KEGG   Vulpes vulpes (red fox): 112909128
Entry
112909128         CDS       T05911                                 

Gene name
AXIN1
Definition
(RefSeq) axin-1 isoform X1
  KO
K02157  axin 1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05210  Colorectal cancer
vvp05213  Endometrial cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112909128 (AXIN1)
   04390 Hippo signaling pathway
    112909128 (AXIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112909128 (AXIN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112909128 (AXIN1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112909128 (AXIN1)
   05225 Hepatocellular carcinoma
    112909128 (AXIN1)
   05226 Gastric cancer
    112909128 (AXIN1)
   05217 Basal cell carcinoma
    112909128 (AXIN1)
   05213 Endometrial cancer
    112909128 (AXIN1)
   05224 Breast cancer
    112909128 (AXIN1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112909128 (AXIN1)
   05022 Pathways of neurodegeneration - multiple diseases
    112909128 (AXIN1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112909128 (AXIN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112909128 (AXIN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112909128 (AXIN1)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112909128 (AXIN1)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind Rootletin Sec16
Other DBs
NCBI-GeneID: 112909128
NCBI-ProteinID: XP_025840734
UniProt: A0A3Q7R375
LinkDB
Position
Unknown
AA seq 867 aa
MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPVSHSFCSGKGAGVKGETSAAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGINLFRTFLKQEDCADLLDFWFA
CSGFRKLEPCDSNEEKRLKLAKAIYRKYILDNNGIVSRQTKPATKSFIKDCIVKQLIDPA
MFDQAQTEIQSTMEENTYPSFLKSDIYLEYTRTGSESPKLCSDQSSGSGTGKGIPGYLPT
LNEDEEWKCDQEQDEDGGRDPAPPGRLTQKLLLETAAPRTSSSRRYSEGREFRCGSWREP
VHPYYVSSGYALAPATSANDSEQQSLSSDADSLSLTDSSVDGIPPYRIRKQHRREMQESV
QVNGRVPLPHIPRTYRMPKEIRVEPQKFAAELIHRLEAIQRTREAEEKLEERLKRVRMEE
EGEDGDVPSGPLGAIHKLPLTPAWHHFPPRYADVGCVGLRDAHEENPESILDEHVQRVMR
TPGCQSPGPGHRSPDNAHVPKIVGVLGGVPSGHGKHAPKSGAKLDTAGLHLHRHSHHHSY
HGAARPKEQADAEAARRVQGSFAWGLELHGHTAKPRSHSESVGAAPNASDSLAYSGKAGT
ASRRNAKKAESGKNAGTEVPGPSEDTDKNQKIMQWIIEGEKEISRHRKAGHGSSGAKKQQ
VHESSRPLSVERPGAVHPWVSAQLRNSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRLE
EEEKRASKLPSKQRYVQEVIQRGRSCVRPACTPVLSVVPAVSDLELSETETKSQRKAGSG
SAQPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGNYRYYFKKVSDEFDCGV
VFEEVREDEAVLPVFEEKIIGKVEKVD
NT seq 2604 nt   +upstreamnt  +downstreamnt
atgaatatccaagagcagggtttccctttggacctcggagcaagtttcactgaagatgcc
ccgcgccccccagtgcctggtgaggagggtgaactggtgtccacagaccccaggcccgtc
agccacagcttctgctccgggaaaggtgccggggtcaaaggtgagacttcagcagccact
ccgaggcgctccgacctggacctggggtacgagcctgagggcagcgcctcccccacccca
ccatacttgaagtgggccgagtcgctgcactccctgctggatgatcaggacgggataaac
ctgtttaggactttcttgaagcaggaggactgtgctgacctgctggacttctggtttgcc
tgcagcggcttcaggaagctggagccctgtgactcgaacgaggagaagaggctgaagctg
gccaaggccatctaccgcaagtacatcctcgataacaacggcatcgtgtcccgccagacc
aagccggccaccaagagcttcataaaggactgcatcgtcaagcagctcatcgatccggcc
atgtttgaccaggcgcagacggagatccagtccaccatggaggagaacacctacccctct
ttcctcaagtctgatatttatttggaatacacgaggacaggctcggagagcccgaagctc
tgtagcgaccagagctctgggtcagggacggggaagggcatacccggctacctgcccact
ctgaacgaagatgaggaatggaagtgtgaccaagagcaggatgaagacggtggcagagac
cctgctccccccggcaggctcacacagaagctgcttctggagacggccgccccgcggacc
tcctcaagtagacggtacagcgaaggcagagaattcaggtgtgggtcctggcgggagcct
gtgcatccctactacgtcagctccggctacgccctcgccccggccaccagcgccaatgac
agcgagcagcagagcctgtccagtgatgccgacagcctgtccctcaccgacagcagcgtg
gatggaatcccaccgtacaggatccgcaagcagcaccgccgggagatgcaggagagtgtc
caggtcaacgggcgggtgcctctacctcacattcctcgcacttaccgaatgccaaaggaa
atccgtgtggagccccagaagttcgccgcggagctcatccaccgcctggaggccatccag
cggacgcgggaggccgaggagaagctggaggagcggctgaaacgtgtccggatggaggaa
gaaggagaggatggtgatgtgccctcaggccccctgggggccattcataagctgcctttg
acccccgcctggcaccactttcccccccgctatgcagacgtgggctgcgtgggactgcgg
gacgcgcacgaggagaaccccgagagcatcctggatgagcacgtgcagcgggtcatgagg
acgcctggctgtcagtcaccagggcctggccatcgttcccctgacaatgcccacgtgccc
aagatcgtgggggtgctggggggtgtgccctctgggcacggtaagcatgcacccaagtca
ggggcgaagctggacacagctggcctgcaccttcacaggcacagccaccaccacagttac
catggtgccgccaggcccaaggagcaggccgacgcggaggctgcccgccgggtccagggc
agctttgcatggggcctggagctgcacggccacacagccaagccccgtagccactcggag
agcgtgggtgccgcccccaatgccagcgacagcctggcctacagcgggaaggccggcact
gcctccaggaggaatgccaagaaggccgagtcggggaagaacgctggcactgaggtgccc
ggcccgtcagaggacacagacaagaaccagaagatcatgcagtggatcatcgagggggag
aaggagatcagcaggcaccgcaaggccggccatgggtcctctggtgccaagaagcagcag
gtgcatgagagctccaggcccctgtctgtcgagcgtcccggggctgtgcatccctgggtc
agcgctcagctccggaactccgtccagccgtctcacctattcattcaagaccccaccatg
ccacccaacccggcccccaaccctctgacccagctggaggaggcccgcaggcgtctggag
gaggaagagaagagagccagcaagttaccttccaagcagaggtatgtacaggaggtcatc
cagcgggggcgctcctgcgtcaggccagcgtgcacacctgtgctgagcgtggtgccagcc
gtgtcggacttggagctctccgagacagagacaaagtcacagaggaaggcgggcagtggg
agcgcgcagccgtgtgacagcatcgtggtggcctactacttctgtggggagcccatcccc
taccggacactggtgcggggccgcgcagtcaccctgggccagttcaaggagctgctgacc
aagaagggcaactacagatactatttcaagaaagtgagcgacgagtttgactgcggcgtg
gtgttcgaggaggttcgcgaggacgaggcggtgctgcccgtcttcgaggagaagatcatc
ggcaaagtggagaaggtggactga

KEGG   Vulpes vulpes (red fox): 112920730
Entry
112920730         CDS       T05911                                 

Gene name
AXIN2
Definition
(RefSeq) axin-2 isoform X1
  KO
K04385  axin 2
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05210  Colorectal cancer
vvp05213  Endometrial cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112920730 (AXIN2)
   04390 Hippo signaling pathway
    112920730 (AXIN2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112920730 (AXIN2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112920730 (AXIN2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112920730 (AXIN2)
   05225 Hepatocellular carcinoma
    112920730 (AXIN2)
   05226 Gastric cancer
    112920730 (AXIN2)
   05217 Basal cell carcinoma
    112920730 (AXIN2)
   05213 Endometrial cancer
    112920730 (AXIN2)
   05224 Breast cancer
    112920730 (AXIN2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112920730 (AXIN2)
   05022 Pathways of neurodegeneration - multiple diseases
    112920730 (AXIN2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112920730 (AXIN2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112920730 (AXIN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:vvp03036]
    112920730 (AXIN2)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    112920730 (AXIN2)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind DUF4827 SdrD_B
Other DBs
NCBI-GeneID: 112920730
NCBI-ProteinID: XP_025855414
UniProt: A0A3Q7S7N4
LinkDB
Position
Unknown
AA seq 842 aa
MSSAVLVTRLPDPSSSFHEDAPRPPVPGEEGETPPCQPGLGKGQVTKPMPVSSNARRNED
GLGEPEGRASPDSPLTRWTKSLHSLLGDQDGAYLFRTFLERDKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSIVSKQLKPATKTYIRDGIKKQQIDSIMFDQAQTEIQS
VMEENAYQMFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVVCGYLPTLNEEEEWACADFK
CKLSPTVVGLSSKTLRATANVRSTETVENGYRSFKRSDPVNPYHVGSGYVFAPATSANDS
EISSDALTDDSMSMTDSSVDGIPPYRVGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPATFAAELISRLEKLKLELESRHSLEERLQQIREDEEKEASELALSSRDGGPTP
HPLSLLPSGSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHQQYHPLL
PPGGKLPPVAASQAGCPLLGAKGFVTKQTTKHVHHHYIHHHALPKTKEEIEAEAAQRVRC
FCPGGTEYYCYSKCRSHPKALEPVQAEQFGSSRGSTLPKRNGKSVEPGLALPAREGGAPG
GAGVLQLPGEEGDRSQDVWQWMLESERQSKPKPPSAQSTKKAYPLESARASPAERAGRHH
LLGGSNGHPRAAPRAHPFTQDPAMPPLTPPNTLAQLEEACRRLAEVSKPPKQRCCAASQQ
RDRNHSATGQTGATPFSNPGLASEDHKEPKKLAGVHALQASELVVTYFFCGEEIPYRRML
KAQSLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWDDEAVLPMYEGRILGKVER
ID
NT seq 2529 nt   +upstreamnt  +downstreamnt
atgagcagtgctgtgttggtgactcgcctcccagaccccagcagcagcttccacgaggat
gccccccgacccccggttccgggggaggaaggggagaccccgccgtgccagcccgggcta
ggaaagggccaggtcaccaaacccatgcccgtgtcctccaacgccaggcgcaatgaggat
gggttgggggagcccgaggggcgggcgtccccggactcccctctgacccggtggaccaag
tccttgcactccttgttgggcgatcaagatggtgcttatctcttccgcactttcctggag
agggacaaatgcgtggataccttagacttctggtttgcctgcaacggattcaggcagatg
aacctgaaggataccaaaactttacgagtagccaaagcgatctacaaaaggtacattgag
aacaacagcattgtctccaagcagctgaagcctgccaccaaaacctacataagagatggc
atcaagaagcagcagattgattccatcatgtttgaccaggcacagactgagatccagtcg
gtgatggaagaaaatgcctaccagatgtttttgacttctgatatatacctcgaatatgtg
aggagtgggggagaaaacacagcttacatgagtaacgggggactgggcagcctcaaggtc
gtgtgtggctatctccccaccttgaatgaggaagaggagtgggcttgtgcggactttaag
tgcaaactgtcacccaccgtggttggcctgtccagcaaaaccctgagggcgacggcgaac
gtgaggtccacggagactgtcgaaaatggatacaggtccttcaagaggagcgatcccgtt
aatccataccacgtaggttctggctatgtcttcgcgccagctaccagcgccaatgatagt
gagatctccagcgatgcgctgacggatgactccatgtccatgacggacagcagcgtagat
ggaatccctccttaccgtgtggggagtaagaaacagctccagagagaaatgcatcgcagt
gtgaaggccaatggccaagtgtctctacctcatttcccgagaacgcaccgcctgcccaag
gagatgacccccgtggagcccgccaccttcgcggccgagctcatctccaggctggagaag
ctgaagctggagctggagagccgccacagcctggaggagcgcctgcagcagatccgagag
gatgaagagaaggaggcctccgagctagcgctgagctccagggatggggggcccaccccg
caccccctctccctcctgccctccggcagctatgaggaggacccgcagaccattctggac
gaccacctgtccagggtcctcaagaccccgggctgccagtcgccgggtgtgggccgctac
agcccccgctcccgttcccccgaccaccaccaccaccaccagcagtaccaccccctgctc
ccgcccgggggcaagttgccccccgtggcagcctcgcaggccggttgccccctccttgga
gccaagggcttcgtgaccaagcagacgacgaagcatgtccaccaccactacatccaccac
cacgccctccccaagaccaaggaggagatcgaggcagaggcggcacagagggtgcgctgc
ttctgccccgggggcaccgagtattactgctattcaaagtgtaggagccaccccaaggct
ctggagcccgtgcaggcggagcaattcggcagcagcagaggcagtaccctgcccaaacga
aatgggaaaagcgtggagccgggcctggccctgcccgccagggaaggaggggccccaggc
ggagctggggtcctgcaacttcccggggaggaaggagacaggtcgcaggatgtctggcag
tggatgctggagagtgagcggcagagcaagcccaagccccctagtgcccaaagcacaaag
aaggcttaccccttggagtcggcccgtgcgtccccagccgagcgagctggccggcaccac
ctgctggggggtagcaacgggcacccccgtgccgccccccgagcccacccgttcacccag
gaccccgccatgcctcccctgaccccgcccaacacgctggcacagctggaggaggcctgc
cgccggctggccgaggtgtccaagcccccaaagcagcggtgctgtgcagccagtcagcag
agggacaggaaccactcggccactggtcagacaggagccacgcccttctccaacccaggc
ctggcttcagaagatcacaaagagccaaagaagctggcgggggtccacgcgctccaggcc
agcgagttggtcgtcacatactttttctgtggagaagaaattccatacaggaggatgctg
aaggctcagagcttgaccctgggccactttaaagagcagctcagcaaaaagggaaattat
aggtattacttcaagaaagcaagcgacgagtttgcctgcggagcggtgtttgaggagatc
tgggacgatgaggcggtgctccccatgtacgaaggcaggattctggggaaggtggagagg
atcgactga

DBGET integrated database retrieval system