KEGG   Vulpes vulpes (red fox): 112909041
Entry
112909041         CDS       T05911                                 

Gene name
TSC2
Definition
(RefSeq) tuberin isoform X1
  KO
K07207  tuberous sclerosis 2
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04072  Phospholipase D signaling pathway
vvp04115  p53 signaling pathway
vvp04140  Autophagy - animal
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04211  Longevity regulating pathway
vvp04218  Cellular senescence
vvp04714  Thermogenesis
vvp04910  Insulin signaling pathway
vvp04919  Thyroid hormone signaling pathway
vvp05163  Human cytomegalovirus infection
vvp05165  Human papillomavirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    112909041 (TSC2)
   04151 PI3K-Akt signaling pathway
    112909041 (TSC2)
   04152 AMPK signaling pathway
    112909041 (TSC2)
   04150 mTOR signaling pathway
    112909041 (TSC2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112909041 (TSC2)
  09143 Cell growth and death
   04115 p53 signaling pathway
    112909041 (TSC2)
   04218 Cellular senescence
    112909041 (TSC2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    112909041 (TSC2)
   04919 Thyroid hormone signaling pathway
    112909041 (TSC2)
  09149 Aging
   04211 Longevity regulating pathway
    112909041 (TSC2)
  09159 Environmental adaptation
   04714 Thermogenesis
    112909041 (TSC2)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    112909041 (TSC2)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112909041 (TSC2)
   05163 Human cytomegalovirus infection
    112909041 (TSC2)
   05165 Human papillomavirus infection
    112909041 (TSC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112909041 (TSC2)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112909041 (TSC2)
SSDB
Motif
Pfam: Tuberin DUF3384 Rap_GAP HEAT Cnd1 Telomere_reg-2
Other DBs
NCBI-GeneID: 112909041
NCBI-ProteinID: XP_025840515
UniProt: A0A3Q7SFT1
LinkDB
Position
Unknown
AA seq 1813 aa
MAKPTSKDSGLKEKFRILLGLGTPRPNPRSAEGKQTEFIITADILRELSVECGINNRIRV
IGQICEVAKTKKFEEHAVEALWKAVADLLQPERPPEARHAVLALLKAIVQGQGDRLGVLR
ALFFRAIKDYPANEDLHERLEVFKALTDNGRHITYLEEELAGFVLQWMDIGLSSEFLLVL
VNLVKFNSCYLDEYIASMVHMICLLCVQTVSSVDIEVSLQVLDAVVCYNCLPAESLPLFI
VTLCRTINVKELCEPCWKLMRNLLGTHLGHSAIYNMCRIMEDRAYMEDAPLLRGAVFFVG
MALWGAHRLYSLKNSPTSVLPSFYEAMTCPNEVVSYEIVLSITRLIKKYRRELQAVTWDI
LLNIMERLLHQLQTLDSPELRTIVHDLLTTVEELCDQNEFHGSQERYFELVERCADQRPE
SSLLNLITYRAQSIHPAKDGWIQNLQLLMERFFRNESRSAVRIKVLDVLSFVLLINRQFY
EEELISSVVISQLSHVPEDKDPQVRKLATQLLVDLAEGCHTHHFNSLLDIVEKVIARSLS
PPPELEERDVAAYSASLEDVKTAVLGLLVILQTKLYALPASHAMRVYETLVSHIQLHYKH
SYTLPIASSIRLQAFDFLLLLRADSLHRLGLPSKDGAVRFSPYCVCDAMEPERGSEKKAS
GPLSPPTGPPGPAPAGPAVRLGSLPYSLLFRVLLQCLKQEVDWKVLKLVLSKLPESLRYK
VLIFTSPCSVDQLSSALCSMLSGPRTLERLRGTPEGFSRTDLHLAVVPVLTALISYHNYL
DKTRQREMVYCLEQGLIYRCASQCVVALAICSVEMPDIIIKALPVLVVKLTHISATASMA
IPLLEFLSTLARLPHLYRNFAAEQYASVFAISLPYTNPSKFNQYIVCLAHHVIAMWFIRC
RLPFRKDFVPYITKGLRSNVLLSFDDTPEKDSFRARSTSLNERPKSLRIARPPKQGLNNS
PPVKEFKESSAAEAFRCRSISVSEHVVRSRIQTSLTSASLGSADENSMAQADDNLKNLHL
ELTETCLDMMARYVFSNFTAVPKRSPVGEFLLAGGRTKTWLVGNKLVTVTTSVGTGTRSL
LGLDSGEQQGGPELSSDPGTHVRQAKEAPAKLESQAGQQVCRGARDRVRSMSGGHGLRVG
ALDTPASHLLGGPTSPGTQAALASKSDRASAGARFPAQEKTSLAAYVPLLTQGWAEILVR
RPTGNTSWLMSLENPLSPFSSDINNMPLQELSNALMAAERFKERRDTALYKSLSVPAAGS
AKPPPPPRSNTVASFSSLYQSSCQGKLHRSISWADSAVVLEEGNSSETSLPVEPTELEDF
EATLGTDRRYGRTEAYSRSSSSSSQEEKFPAEELAAGGIPIERAVSSEGARPSVELSFQP
SQPLSKSSSSPELQTLQDILGDPGDKSDVGRLSPEAKARSQSGILDGAGASWSTPGEENQ
GQGPAQPEGPLPSSCPRSPSGLRPRGYTISDSAPSRRGKRVEQDAFRSRAGASNTEKVPG
INPSFVFLQLYHSPFFGDESNKPILLPNESFERSVQLLDQIPSYDTHKIAVLYVGEGQSS
SELAILSNEHGSYRYTEFLTGLGKLIELKDCQPDKVYLGGLDVCGEDGQFTYCWHDDIMQ
AVFHIATLMPTKDVDKHRCDKKRHLGNDFVSIVYNDSGEDFKLGTIRGQFNFVHVIITPL
DYECNLVSLQCRKDMEGLVDTSVAKIVSDRNLPFVARQMALHANMASQVHHSRSNPTDIY
PSKWIARLRHIKRLRHRIREEAHYTNPSLPLMQMHPLGHPKAPAQAPAEPLPTYETGQRK
RLISSVDDFTEFV
NT seq 5442 nt   +upstreamnt  +downstreamnt
atggccaagcctacgagcaaagactcaggcctgaaggagaagttcaggattctgttggga
ctgggaacaccgaggccaaaccccaggtcagcagagggcaagcagaccgagttcatcatc
acggcggacatcctgagagagctgagtgttgaatgcggcatcaacaatcgcatccgggtg
atagggcagatctgcgaagttgcaaaaacgaagaaatttgaagagcatgcagtagaagca
ctctggaaggccgttgcggacctgctgcagccggagcggccccccgaggcccggcatgcg
gtgctggcgctgctgaaggccatcgtgcaggggcagggggaccgcctgggcgttctccgg
gctctgttctttagggccatcaaggattaccccgctaatgaagacctccatgaaagactg
gaagttttcaaggccctcacggacaatgggagacacatcacctacttggaagaagaactg
gctgggtttgtcctgcagtggatggacatcggcctgtcctccgaattcctcctggtgctt
gtgaacttggtcaagttcaacagctgttacctggatgagtacattgcatcaatggtccac
atgatctgcctgctgtgcgtccagactgtgtcatccgtggacatagaggtctccctgcag
gtgctggacgccgttgtctgctacaactgcctgccggccgagagcctccccctgttcatt
gtcactctgtgccgcaccatcaatgtgaaggagctctgtgagccttgctggaagctgatg
cggaacctgctgggcacccacctgggccacagtgccatctacaacatgtgtcgcatcatg
gaggacagagcctacatggaagatgccccactgctgagaggggctgtgttctttgtgggg
atggccctttggggagcacaccgactctactctctcaagaactccccaacgtctgtgttg
ccgtcattttatgaggccatgacctgtccgaatgaggtggtgtcctatgaaatcgtcctc
tctataaccagactcatcaagaagtaccggagggagctgcaagctgtgacctgggacatc
ttactgaacatcatggagcgcctcctgcaccagctccagaccctggacagcccggagctc
agaaccatcgtgcacgacctgctgaccacagtggaagagctgtgtgatcagaatgagttc
cacggctctcaggagagatactttgagctggttgagcgatgtgcagaccagaggccggag
tcttccctcttaaacttaataacgtaccgggctcagtcgatccacccggcgaaggacggc
tggattcagaacctgcagttactgatggagaggttcttcaggaatgaatctcgcagtgct
gtgcgcatcaaggtgctggacgtcctgtccttcgtgctgctcatcaacaggcagttctat
gaggaggagctaatcagctcagtggtcatctcacagctctcccacgtcccggaggacaaa
gacccccaagtccggaaactggccacccagttgctggtggacctggctgaaggctgccac
acccaccacttcaacagtctgttggacattgtggaaaaggtgattgcccgctctctctct
ccaccccctgagctggaggaaagagacgtggcggcgtactcggcctccttagaggacgtg
aagactgccgtcctggggctcctggtcatccttcagaccaagctgtacgccttgcctgcc
agccatgcgatgcgtgtgtatgagacgctcgtcagccacatccagctccactacaagcat
agctacaccctgcccatcgccagtagcatccggctgcaggcttttgacttcctactgctg
ctgagggccgactcgctgcaccgccttggcctgcccagcaaggacggggccgtgaggttc
agcccttactgcgtctgcgatgccatggagccagagagaggctcggagaagaaggccagt
ggtcccctgtcacctcccacggggccgcctggtcctgcgcccgcaggccctgccgtgcgg
cttggctccctgccctactccctgctcttccgtgtcctgctacagtgcctgaagcaggag
gtggactggaaggtactgaagctcgtgcttagcaagctgccggagtccctgcgctataag
gtgctcatcttcacctcaccctgcagtgtggaccagctgtcctccgccctctgctccatg
ctctcaggtcccagaactctggagcggctccgaggcaccccggaagggttctccagaacc
gacctgcacctggctgtggtccctgtgctgacggcgctcatctcttaccataactacctg
gacaaaaccagacagcgggagatggtgtactgcctggagcaaggcctgatctaccgctgt
gccagccagtgtgtggtggccctggccatctgcagcgtggagatgcctgacatcatcatc
aaggcgcttcccgtcctggtcgtgaagctcacacacatctcggccacggccagtatggcc
attcctctcctcgagttcctgtcaacgctggccaggctgccccacctgtacaggaacttc
gcagcagagcagtacgcgagcgtgtttgccatctccctgccctacaccaatccctccaag
ttcaatcagtacatcgtgtgcctggcccatcacgtcatagccatgtggttcattagatgc
cgcctgcccttccggaaggattttgttccttatatcactaagggcctgcgctccaacgtt
ctcctgtcttttgatgacacccccgagaaggacagtttcagagcacgaagcaccagtctc
aacgagaggcccaagagtttgaggatagccagaccccccaaacaaggcttgaataactct
ccacccgtgaaagaattcaaagagagctctgccgccgaggccttccgatgccgcagcatc
agtgtgtctgaacatgtggtccgcagcaggatccagacgtccctcacaagcgccagcttg
gggtctgccgacgagaactcgatggcccaggctgatgacaacttgaaaaatctccacctg
gagctcacggaaacatgtctggacatgatggccagatacgtgttctccaacttcacagcg
gtgcccaagaggtctccggtgggagagttcctcctggctggtggcaggaccaaaacctgg
ctggttgggaacaagcttgttactgtgacgacgagcgtggggacggggacccggtcgctg
ctgggcttggactcaggagagcagcaaggtggccccgagttgagctcggaccctggcacg
catgtgagacaggcaaaggaggcacctgccaagctggagtcacaggctgggcagcaggtg
tgccgcggcgcccgggaccgggtccgctccatgtccgggggccacggtcttcgtgttggt
gccctggacactccagcctcccacttgctgggcggccccacttccccaggcacgcaggca
gcgctggccagcaagtctgacagggcctcggctggtgcccggttcccagcacaggagaag
acgagcctggcagcctacgtaccgctgctgacccagggctgggcggagatcttggtccgg
aggcctacagggaacaccagctggctgatgagcctggagaacccgctcagccccttctcg
tcggacatcaacaacatgcctctgcaggagctgtccaatgcgctcatggccgctgagcgc
ttcaaggagcgtcgtgacacggctctgtacaagtccctgtcggtgcctgccgcaggctcg
gccaagccccctccgcccccgagatctaacacggtggcctctttctcctccctgtaccag
tccagttgccaaggaaagctgcacaggagcatttcctgggcagactctgcggtggttctg
gaggagggaaattcaagcgagaccagtctgccagtggagcccacggagctggaggacttc
gaggcgacactaggcacagaccggcgctatggccgcacggaagcttacagcaggtcgtct
tcaagctccagccaggaggagaagttccctgcagaggagctggctgctggagggatcccc
atcgaacgagccgtctcttctgagggcgcccggccttctgtggagctctccttccagccc
tcccagcccctcagcaagtccagctcctcccctgagctgcagaccctgcaggatatactc
ggggaccccggggacaagtctgatgttggccggctcagccctgaggccaaggcccggtca
cagtccgggattctggacggggcgggtgcctcctggtccaccccaggtgaagagaaccag
ggccagggccccgcacagcccgagggtcccttgccttccagctgcccccgctcccccagt
ggcctgcggcccagaggctacaccatctctgattcagccccatcacgcagaggcaaaagg
gtagagcaggacgccttcaggagcagagctggggcttccaacaccgagaaagtgccaggc
atcaatcccagctttgtgttcctgcagctctaccactcacccttctttggtgacgagtcc
aacaagcccattcttctacccaatgagtccttcgagcggtcagtgcagcttctcgaccag
attccatcatacgacacacacaagatcgccgtcctgtatgtgggagaaggccagagcagc
agtgagctcgccatcctgtccaacgagcatggctcatacaggtacacggagttcctgaca
ggcctgggcaagctcatcgagctcaaagactgccagccggacaaggtgtacctggggggc
ctggacgtgtgtggcgaagatggccagttcacctactgctggcatgacgacatcatgcaa
gctgtcttccacattgccaccctgatgcccaccaaggatgtggacaagcaccgctgtgac
aagaagcgccacctgggcaatgactttgtgtccatcgtctacaacgactctggtgaggac
ttcaagctgggcaccatccgaggccagttcaacttcgtccacgtgatcatcacccccctg
gactatgagtgcaacctggtgtccctgcagtgcaggaaagacatggaaggtcttgtggat
accagcgtggccaagatcgtgtctgaccgcaacctgccttttgtggcacgtcagatggct
ttgcacgcaaatatggcctcacaagtgcatcatagccgctccaaccccaccgacatctat
ccctccaagtggattgccaggcttcgccacatcaagcgactccgccaccggatccgcgag
gaagcccactacaccaaccccagcctgccactgatgcagatgcaccccttgggccacccc
aaagcccctgctcaggcgccggcagagcctctgcccacgtatgagacaggccagcggaag
cgtctcatctcctctgtggatgacttcacggagtttgtgtga

DBGET integrated database retrieval system