
vvp04728  Dopaminergic synapse
vvp04730  Long-term depression
vvp05142  Chagas disease
vvp05160  Hepatitis C
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112917055 (PPP2CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    112917055 (PPP2CA)
   04390 Hippo signaling pathway
    112917055 (PPP2CA)
   04071 Sphingolipid signaling pathway
    112917055 (PPP2CA)
   04151 PI3K-Akt signaling pathway
    112917055 (PPP2CA)
   04152 AMPK signaling pathway
    112917055 (PPP2CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112917055 (PPP2CA)
   04136 Autophagy - other
    112917055 (PPP2CA)
  09143 Cell growth and death
   04114 Oocyte meiosis
    112917055 (PPP2CA)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112917055 (PPP2CA)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112917055 (PPP2CA)
  09156 Nervous system
   04728 Dopaminergic synapse
    112917055 (PPP2CA)
   04730 Long-term depression
    112917055 (PPP2CA)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    112917055 (PPP2CA)
   05165 Human papillomavirus infection
    112917055 (PPP2CA)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    112917055 (PPP2CA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112917055 (PPP2CA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:vvp03019]
    112917055 (PPP2CA)
   04131 Membrane trafficking [BR:vvp04131]
    112917055 (PPP2CA)
   03036 Chromosome and associated proteins [BR:vvp03036]
    112917055 (PPP2CA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vvp04147]
    112917055 (PPP2CA)
Enzymes [BR:vvp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     112917055 (PPP2CA)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     112917055 (PPP2CA)
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     112917055 (PPP2CA)
Membrane trafficking [BR:vvp04131]
 Autophagy
  Other autophagy associated proteins
   Others
    112917055 (PPP2CA)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     112917055 (PPP2CA)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112917055 (PPP2CA)
SSDB
Motif
Pfam: Metallophos STPPase_N Glyco_hydro_65N YqzH
Other DBs
NCBI-GeneID: 112917055
NCBI-ProteinID: XP_025850687
UniProt: A0A3Q7RW18
LinkDB
Position
Unknown
AA seq 309 aa
MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgagaaggtgttcaccaaggagctggaccagtggatcgagcagctgaacgagtgc
aagcagctgtccgagtcccaggtcaagagcctctgcgagaaggctaaagaaatcctgaca
aaagaatccaacgtgcaagaagttcgatgtccagtcaccgtctgtggagatgtacatggg
caatttcatgatctcatggaactgtttagaattggtggcaaatcaccagacacaaactac
ctgtttatgggagattatgttgacagaggatattactcagttgaaacagttactctgctt
gtagctcttaaggttcgttaccgtgaacgcatcaccattcttcgaggaaatcatgaaagc
agacagatcacacaagtatatggtttctatgatgagtgtttaaggaaatatggaaatgca
aatgtttggaaatactttacagatctttttgactatcttcctctcactgccttggttgat
gggcagatattctgtctacatggtggcctctcaccatccatagatacactggatcacatc
agagcacttgatcgcctacaagaagttcctcatgagggtccaatgtgtgacttgctgtgg
tcagatccagatgatcgtggtggttggggtatatctcctagaggagctggttacaccttt
gggcaagacatttctgaaacatttaatcatgccaatggcctcacattggtatccagagct
caccagctggtgatggagggatataactggtgccatgaccggaatgtagtaacgattttc
agtgctccaaactattgttatcgttgtggtaatcaagctgcgatcatggaacttgatgat
actctaaaatactctttcttgcagtttgacccagcacctcgcagaggcgagccacatgtt
actcgtcgtaccccagactacttcctgtaa

KEGG   Vulpes vulpes (red fox): 112920859
Entry
112920859         CDS       T05911                                 

Gene name
PPP2R2C
Definition
(RefSeq) protein phosphatase 2, regulatory subunit B, gamma isoform X1
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03015  mRNA surveillance pathway
vvp04071  Sphingolipid signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04390  Hippo signaling pathway
vvp04530  Tight junction
vvp04728  Dopaminergic synapse
vvp05142  Chagas disease
vvp05160  Hepatitis C
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112920859 (PPP2R2C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    112920859 (PPP2R2C)
   04071 Sphingolipid signaling pathway
    112920859 (PPP2R2C)
   04151 PI3K-Akt signaling pathway
    112920859 (PPP2R2C)
   04152 AMPK signaling pathway
    112920859 (PPP2R2C)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112920859 (PPP2R2C)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112920859 (PPP2R2C)
  09156 Nervous system
   04728 Dopaminergic synapse
    112920859 (PPP2R2C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    112920859 (PPP2R2C)
   05165 Human papillomavirus infection
    112920859 (PPP2R2C)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    112920859 (PPP2R2C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112920859 (PPP2R2C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:vvp03019]
    112920859 (PPP2R2C)
   03036 Chromosome and associated proteins [BR:vvp03036]
    112920859 (PPP2R2C)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     112920859 (PPP2R2C)
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     112920859 (PPP2R2C)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     112920859 (PPP2R2C)
SSDB
Other DBs
NCBI-GeneID: 112920859
NCBI-ProteinID: XP_025855655
UniProt: A0A3Q7TKJ8
LinkDB
Position
Unknown
AA seq 447 aa
MGEDTDTRKINHSFLRDHSYVTEADIISTVEFNHTGELLATGDKGGRVVIFQREPESKNA
PHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKI
TERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRVFANGHTYHINSIS
VNSDCETYMSADDLRINLWHLAITDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVY
SSSKGSLRLCDMRAAALCDKHSKLFEEPEDPSNRSFFSEIISSVSDVKFSHSGRYMLTRD
YLTVKVWDLNMEARPIETYQVHDYLRSKLCSLYENDCIFDKFECAWNGSDSVIMTGAYNN
FFRMFDRNTKRDVTLEASRESSKPRAVLKPRRVCVGGKRRRDDISVDSLDFTKKILHTAW
HPAENIIAIAATNNLYIFQDKVNSEMH
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgggcgaggacacggacacgcggaaaattaaccacagcttcctgcgggaccacagctat
gtgactgaagccgatatcatctctaccgttgagttcaaccacaccggagagctgctggcc
acaggcgacaagggtggccgggttgtcatcttccagcgggagccggagagtaaaaatgca
cctcacagccagggcgagtatgacgtctacagcaccttccagagccacgagccggagttt
gactatctcaagagtctggagatagaggaaaaaatcaacaagatcaagtggcttccgcag
cagaatgccgcccactccctgctgtccaccaacgacaaaactatcaaattatggaagatt
accgaacgagataaaaggcccgagggctataacctaaaagatgaagaaggaaagcttaag
gacctgtccacggtgacgtcattgcaggtacctgtgctgaagcccatggatttgatggtg
gaggtgagcccacggagagtcttcgctaatggccatacctaccacatcaactccatctcc
gtcaatagcgactgcgagacgtacatgtcagcggatgacctgcgcatcaacctgtggcac
ctggccatcactgacaggagcttcaacatcgtggacatcaagccggccaacatggaagac
ctcacagaggtgatcacagcatctgagttccacccccaccactgcaacctctttgtgtac
agcagcagcaagggctctctgcgtctctgcgacatgcgtgcagccgccctgtgtgacaag
cactccaaactgtttgaagagcctgaggaccccagtaaccgctccttcttctcggaaatc
atctcctctgtgtcggatgtgaagttcagccacagcggccggtacatgctcacccgggat
tacctcacggtcaaagtctgggacctgaacatggaggcaaggcccatagagacctaccag
gtccatgattaccttcggagcaagctctgttccctgtatgagaatgactgcattttcgac
aagtttgaatgtgcctggaacgggagcgacagcgtcattatgaccggggcctacaacaac
ttcttccgcatgtttgaccggaacacgaagcgcgacgtgaccctggaggcgtcgagggag
agcagcaagccccgggccgtgctcaagccacggcgtgtgtgcgtggggggcaagcgcagg
cgggacgacatcagcgtggacagcctggacttcaccaagaagattctgcacacagcctgg
cacccggccgagaacatcatcgccatcgcggccaccaacaacctgtacatcttccaggac
aaagtgaactctgagatgcactag

KEGG   Vulpes vulpes (red fox): 112921351
Entry
112921351         CDS       T05911                                 

Gene name
PPP2R5E
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform isoform X1
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03015  mRNA surveillance pathway
vvp04071  Sphingolipid signaling pathway
vvp04114  Oocyte meiosis
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04728  Dopaminergic synapse
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112921351 (PPP2R5E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    112921351 (PPP2R5E)
   04151 PI3K-Akt signaling pathway
    112921351 (PPP2R5E)
   04152 AMPK signaling pathway
    112921351 (PPP2R5E)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112921351 (PPP2R5E)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112921351 (PPP2R5E)
  09156 Nervous system
   04728 Dopaminergic synapse
    112921351 (PPP2R5E)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112921351 (PPP2R5E)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112921351 (PPP2R5E)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:vvp03019]
    112921351 (PPP2R5E)
   03036 Chromosome and associated proteins [BR:vvp03036]
    112921351 (PPP2R5E)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     112921351 (PPP2R5E)
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     112921351 (PPP2R5E)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     112921351 (PPP2R5E)
SSDB
Motif
Pfam: B56 Sec7_N SBF2
Other DBs
NCBI-GeneID: 112921351
NCBI-ProteinID: XP_025856328
UniProt: A0A3Q7SIX2
LinkDB
Position
Unknown
AA seq 475 aa
MYWNDSRDMSSAPTTPPSVDKVDGFSRKSVRKARQKRSQSSSQFRSQGKPIELTPLPLLK
DVPSSEQPELFLKKLQQCCVIFDFMDTLSDLKMKEYKRSTLNELVDYITISRGCLTEQTY
PEVVRMVSCNIFRTLPPSDSNEFDPEEDEPTLEASWPHLQLVYEFFIRFLESQEFQPSIA
KKYIDQKFVLQLLELFDSEDPRERDYLKTVLHRIYGKFLGLRAFIRKQINNIFLRFVYET
EHFNGVAELLEILGSIINGFALPLKAEHKQFLVKVLIPLHTVRSLSLFHAQLAYCIVQFL
EKDPSLTEPVIRGLMKFWPKTCSQKEVMFLGELEEILDVIEPSQFVKIQEPLFKQIAKCV
SSPHFQVAERALYYWNNEYIMSLIEENSNVILPIMFSSLYRISKEHWNPAIVALVYNVLK
AFMEMNSTMFDELTATYKSDRQREKKKEKEREELWKKLEDLELKRGLRRDGIIPT
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgtattggaatgacagtagggatatgtcctcagcaccaactactcctccatcagtggat
aaagtagacggattttctcggaagtccgtcagaaaagccagacagaagaggtcgcaaagt
tcctcacagtttaggtctcaaggcaaacctattgagttaacacctctgccgctgctaaaa
gacgttccatcctcagagcagcctgaactgttcctaaagaaacttcagcagtgctgtgtc
atttttgacttcatggacacgctatctgatcttaaaatgaaagaatacaagcgctccact
cttaatgaactggtggactacattacaataagcagaggctgtttgacagagcagacttac
cctgaagtagttagaatggtatcttgcaatatattcagaactctccctcctagtgacagc
aatgaatttgatccagaagaagatgaaccaacccttgaggcatcgtggccacatttacag
cttgtatatgaatttttcatacgatttttggaaagccaagaattccaacccagcattgcc
aaaaaatacatagatcagaaatttgtattacagcttttggagctatttgacagcgaagac
cctcgggaacgggactacttaaaaacagtcttacacagaatttatggcaaatttcttggt
cttagagcatttatccgaaaacagattaacaatatttttctaaggtttgtttatgaaaca
gaacacttcaatggggtagctgaactgctggaaatattaggaagtattatcaatggcttt
gctttacctcttaaggcagaacacaaacagtttctggtgaaagtgttgattcctttacac
actgtcaggagcttatcactcttccatgcccagctggcatattgcatagtacagtttttg
gagaaagatccttcactcacagaaccagttattagggggctaatgaaattttggcctaaa
acatgtagtcaaaaagaggtcatgttccttggggagctggaggaaatattggatgtgatt
gaaccctcacaatttgttaaaattcaagaacctttgtttaaacaaattgccaagtgtgta
tctagcccccattttcaggtggcagaaagggcactgtattattggaataatgaatacatc
atgagtttgatagaagaaaactctaatgtcatccttcccatcatgttttccagtctttat
aggatttcaaaagaacattggaatccggctattgtggcactagtgtacaatgtgttgaag
gcatttatggaaatgaacagcaccatgtttgatgagctgacagccacatacaagtcagat
cgtcagcgtgagaaaaagaaagaaaaagagcgtgaagaactatggaaaaaactggaggat
ctggaattaaagagaggtcttagacgtgatggcataattccaacctaa

KEGG   Vulpes vulpes (red fox): 112921765
Entry
112921765         CDS       T05911                                 

Gene name
PPP2R5A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03015  mRNA surveillance pathway
vvp04071  Sphingolipid signaling pathway
vvp04114  Oocyte meiosis
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04728  Dopaminergic synapse
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112921765 (PPP2R5A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    112921765 (PPP2R5A)
   04151 PI3K-Akt signaling pathway
    112921765 (PPP2R5A)
   04152 AMPK signaling pathway
    112921765 (PPP2R5A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112921765 (PPP2R5A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112921765 (PPP2R5A)
  09156 Nervous system
   04728 Dopaminergic synapse
    112921765 (PPP2R5A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112921765 (PPP2R5A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112921765 (PPP2R5A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:vvp03019]
    112921765 (PPP2R5A)
   03036 Chromosome and associated proteins [BR:vvp03036]
    112921765 (PPP2R5A)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     112921765 (PPP2R5A)
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     112921765 (PPP2R5A)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     112921765 (PPP2R5A)
SSDB
Motif
Pfam: B56
Other DBs
NCBI-GeneID: 112921765
NCBI-ProteinID: XP_025856862
UniProt: A0A3Q7T895
LinkDB
Position
Unknown
AA seq 493 aa
MSSSSSSSPPPPPPAGAAGAAISASEKVDGFTRKSVRKAQRQKRSQGSSQFRSQGSQAEL
HPLPQLKDATSNEQQELFCQKLQQCCILFDFMDSVSDLKSKEIKRATLNELVEYVSTNRG
VIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASWPHIQLVYEFFLRFLESP
DFQPSIAKRYIDQKFVQQLLELFDSEDPRERDFLKTVLHRIYGKFLGLRAFIRKQINNIF
LRFIYETEHFNGVAELLEILGSIINGFALPLKAEHKQFLMKVLIPMHTAKGLALFHAQLA
YCVVQFLEKDTTLTEPVIRGLLKFWPKTCSQKEVMFLGEIEEILDVIEPTQFKKIEEPLF
KQISKCVSSSHFQVAERALYFWNNEYILSLIEENIDKILPIMFGSLYKISKEHWNPTIVA
LVYNVLKTLMEMNGKLFDDLTSSYKAERQREKKKELEREELWKKLEELKLKKALEKQNSA
YNMHSILSNTSDE
NT seq 1482 nt   +upstreamnt  +downstreamnt
atgtcgtcgtcgtcgtcgtcgtcgccgccgccgccgccgccggcgggggctgccggcgcc
gccatctcggcctcggagaaagtggacggcttcacccggaaatcggtgcgcaaggcgcag
aggcagaagcgctcgcagggctcgtcgcagttccgcagccagggcagccaggcggagctg
caccccctgccccagctcaaagatgccacttccaatgaacaacaagagcttttctgtcag
aagttgcagcagtgttgtatactgtttgatttcatggactctgtttcagacttgaagagc
aaagaaattaaaagagcaacactgaatgaactggttgagtatgtttcaactaatcgtggt
gtaattgttgaatcagcgtattctgatatagtaaaaatgatcagcgctaatatcttccgt
actcttcctccaagtgataatccagattttgatccagaagaggatgaacccacgcttgag
gcctcttggcctcacatacaattggtgtatgaattcttcttaagatttttggagagccct
gatttccagcctagcattgcaaagcgatacattgatcagaaatttgtacaacagctcctg
gagctttttgatagtgaagatcccagagaacgtgacttcctgaagactgttctgcaccga
atttatgggaaatttcttggattaagagcattcatcagaaaacaaattaacaacattttc
ctcaggtttatatatgaaacagaacatttcaatggtgttgctgaactccttgaaatatta
ggaagtattatcaatggctttgcattgccactgaaagcagaacataaacaatttctaatg
aaggttcttattcctatgcatactgcaaaaggattagctttgtttcatgctcagctagcc
tactgtgtcgtacagttcctggagaaggatactacactaacagaaccagtgatcagaggg
ttgctgaaattttggccaaaaacatgcagtcagaaagaggtgatgtttttaggagaaatt
gaagaaatcttagatgttattgaacccacacagttcaaaaaaattgaggagccccttttt
aagcagatatccaagtgtgtatccagttctcattttcaggttgcagaaagggcattgtac
ttctggaataatgagtatattcttagtttgattgaggagaacattgataaaattctgcca
attatgtttggcagtttatataaaatctccaaagaacactggaatccgaccattgtagca
ctggtgtacaatgtgcttaaaaccctaatggaaatgaacggcaagctgttcgatgacctt
actagctcatacaaagctgaaagacaaagagagaaaaagaaggaactggaacgtgaagaa
ttatggaaaaaattagaggagctaaagctaaagaaagctctggaaaagcagaacagtgct
tacaacatgcacagtattctcagcaatacaagtgatgaataa

KEGG   Vulpes vulpes (red fox): 112924290
Entry
112924290         CDS       T05911                                 

Gene name
PPP2R5B
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform isoform X1
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03015  mRNA surveillance pathway
vvp04071  Sphingolipid signaling pathway
vvp04114  Oocyte meiosis
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04728  Dopaminergic synapse
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112924290 (PPP2R5B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    112924290 (PPP2R5B)
   04151 PI3K-Akt signaling pathway
    112924290 (PPP2R5B)
   04152 AMPK signaling pathway
    112924290 (PPP2R5B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112924290 (PPP2R5B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112924290 (PPP2R5B)
  09156 Nervous system
   04728 Dopaminergic synapse
    112924290 (PPP2R5B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112924290 (PPP2R5B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112924290 (PPP2R5B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:vvp03019]
    112924290 (PPP2R5B)
   03036 Chromosome and associated proteins [BR:vvp03036]
    112924290 (PPP2R5B)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     112924290 (PPP2R5B)
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     112924290 (PPP2R5B)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     112924290 (PPP2R5B)
SSDB
Motif
Pfam: B56 FTCD_C
Other DBs
NCBI-GeneID: 112924290
NCBI-ProteinID: XP_025860280
UniProt: A0A3Q7TY39
LinkDB
Position
Unknown
AA seq 521 aa
METKLPPASTPTSPSSPGLSPVPPPDKVDGFSRRSLRRARPRRSHSSSQFRYQSNQQELT
PLPLLKDVPASELHELLSRKLAQCGVMFDFLDCVADLKGKEVKRAALNELVECVGSTRGV
LIEPVYPDIIRMISVNIFRTLPPSENPEFDPEEDEPNLEPSWPHLQLVYEFFLRFLESPD
FQPSVAKRYVDQKFVLMLLELFDSEDPREREYLKTILHRVYGKFLGLRAYIRKQCSHIFL
RFIYEFEHFNGVAELLEILGSIINGFALPLKTEHKQFLVRVLIPLHSVKSLSVFHAQLAY
CVVQFLEKDATLTEHVSTSGGEGSPHPFRSDSFLLQLPQVIRGLLKYWPKTCTQKEVMFL
GEMEEILDVIEPSQFVKIQEPLFKQVARCVSSPHFQVAERALYFWNNEYILSLIEDNCHT
VLPAVFGTLYQVSKEHWNQTIVSLIYNVLKTFMEMNGKLFDELTASYKLEKQQEQQKARE
RQELWQGLEELRLRRLQGTQGAKEAPLQRLTPQVATSGGQS
NT seq 1566 nt   +upstreamnt  +downstreamnt
atggagacaaaactgccccctgcaagcacccccaccagcccttcttccccagggctatcg
cctgtgcccccacccgacaaggtggatggcttctcccgccgttcccttcgcagagcccgg
ccccggcgctcccatagctcctctcagttccgctatcagagcaaccagcaagagctcact
ccactgcccctgctcaaagatgtgccagcctctgagctgcatgagctgttgagccggaag
ctggcccaatgtggggtgatgtttgactttttggactgtgtggctgacctgaaggggaag
gaggtgaagcgggcagcactcaatgagctggtggagtgtgtggggagcacccggggagtc
ctcattgaacctgtctacccagacatcattcgcatgatctcagtgaatatcttccggacc
ctaccacccagtgagaaccctgaatttgatcctgaagaggatgaacccaaccttgagcct
tcctggccacatctgcagctggtatatgagtttttcctgcgtttcttggaaagtccagat
ttccaaccctccgtggccaagagatatgtggatcaaaagtttgtcctgatgctcctggag
ctatttgatagtgaggacccccgggagcgtgagtacctcaagaccatcctgcaccgggtc
tatggcaagttcctggggctccgggcctacatccgcaaacagtgcagccacatctttctc
cgattcatctatgaattcgagcacttcaatggtgtggctgaactgctggagatcttagga
agcatcatcaatggctttgcactgcccctgaagactgagcacaagcagttcctggtccgg
gtcctgattcccctacactctgtcaagtcactgtctgtttttcatgcccagctggcatac
tgtgtggtgcagttcctggagaaggatgccaccttgacagagcatgtgagtacctctggg
ggggaaggtagtccccatcccttcaggtctgactcttttctacttcaactcccacaggtg
atccgagggctgctcaaatactggccaaaaacctgtacccagaaagaggtgatgtttctg
ggggagatggaagagattcttgatgtcattgagccctcccagtttgtgaagatccaggag
cccctctttaagcaggtggcccggtgtgtttccagcccccatttccaggttgcagagcgg
gctctgtatttctggaacaatgagtatatcctgagcctcatcgaggacaactgccacact
gtgctgcctgctgtgtttgggaccctctaccaagtctctaaggagcactggaatcaaacc
atcgtgtctctgatctacaatgtgctcaagacgttcatggagatgaatggaaagctgttt
gatgagctcacagcctcctacaagcttgaaaagcagcaggagcagcagaaggcccgggag
cgtcaggaactatggcaaggcctggaggagctacggctacgccggttacaggggacccaa
ggggccaaagaggcacctctccaacggcttacaccccaggtggccaccagtgggggtcag
agctag

KEGG   Vulpes vulpes (red fox): 112925972
Entry
112925972         CDS       T05911                                 

Gene name
PPP2R1B
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform isoform X1
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03015  mRNA surveillance pathway
vvp04071  Sphingolipid signaling pathway
vvp04114  Oocyte meiosis
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04350  TGF-beta signaling pathway
vvp04390  Hippo signaling pathway
vvp04530  Tight junction
vvp04728  Dopaminergic synapse
vvp04730  Long-term depression
vvp05142  Chagas disease
vvp05160  Hepatitis C
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112925972 (PPP2R1B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    112925972 (PPP2R1B)
   04390 Hippo signaling pathway
    112925972 (PPP2R1B)
   04071 Sphingolipid signaling pathway
    112925972 (PPP2R1B)
   04151 PI3K-Akt signaling pathway
    112925972 (PPP2R1B)
   04152 AMPK signaling pathway
    112925972 (PPP2R1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112925972 (PPP2R1B)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112925972 (PPP2R1B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112925972 (PPP2R1B)
  09156 Nervous system
   04728 Dopaminergic synapse
    112925972 (PPP2R1B)
   04730 Long-term depression
    112925972 (PPP2R1B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    112925972 (PPP2R1B)
   05165 Human papillomavirus infection
    112925972 (PPP2R1B)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    112925972 (PPP2R1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112925972 (PPP2R1B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:vvp03019]
    112925972 (PPP2R1B)
   03036 Chromosome and associated proteins [BR:vvp03036]
    112925972 (PPP2R1B)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     112925972 (PPP2R1B)
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     112925972 (PPP2R1B)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     112925972 (PPP2R1B)
SSDB
Motif
Pfam: HEAT HEAT_2 HEAT_EZ Vac14_Fab1_bd Cnd1 Adaptin_N M11L CLASP_N AEP1
Other DBs
NCBI-GeneID: 112925972
NCBI-ProteinID: XP_025862597
UniProt: A0A3Q7TMT9
LinkDB
Position
Unknown
AA seq 618 aa
MKSGEALNLFSSWRWASSSLVRQSPRSTVRITQLRLNSIKKLSTIALALGVERTRTELLP
FLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLTPSGNCHLGHEILAVLQKSCLQP
PLESLATVEETVVRDKAVESLRQISQEHTPVALEAHFVPLVKRLASGDWFTSRTSACGLF
SVCYPRASNAVKAEIRQHFRSLCSDDTPMVRRAAASKLGEFAKVLELDSVKSEIVPLFTN
LASDEQDSVRLLAVEACVSIAQLLSQEDLEALVMPTLRQAAEDKSWRVRYMVADKFSELQ
KAVGPKITLHDLIPAFQNLLKDCEAEVRAAAAHKVKELCENLPTEGRETIIMNQILPYIK
ELVSDTNQHVKSALASVIMGLSTILGKENTIEHLLPLFLAQLKDECPEVRLNIISNLDCV
NEVIGIRQLSQSLLPAIVELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWL
VDHVYAIREAATNNLMKLVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEA
CGQEITTKQMLPIVLKMAGDQVANVRFNVAKSLQKIGPILDTDALQEEVKPVLQKLGQDE
DMDVKYFAQEAISVLALA
NT seq 1857 nt   +upstreamnt  +downstreamnt
atgaagtcaggggaggcgctaaatttgttttcctcctggcgttgggcatcatcctctttg
gtccgccagagtcccaggagcacagttcgcatcactcagctccgtctcaacagtattaag
aagttatcaacaattgctctagcgcttggagtcgaaaggacgcgaacagaactgctgcca
ttccttacggatacaatttatgatgaagatgaggtactgttagctcttgctgagcaactg
ggaaatttcactggcctggtgggaggtcctgactttgcccactgtttgctgacaccatct
gggaattgccatctgggacatgagatcttggctgtcctacagaagtcgtgtcttcagcct
cctttggaaagtttggcaactgtggaagagactgtggttcgagacaaggctgtggagtcc
ctgaggcagatctcccaggagcatactcctgttgctttggaagcacattttgtacctctg
gtgaaacgcctggcgagtggtgattggttcacttctcgcacatctgcatgtggtttgttc
agcgtttgctatcccagggcgtcaaatgctgtcaaggcagagattagacagcacttccgt
tccttgtgctcagatgacactccaatggtacgacgtgctgccgcttccaaactgggcgaa
tttgcaaaagttttggaattagacagtgtgaaaagtgaaattgttccactgttcactaat
ctagcttcagatgaacaggattcagtgcgtctcctagctgtggaagcctgtgtcagcatt
gctcagttactgtctcaagaggacctcgaggctttggtgatgcctacgcttcggcaagca
gcagaagataaatcttggagggtccgctacatggtagctgataagttttcagagctccag
aaagctgtgggccctaaaatcaccttacacgacctcatccccgcctttcagaacctactt
aaagactgtgaagctgaagtccgagcagctgctgcccacaaagtaaaagaactttgtgag
aacttgcccactgaaggtagagagaccataattatgaatcaaattctgccctatataaag
gaattagtatctgatacaaatcaacacgtcaaatcagctctagcttctgtaattatggga
ttgtctaccattttgggcaaagagaataccattgaacatcttctacctctctttttagct
cagttaaaggatgagtgtccagaagttcgtttgaatatcatctctaatttggattgtgta
aatgaagtgattgggatccgtcaactttctcagtctctccttcctgccatagtggagctg
gctgaagatgccaagtggagagtcaggctggccatcattgagtatatgccactgctggcg
ggccagctgggtgtggagttctttgacgaaaagctgaattctttatgtatggcctggctt
gtggaccatgtgtacgccatccgggaagctgccaccaacaacctcatgaaacttgttcag
aagtttggtacagagtgggcccagaataccatcgttcccaaagtgctagtaatggcaaat
gatcctaattacttgcacagaatgaccactttattctgcattaatgcgctgtctgaagcc
tgcgggcaggaaatcaccactaagcagatgttgcctatcgtgttgaaaatggcaggagac
caagtagcaaatgtccgtttcaatgtggccaaatctcttcagaaaattggaccaattcta
gatactgatgctctgcaggaggaagtgaagccagtgctacagaagttaggtcaagatgag
gacatggatgtcaaatactttgcacaggaagccataagtgtgcttgcgttggcataa

KEGG   Vulpes vulpes (red fox): 112926797
Entry
112926797         CDS       T05911                                 

Gene name
PPP2R2A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform isoform X1
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03015  mRNA surveillance pathway
vvp04071  Sphingolipid signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04390  Hippo signaling pathway
vvp04530  Tight junction
vvp04728  Dopaminergic synapse
vvp05142  Chagas disease
vvp05160  Hepatitis C
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112926797 (PPP2R2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    112926797 (PPP2R2A)
   04071 Sphingolipid signaling pathway
    112926797 (PPP2R2A)
   04151 PI3K-Akt signaling pathway
    112926797 (PPP2R2A)
   04152 AMPK signaling pathway
    112926797 (PPP2R2A)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112926797 (PPP2R2A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112926797 (PPP2R2A)
  09156 Nervous system
   04728 Dopaminergic synapse
    112926797 (PPP2R2A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    112926797 (PPP2R2A)
   05165 Human papillomavirus infection
    112926797 (PPP2R2A)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    112926797 (PPP2R2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112926797 (PPP2R2A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:vvp03019]
    112926797 (PPP2R2A)
   03036 Chromosome and associated proteins [BR:vvp03036]
    112926797 (PPP2R2A)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     112926797 (PPP2R2A)
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     112926797 (PPP2R2A)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     112926797 (PPP2R2A)
SSDB
Motif
Pfam: ANAPC4_WD40
Other DBs
NCBI-GeneID: 112926797
NCBI-ProteinID: XP_025863687
UniProt: A0A3Q7TQX2
LinkDB
Position
Unknown
AA seq 447 aa
MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQE
NKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIK
LWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHI
NSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCN
TFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYM
MTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTG
SYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKIL
HTAWHPKENIIAVATTNNLYIFQDKVN
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggcaggagctggaggagggaatgatattcagtggtgtttttctcaggtgaaaggagca
gtagatgatgatgtagcagaagcagatataatttctacagtagaatttaatcattctgga
gaattactagcaacaggagataaaggtggtagagttgtcatctttcaacaggagcaggag
aacaaaatccagtctcatagcagaggagaatataatgtttacagcacctttcagagccat
gaaccagagtttgactacttgaaaagtttagaaatagaagaaaagatcaacaaaattagg
tggttaccccagaaaaatgctgctcagtttttattgtctaccaatgataaaacaataaaa
ttatggaaaatcagtgaaagggacaaaagaccagaagggtataacttgaaagaggaagat
ggaaggtatagagatcctactacagtcactacactacgagtgccagtctttaggcccatg
gacctaatggttgaggccagtccacgaagaatatttgccaatgctcatacatatcacatc
aactcaatttctattaatagtgattatgaaacatatttatctgcagacgatttacggatt
aatctttggcatctggagatcacagacaggagttttaatattgtggatatcaagcctgcc
aatatggaagagctaactgaggtgattacggcagcagaattccatccaaacagctgcaac
acgtttgtatacagcagcagtaaaggaactattcggttatgtgacatgcgggcctctgcc
ctctgtgataggcattctaaactgtttgaagaacctgaagatcccagtaacaggtctttt
ttttctgaaatcatctcctcgatttccgatgtaaaattcagccatagtggtcgatatatg
atgactagagactatttgtcagtcaaaatttgggacttaaatatggaaaacaggcctgtg
gaaacataccaggttcatgaatacctcagaagtaaactttgttcactgtatgaaaatgac
tgcatatttgacaaatttgaatgttgttggaatggatctgacagtgttgtcatgaccgga
tcttacaataatttcttcagaatgtttgacaggaacaccaagcgagacataaccctagag
gcatcacgcgagaacaacaaaccgcgcacggttttgaagccacgcaaagtctgtgcaagt
ggcaagcgaaagaaagatgaaataagtgttgacagcctagacttcaacaagaaaatcctt
catacagcctggcaccccaaggaaaatatcattgctgtagctactacaaacaatctgtat
atatttcaagacaaagtgaattag

KEGG   Vulpes vulpes (red fox): 112928797
Entry
112928797         CDS       T05911                                 

Gene name
PPP2R2D
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform isoform X1
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03015  mRNA surveillance pathway
vvp04071  Sphingolipid signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04390  Hippo signaling pathway
vvp04530  Tight junction
vvp04728  Dopaminergic synapse
vvp05142  Chagas disease
vvp05160  Hepatitis C
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112928797 (PPP2R2D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    112928797 (PPP2R2D)
   04071 Sphingolipid signaling pathway
    112928797 (PPP2R2D)
   04151 PI3K-Akt signaling pathway
    112928797 (PPP2R2D)
   04152 AMPK signaling pathway
    112928797 (PPP2R2D)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112928797 (PPP2R2D)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112928797 (PPP2R2D)
  09156 Nervous system
   04728 Dopaminergic synapse
    112928797 (PPP2R2D)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    112928797 (PPP2R2D)
   05165 Human papillomavirus infection
    112928797 (PPP2R2D)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    112928797 (PPP2R2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112928797 (PPP2R2D)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:vvp03019]
    112928797 (PPP2R2D)
   03036 Chromosome and associated proteins [BR:vvp03036]
    112928797 (PPP2R2D)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     112928797 (PPP2R2D)
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     112928797 (PPP2R2D)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     112928797 (PPP2R2D)
SSDB
Motif
Pfam: Y_phosphatase2
Other DBs
NCBI-GeneID: 112928797
NCBI-ProteinID: XP_025866442
UniProt: A0A3Q7TZ59
LinkDB
Position
Unknown
AA seq 424 aa
MGSHSDIISTVEFNYSGDLLATGDKGGRVVIFQREQENKSRPHSRGEYNVYSTFQSHEPE
FDYLKSLEIEEKINKIRWLPQQNAAHFLLSTNDKTIKLWKISERDKRAEGYNLKDEDGRL
RDPFRITALRVPILKPMDLMVEASPRRIFANAHTYHINSISVNSDHETYLSADDLRINLW
HLEITDRSFNIVDIKPVNMEELTEVITAAEFHPHQCNVFVYSSSKGTIRLCDMRSSALCD
RHAKFFEEPEDPSSRSFFSEIISSISDVKFSHSGRYMMTRDYLSVKVWDLNMESRPVETH
QVHEYLRSKLCSLYENDCIFDKFECCWSGSDSAIMTGSYNNFFRMFDRTTRRDVTLEASR
ENSKPRASLKPRKVCTGGKRKKDEISVDSLDFNKKILHTAWHPAENIIAVAATNNLYIFQ
DKVN
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgggatcacactctgacatcatctcaactgttgaatttaattactctggagaccttctt
gcaacaggagacaagggcggcagagttgttatttttcagcgggaacaagagaataaaagc
cgccctcactctaggggagaatacaatgtttacagtacctttcaaagtcatgaaccagag
tttgactatttgaaaagtctagaaattgaggaaaagattaataaaattaggtggttacca
caacagaatgctgctcattttctactctctacaaatgataaaactattaaattatggaaa
ataagtgaacgggacaaaagagcagaaggttataacttgaaagatgaagatggacggctt
cgagacccatttcgaattacagcactgcgggtcccaatattgaagcctatggatcttatg
gtagaagcaagtccacgacgaatttttgcaaatgctcacacatatcatataaattccatt
tcagtaaatagtgatcatgaaacatatctttctgcagatgacctgagaattaatctatgg
catttagaaatcacagatagaagttttaacatcgtagacatcaagcctgtgaacatggag
gagctgacggaggtgatcacggcggccgagttccacccgcaccagtgcaacgtgtttgtc
tacagcagcagcaaagggaccatcagactgtgtgacatgcgctcctcggccctgtgtgac
agacacgcgaagttttttgaagaacccgaagatcccagcagtaggtccttcttctcagaa
ataatctcctccatctccgatgtgaaattcagtcacagtggtcggtacatgatgacccga
gactacctgtcggtgaaggtgtgggacctcaacatggagagccggcccgtggagacccac
caggtccacgagtacctgcgaagcaagctttgttctctgtacgaaaacgactgcatcttt
gacaagttcgagtgctgctggagcggttcggacagcgcgatcatgaccggctcctacaac
aacttcttcaggatgtttgaccggaccacacggagggacgtcacgctggaagcttcccgg
gagaacagcaagcctcgggccagcttaaagcctcggaaagtgtgtacaggcggtaagaga
aagaaggacgagattagtgtggacagtctggacttcaataagaagatcctgcacacggcc
tggcacccggcggagaacattatcgccgtggctgccaccaacaacctgtacatattccag
gacaaagtcaactaa

KEGG   Vulpes vulpes (red fox): 112930274
Entry
112930274         CDS       T05911                                 

Gene name
PPP2R5C
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform isoform X1
  KO
K11584  serine/threonine-protein phosphatase 2A regulatory subunit B'
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03015  mRNA surveillance pathway
vvp04071  Sphingolipid signaling pathway
vvp04114  Oocyte meiosis
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04728  Dopaminergic synapse
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112930274 (PPP2R5C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    112930274 (PPP2R5C)
   04151 PI3K-Akt signaling pathway
    112930274 (PPP2R5C)
   04152 AMPK signaling pathway
    112930274 (PPP2R5C)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112930274 (PPP2R5C)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112930274 (PPP2R5C)
  09156 Nervous system
   04728 Dopaminergic synapse
    112930274 (PPP2R5C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112930274 (PPP2R5C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112930274 (PPP2R5C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:vvp03019]
    112930274 (PPP2R5C)
   03036 Chromosome and associated proteins [BR:vvp03036]
    112930274 (PPP2R5C)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     112930274 (PPP2R5C)
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     112930274 (PPP2R5C)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     112930274 (PPP2R5C)
SSDB
Motif
Pfam: B56
Other DBs
NCBI-GeneID: 112930274
NCBI-ProteinID: XP_025868393
UniProt: A0A3Q7TF74
LinkDB
Position
Unknown
AA seq 571 aa
MAESPKAGKSGKSSKEGQDIIESETSSRKNNLAAPPSTVSSKIKVPVPQPIVKKEKRQNS
SRFNASNNRELQKLPSLKDVPPADQEKLFIQKLRQCCVLFDFVSDPLSDLKWKEVKRAAL
SEMVEYITHNRNVITEPIYPEVVHMFAVNMFRTLPPSSNPTGAEFDPEEDEPTLEAAWPH
LQLVYEFFLRFLESPDFQPNIAKKYIDQKFVLQLLELFDSEDPRERDFLKTTLHRIYGKF
LGLRAYIRKQINNIFYRFIYETEHHNGIAELLEILGSIINGFALPLKEEHKIFLLKVLLP
LHKVKSLSVYHPQLAYCVVQFLEKDSTLTEPVVMALLKYWPKTHSPKEVMFLNELEEILD
VIEPSEFVKIMEPLFRQLAKCVSSPHFQVAERALYYWNNEYIMSLISDNAAKILPIMFPS
LYRNSKTHWNKTIHGLIYNALKLFMEMNQKLFDDCTQQFKAEKLKEKLKMKEREEAWVKI
ENLAKANPQYAVYSQASTMSIPVAMETDGPLFEDVQMLRKAVNEEARQAQKDLKKDRPGV
RRKPELPQDPHTKNALEAHCRADELVSQDGR
NT seq 1716 nt   +upstreamnt  +downstreamnt
atggctgaatcaccaaaagcagggaaaagtggaaaaagttcaaaggaaggacaagacata
atagaatcagagacttccagcaggaaaaacaaccttgctgctcccccgtctacagtgtcc
agcaaaataaaagtgccagtccctcagcccatagtgaagaaagagaagcggcaaaattcc
tccaggtttaacgccagcaataacagagagcttcaaaaactgccgtctctaaaagatgtt
cctcctgctgatcaagagaagctttttatccagaagctacgtcagtgttgtgtcctcttt
gactttgtttccgacccactaagtgacctaaagtggaaggaagtaaaacgagccgctcta
agtgaaatggtggagtacatcacccataatcggaacgtgatcacagagcctatttaccca
gaagtagtccacatgtttgcagttaacatgtttcgaacgttaccaccttcctccaatcct
acgggagcagaatttgaccccgaggaagacgagcccacgttagaagcagcctggcctcat
ctacagcttgtttatgaatttttcttaagatttttagagtctccagatttccaacctaat
atagcgaagaaatatattgatcagaagtttgtattgcagcttttagagctctttgacagt
gaagatcctcgggagagagattttcttaaaactacccttcacagaatctatggaaaattc
ttaggcttaagagcttacatcagaaaacagataaataatatattttataggtttatttat
gaaacagagcatcacaacggcatagcagaattactggaaatcttggggagtataattaat
ggatttgccttaccactaaaagaagagcacaagattttcttactgaaggtgttgctacct
ttgcacaaagtgaaatctctgagtgtctaccatccacagctggcgtactgtgtagtgcag
tttctagaaaaggacagcaccctcactgaaccggtggtgatggcacttctcaaatactgg
ccaaagacccatagtccaaaagaagtcatgttcttaaatgaactagaagagatcttagac
gtaatcgaaccatcagaatttgtgaagatcatggagccgctcttccggcagttggccaaa
tgtgtgtccagcccacacttccaggtggcagagcgagcactgtattactggaacaatgag
tatatcatgagcctaatcagtgacaacgcagcaaagatcctacccatcatgtttccatcc
ttgtaccgcaactccaagacccactggaacaagacgatacatggcttgatctacaacgcg
ctgaagctcttcatggagatgaaccagaaactattcgacgactgcacccagcagtttaaa
gcagagaaactgaaagagaagctaaaaatgaaagaacgagaagaagcgtgggttaaaata
gaaaatctagccaaagcaaacccccagtacgcagtgtatagtcaagcgagcaccatgagc
attccggttgcaatggagacagatgggcctttgtttgaagatgtgcagatgctgagaaag
gccgtgaacgaagaggctcgccaggcccagaaagatctgaagaaggaccggcctggcgtg
cgccgcaagcccgagctgcctcaggacccccacaccaagaacgccttggaggcccactgc
cgagcggacgagctggtgtcccaggacggccgctag

KEGG   Vulpes vulpes (red fox): 112931417
Entry
112931417         CDS       T05911                                 

Gene name
PPP2R1A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03015  mRNA surveillance pathway
vvp04071  Sphingolipid signaling pathway
vvp04114  Oocyte meiosis
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04350  TGF-beta signaling pathway
vvp04390  Hippo signaling pathway
vvp04530  Tight junction
vvp04728  Dopaminergic synapse
vvp04730  Long-term depression
vvp05142  Chagas disease
vvp05160  Hepatitis C
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112931417 (PPP2R1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    112931417 (PPP2R1A)
   04390 Hippo signaling pathway
    112931417 (PPP2R1A)
   04071 Sphingolipid signaling pathway
    112931417 (PPP2R1A)
   04151 PI3K-Akt signaling pathway
    112931417 (PPP2R1A)
   04152 AMPK signaling pathway
    112931417 (PPP2R1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    112931417 (PPP2R1A)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112931417 (PPP2R1A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112931417 (PPP2R1A)
  09156 Nervous system
   04728 Dopaminergic synapse
    112931417 (PPP2R1A)
   04730 Long-term depression
    112931417 (PPP2R1A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    112931417 (PPP2R1A)
   05165 Human papillomavirus infection
    112931417 (PPP2R1A)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    112931417 (PPP2R1A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112931417 (PPP2R1A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:vvp03019]
    112931417 (PPP2R1A)
   03036 Chromosome and associated proteins [BR:vvp03036]
    112931417 (PPP2R1A)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     112931417 (PPP2R1A)
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     112931417 (PPP2R1A)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     112931417 (PPP2R1A)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 Adaptin_N CLASP_N TAF6_C M11L Spore_Cse60
Other DBs
NCBI-GeneID: 112931417
NCBI-ProteinID: XP_025869898
UniProt: A0A3Q7TJL4
LinkDB
Position
Unknown
AA seq 589 aa
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggcggccgccgacggcgacgactcgctctaccccatcgcagtgttgatagacgagctt
cgcaacgaggatgttcagcttcgtctcaacagcatcaagaaactgtccaccatagccctg
gcccttggggtggaaaggacccgcagcgagctcctgccctttctaacagataccatctac
gatgaggatgaggtcctcttggccctggcggaacagctgggaaccttcaccacgctggtg
ggaggccccgagtacgtccactgcctgctgccacccctggagtcgctggccacggtggag
gagacggtggtgcgggacaaggcggtggagtccttgcgggccatctcgcatgagcactca
ccctctgacctcgaggcccacttcgtgccactggtgaaacggctggcgggtggcgactgg
ttcacctcccgcacctcggcttgtggcctcttctctgtttgctacccccgcgtgtccagt
gccgtcaaggcagaacttcgacagtacttccggaacctgtgctcagatgacacccccatg
gtgcggcgggccgcagcctccaaactgggggaatttgccaaggtgctggaactggacaat
gtcaagagtgagatcatccccatgttttccaacctggcctctgacgagcaggactcagtg
cgactgttggcagtggaggcatgtgtgaacatcgcccagctactgccccaggaagatctg
gaagccctggtgatgcccacccttcgccaggctgctgaggacaagtcatggcgtgtccga
tacatggtggctgacaagttcacagaactccagaaagctgtggggcctgagatcaccaag
acagacctggtgcccgccttccagaacctaatgaaagactgtgaggctgaggtgagggcc
gcagcctcccacaaggtcaaagaattctgtgaaaatctctctgctgactgtcgggagaat
gtgatcatgacccagatcttaccctgcatcaaggagctggtgtcagatgccaaccaacac
gtgaagtcagccctggcctcagtcatcatgggcctctcccccatcctgggcaaagacaac
accattgagcacctgttgcccctctttctggctcagctgaaggatgagtgtccagaggtg
cggctcaacattatctccaacctggactgtgtgaatgaggtaatcggcatccggcagctg
tcccagtccctgctgcctgccattgtggaactggctgaagatgccaagtggcgagtgcgg
ttggccatcattgagtacatgcccctgctggctggacagctgggggtagaattctttgat
gagaagctcaactccttgtgcatggcctggcttgtggatcatgtctatgccatccgtgag
gcagccaccagcaacctgaagaagctggtggagaaatttgggaaggagtgggcccatgcc
actatcatccctaaggtcttggccatgtccggggaccccaactacctgcaccgcatgact
acgctcttctgcatcaatgtgctatctgaggtctgtgggcaggacatcaccaccaagcat
atgctccctacagtcctgcgtatggctggggaccctgtcgccaatgtccggttcaatgtg
gccaagtccctacagaagatagggcctatcctcgacaacagcacattgcagagcgaggtc
aagcccatcctagagaagctaacccaggaccaggatgtggatgtcaagtactttgcccag
gaggctctgactgttctgtctctcgcctga

KEGG   Vulpes vulpes (red fox): 112932510
Entry
112932510         CDS       T05911                                 

Gene name
PPP2R3A
Definition
(RefSeq) serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03015  mRNA surveillance pathway
vvp04071  Sphingolipid signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04728  Dopaminergic synapse
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112932510 (PPP2R3A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    112932510 (PPP2R3A)
   04151 PI3K-Akt signaling pathway
    112932510 (PPP2R3A)
   04152 AMPK signaling pathway
    112932510 (PPP2R3A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112932510 (PPP2R3A)
  09156 Nervous system
   04728 Dopaminergic synapse
    112932510 (PPP2R3A)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112932510 (PPP2R3A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112932510 (PPP2R3A)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:vvp03019]
    112932510 (PPP2R3A)
   03036 Chromosome and associated proteins [BR:vvp03036]
    112932510 (PPP2R3A)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     112932510 (PPP2R3A)
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     112932510 (PPP2R3A)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     112932510 (PPP2R3A)
SSDB
Motif
Pfam: EF-hand_13 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 DUF4116 DUF4187
Other DBs
NCBI-GeneID: 112932510
NCBI-ProteinID: XP_025871270
UniProt: A0A3Q7UVB8
LinkDB
Position
Unknown
AA seq 1152 aa
MAATYRLVVSTVNHYSSVVIDRRFEQAIHYCTGTCHTFTHGVDCIVVHHSVCADLLHIPV
SQFKDADLDSMFLPHENGFSSAEGDYHQQALAGIPRVKKGSTFQNTCNLKDIAGEAISFA
SGKIKEFSFEKLKNSNHAAYKKGRKVKSDSFNRRSVDFDLLCGHYNNDGNSPSFGLLRSS
SVEEKSLSHRNSLDTNLTSVLLHNFSEEDLVTQILEKHKIDNFSSGTDIKMCLDILLKCS
EDLKKCTDIIKQCIKKKSGSSINEGNGNDAISSSDTVYVNVMTRLASYLKKLPFEFMQPG
NNEAIDLTELVSNIPSLQLTPFSPVFGTEQPPKYEDVVQLSAPDSGQFQTIALQDDKHSS
RKTDAVKSIPNNSTNPLYNSEINDPRTVKDAQLQSQSLTMNSLENVSSSDLMETLYIEEE
SDGKKALDKGQRTENGPGQDLLKVNEDRAEFSDRGTPLKKYPASVQNESDKIFEKSVNLP
EEDRKLKAPKVEERDHRDFMNPNSQEEIDKLLMDLESFSQKMETSLREPLAKGKSPNSLN
SHNPLTGQLPIDLEPKSKVSSPTEKVSPSCLTRIIETNGHKIEEEDRVLLLRILESIEDF
AQELVECKSGRGSLSQEKEMMQILQETLTTSSQANLSVSRSPVGDKAKDTTSVVLIQQTP
EVIKIQNKPEKKPGTPLPPTATFPSSPRPLSPVPHVNNVVNAPLSINIPQFYFPEGLPDA
CSNHEQTLSKIETAFMDIEDQKADIYEMGKIAKLCGCPLYWKAPMFRAAGGERTGFVSAQ
SFIAMWRKLLNDHHDDASKFICLLAKPSCNSLEQEDFIPLLQDVVDTHPGLTFLKDAPEF
HSRYITTVIQRIFYTVNRSWSGKITSTEIRKSNFLQTLALLEEEEDINQITDYFSYEHFY
VIYCKFWELDSDHDLYISQADLSRYNDQASSNRIIERIFSGAVTRGKTVQKEGRMSYADF
VWFLISEEDKRNPTSIEYWFRCMDVDGDGVLSMYELEYFYEEQCERMEAMGIEPLPFHDL
LCQMLDLVKPATEGKITLRDLKRCRMAHIFYDTFFNLEKYLDHEQRDPFAVQKDIENEGP
EPSDWDRFAAEEYETLVAEESAQAQFQEGSFEDYETEEPASPSEIGNKSNKSKTVTSSLS
EKCGKLQSVDEE
NT seq 3459 nt   +upstreamnt  +downstreamnt
atggcagcaacttacagacttgtggtcagtactgtgaaccactacagcagtgtggtgata
gacaggcgttttgagcaagctatacattattgcactggaacctgtcatacctttacacat
ggagttgattgcattgtggtacatcatagtgtttgtgcagacctcttgcacatccctgtg
tctcagtttaaagatgcagatctggactctatgtttctaccccatgaaaatgggttttct
tcagccgagggtgactatcaccagcaggccctcgcaggcattcccagggtcaagaaagga
tctacctttcagaacacctgtaacttgaaggacattgcaggagaagcaatcagttttgcc
agcgggaaaataaaagaattttcctttgaaaagctcaaaaactctaaccatgcagcttac
aaaaagggaagaaaagttaagtctgactcatttaataggaggtcagttgattttgacttg
ctctgtggccattataacaatgatgggaactctccatcctttggtttactccggagttcc
tcagttgaggaaaaatctttgtcccatagaaactcacttgatacaaacctaacttcagtg
cttcttcacaacttctctgaagaagacctggttactcagattttggaaaaacataagata
gataatttttcttctggaacagacataaagatgtgcttggacatcttgctgaaatgctct
gaggatttgaaaaaatgtacagatatcataaaacaatgcataaagaagaagtcagggagt
agcatcaacgaaggaaatggcaatgatgcaatttctagttctgatactgtctatgtgaat
gtaatgactaggttagcatcctatctgaaaaagctaccatttgaattcatgcagcccggg
aataatgaggctatagatttaacagaactggtcagcaatatacccagtttacaactgact
cccttttccccagtatttggcactgaacagccccctaaatatgaagatgttgtccagctc
tcagcccctgactctggacagtttcaaactatagcactgcaagatgacaaacacagttct
aggaaaacagacgcagtaaaatccattccaaacaactctacaaatcccttatataactct
gagataaatgatcccagaactgtaaaagatgcccagcttcaatcacagtcattaaccatg
aattctttagaaaatgtttcttctagtgacctaatggaaaccctttatattgaagaagag
tcagatggaaagaaagcattggataaaggacaaaggacagagaatggacccggtcaggat
ttgttaaaggtaaatgaagatagagcagaattttcagaccgtggtactcctcttaaaaaa
tatcctgcctcagtgcaaaatgaaagtgataagatatttgagaaatcagttaacctacct
gaggaagatcgtaaattaaaagctcctaaagttgaagagagagaccacagagattttatg
aatcctaatagtcaggaagagatagataagttgttaatggatctggaatcattttcacag
aaaatggagacctctctaagagagccacttgccaaaggtaaaagccctaactccctaaat
agtcataatccattgactggtcagcttcctatagatcttgagcctaaatctaaagtctct
tcacccaccgaaaaagtctccccttcctgtctaacaaggattattgaaaccaatggacac
aaaatagaagaagaggatcgagtcctcttactgcgaattctagaaagcattgaagacttt
gctcaagaactagttgagtgcaaatcaggcagagggagcctatcacaagagaaggaaatg
atgcagattctacaggaaaccttgacaacttcctcccaggccaatttatcagtctctaga
agtcctgttggtgataaagccaaagatactacttcagtggttttgattcagcagactcca
gaggtgatcaagattcaaaataaaccagaaaagaaacctggaacgccacttccacctaca
gccacctttccaagtagtccccgacctctctcccctgttcctcatgtgaataatgttgtg
aatgcaccattgtccataaacattccacagttctactttcccgaaggactcccagatgcc
tgcagtaaccatgaacagactctaagcaaaattgaaactgctttcatggatattgaagat
cagaaagcagacatctatgaaatgggaaaaattgcaaagctctgcggctgtcctctctat
tggaaagcacccatgttcagggctgccgggggagagaggacaggatttgtgtccgcacag
tcgttcattgccatgtggagaaagttgctgaatgaccatcatgatgacgcctctaagttt
atctgtctgctagcaaagcccagctgcaactctctagaacaggaggattttatcccttta
cttcaggatgtggtggatacacaccctggcctcacattcttgaaagatgctccagaattc
cactcccgctacatcaccacggttattcagagaatattctacacagtcaacagatcttgg
agtggaaaaataacttcgacagagataagaaaaagcaactttttgcaaactctagccctt
ttggaagaagaggaagatataaaccaaatcacagattacttctcctatgaacatttctat
gttatttattgtaaattctgggaactagatagtgatcatgacctctacatcagccaggcc
gatttatctcgatacaatgaccaggcttcatcaaacagaattattgaaaggatattctct
ggggcagtaacaaggggtaaaacagtgcagaaagagggaagaatgagctatgcagatttt
gtttggtttttgatctctgaggaggacaaaaggaacccaaccagtattgagtattggttc
cgctgcatggatgtggatggggacggtgtactctccatgtacgagctagagtacttctat
gaggagcagtgtgaacggatggaagccatgggcattgagcccttgccattccatgatttg
ctgtgccagatgcttgacttggtaaagccagccactgaaggcaaaataacactacgagat
ctgaagagatgcagaatggcacacatcttttatgacactttctttaatctggaaaaatac
ttagaccatgaacagagagatccctttgcggtccagaaggatattgagaatgaggggcct
gagccttctgactgggacaggttcgcagctgaggaatatgagactcttgttgcagaggaa
tctgcccaagcacagttccaggaaggctcctttgaagattatgaaacagaggaacctgcc
tctccctctgaaattggaaacaaaagcaataaaagtaaaacagtaacctcaagcctttca
gagaaatgtggaaagcttcaatcagtggatgaagagtag

KEGG   Vulpes vulpes (red fox): 112934990
Entry
112934990         CDS       T05911                                 

Gene name
PPP2R2B
Definition
(RefSeq) serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B beta isoform isoform X1
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03015  mRNA surveillance pathway
vvp04071  Sphingolipid signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04390  Hippo signaling pathway
vvp04530  Tight junction
vvp04728  Dopaminergic synapse
vvp05142  Chagas disease
vvp05160  Hepatitis C
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112934990 (PPP2R2B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    112934990 (PPP2R2B)
   04071 Sphingolipid signaling pathway
    112934990 (PPP2R2B)
   04151 PI3K-Akt signaling pathway
    112934990 (PPP2R2B)
   04152 AMPK signaling pathway
    112934990 (PPP2R2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    112934990 (PPP2R2B)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112934990 (PPP2R2B)
  09156 Nervous system
   04728 Dopaminergic synapse
    112934990 (PPP2R2B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    112934990 (PPP2R2B)
   05165 Human papillomavirus infection
    112934990 (PPP2R2B)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    112934990 (PPP2R2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112934990 (PPP2R2B)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:vvp03019]
    112934990 (PPP2R2B)
   03036 Chromosome and associated proteins [BR:vvp03036]
    112934990 (PPP2R2B)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     112934990 (PPP2R2B)
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     112934990 (PPP2R2B)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     112934990 (PPP2R2B)
SSDB
Other DBs
NCBI-GeneID: 112934990
NCBI-ProteinID: XP_025874356
UniProt: A0A3Q7U8X4
LinkDB
Position
Unknown
AA seq 449 aa
MIPGIGALTQDTLWCFSQVKGTIEIGATEADIISTVEFNHTGELLATGDKGGRVVIFQRE
QESKNQVHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKT
VKLWKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEATPRRVFANAHTY
HINSISVNSDYETYMSADDLRINLWNFEITNQSFNIVDIKPANMEELTEVITAAEFHPHH
CNSFVYSSSKGTIRLCDMRASALCDRHSKFFEEPEDPSNRSFFSEIISSISDVKFSHSGR
YIMTRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIM
TGSYNNFFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKK
ILHTAWHPSENIIAVAATNNLYIFQDKVN
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgatacctggaattggggcactcacccaggacacactatggtgcttcagccaagtgaaa
ggcaccatcgagatcggagccacggaagctgacattatctctacggtagaattcaaccac
acgggagaattactagcgacaggggacaaggggggtcgggttgtaatatttcaacgagag
caagagagtaagaatcaggttcatcgtaggggtgaatacaatgtttacagcacattccag
agccatgaacccgagttcgattacctgaagagtttagaaatagaagaaaaaatcaataaa
ataagatggctccctcagcagaatgcagcctacttccttctgtctactaatgataaaact
gtgaagctgtggaaagtcagcgagcgtgataagaggccagaaggttacaatctgaaagat
gaggagggccggctccgggatcctgccaccatcacgaccttgagggtgcctgtcctgaga
cccatggacttgatggtggaggccaccccgcgaagagtatttgccaacgcacacacatat
cacatcaactctatatcagtcaacagcgactacgaaacctacatgtcagctgatgacctg
aggattaacctatggaactttgaaataaccaatcaaagttttaatatcgttgacattaag
ccggccaacatggaggagctcacggaggtgatcacagcagccgagttccacccgcatcac
tgcaacagcttcgtgtacagcagcagcaaagggacaatccggctgtgtgacatgagggcg
tcggccttgtgtgacaggcacagcaaattttttgaagagcccgaagatccaagcaacagg
tcgtttttctctgaaattatctcttcaatttcggatgtgaagttcagccacagtgggagg
tatatcatgaccagagactatctgaccgttaaagtctgggatctcaacatggaaaatcgt
cccattgagacttaccaggttcatgactacctccgcagcaagttgtgctccctctacgaa
aacgactgcatttttgataaatttgagtgtgtgtggaatgggtcagacagtgtcatcatg
acaggctcttacaacaacttcttcagaatgttcgacaggaacaccaagcgtgatgtcacc
ctggaggcctcgagggaaaacagcaaacctcgggctatcctaaaaccacggaaagtgtgc
gtggggggcaagcggagaaaagatgagatcagtgtcgacagtctggactttagcaaaaag
atcttgcatacagcttggcatccttcagaaaatattatagcagtggcggctacaaataac
ctatatatattccaggacaaggttaactag

KEGG   Vulpes vulpes (red fox): 112935323
Entry
112935323         CDS       T05911                                 

Gene name
PPP2R3C
Definition
(RefSeq) serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma isoform X1
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03015  mRNA surveillance pathway
vvp04071  Sphingolipid signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04728  Dopaminergic synapse
vvp05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    112935323 (PPP2R3C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    112935323 (PPP2R3C)
   04151 PI3K-Akt signaling pathway
    112935323 (PPP2R3C)
   04152 AMPK signaling pathway
    112935323 (PPP2R3C)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112935323 (PPP2R3C)
  09156 Nervous system
   04728 Dopaminergic synapse
    112935323 (PPP2R3C)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112935323 (PPP2R3C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112935323 (PPP2R3C)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:vvp03019]
    112935323 (PPP2R3C)
   03036 Chromosome and associated proteins [BR:vvp03036]
    112935323 (PPP2R3C)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     112935323 (PPP2R3C)
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     112935323 (PPP2R3C)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     112935323 (PPP2R3C)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_13 EF-hand_1 EF-hand_5 DUF61
Other DBs
NCBI-GeneID: 112935323
NCBI-ProteinID: XP_025874783
UniProt: A0A3Q7TYE4
LinkDB
Position
Unknown
AA seq 453 aa
MDWKEILRRRLAMPNTRTNRKKSEQELKDEEMDLFTKYYSEWKGDRKNTNEFYKTIPRFY
YRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINY
ENFLKVGEKAGPKCKQFFTAKVFAKLLHTDSYGRISIMQFFNYVMRKVWLHQTRIGLSLY
DVAGQGYLRESDLENYILELIPTLPQLDGLEKSFYSFYVCTAVRKFFFFLDPLRTGKIKI
QDILACSFLDDLLELRDEELSKESQETNWFSAPSALRVYGQYLNLDKDHNGMLSKEELSR
YGTATMTNVFLDRVFQECLTYDGEMDYKTYLDFVLALENRKEPAALQYIFKLLDIENKGY
LNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLINSNQGDTV
TTILIDLNGFWTYENREALVANDNENSTDLDDT
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggactggaaagagattcttcgccggcggttagcgatgcccaacacccgtacaaacaga
aaaaaaagtgaacaagaattaaaagatgaagaaatggatttgtttaccaaatactactca
gaatggaaaggagatagaaaaaacacaaatgaattctataagaccattccccggttttat
tataggctgccagccgaagatgaagtcttactacaaaaattaagagaggaatccagagct
gtctttctacaaaggaaaagcagagaactgttagataatgaagaattacagaacttatgg
tttttgctggataagcaccagacaccacctatgattggagaggaagcaatgattaattat
gaaaatttcttgaaggttggtgaaaaagctggaccaaaatgcaagcagtttttcacagca
aaagtctttgctaaacttcttcatacagactcttatggaagaatttctatcatgcagttc
ttcaattatgtcatgagaaaagtttggcttcatcagacaagaataggactcagtttatat
gatgttgctggacaagggtaccttcgggaatctgacttagaaaactacatactggaactt
atccctaccttgccacaattagatgggctggaaaagtctttttactccttttatgtttgt
acagcagttaggaagttcttcttctttttagaccctctgagaacagggaagattaaaatt
caagatattttagcatgcagcttcctagatgatttattggagttaagggatgaggaactg
tccaaggaaagtcaagaaactaattggttttctgcaccttctgccctaagggtatatggc
cagtatttgaatcttgataaggatcacaatggtatgctcagtaaagaagaactctcccgc
tatggaacagcaaccatgaccaacgtcttcttagatcgcgttttccaggagtgtctgact
tatgatggagaaatggattataagacctacctggactttgttcttgcgttagaaaatcga
aaagaacctgcagctctgcagtatattttcaaattacttgatattgagaacaaaggatat
ctgaatgtcttttcacttaattacttctttagggccatacaggaactaatgaaaatccat
ggacaagatcctgtttcatttcaagatgtcaaggatgaaatctttgacatggttaaacca
aaggatcctttgaaaatctctcttcaggatttaatcaacagtaatcaaggagacacagtc
accaccattctaattgatctgaatggcttctggacttacgagaacagagaagctcttgtt
gcaaatgacaatgaaaactctacagaccttgatgatacatga

DBGET integrated database retrieval system