KEGG   Vulpes vulpes (red fox): 112909226
Entry
112909226         CDS       T05911                                 

Gene name
ADGRB1
Definition
(RefSeq) adhesion G protein-coupled receptor B1
  KO
K04596  adhesion G protein-coupled receptor B1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112909226 (ADGRB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:vvp01002]
    112909226 (ADGRB1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvp04131]
    112909226 (ADGRB1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:vvp04030]
    112909226 (ADGRB1)
Peptidases and inhibitors [BR:vvp01002]
 Mixed peptidases
  Family P2
   112909226 (ADGRB1)
Membrane trafficking [BR:vvp04131]
 Endocytosis
  Phagocytosis
   Others
    112909226 (ADGRB1)
G protein-coupled receptors [BR:vvp04030]
 Adhesion receptor family
  Brain-specific angiogenesis inhibitor (BAI)
   112909226 (ADGRB1)
SSDB
Motif
Pfam: AGRB_N 7tm_2 TSP_1 GAIN TSP1_spondin TSP1_ADAMTS HRM TSP1_CCN
Other DBs
NCBI-GeneID: 112909226
NCBI-ProteinID: XP_025840850
UniProt: A0A3Q7SGL5
LinkDB
Position
Unknown
AA seq 2318 aa
MALTSLLLAKVTLEQPLLRASVTQGQEPRRPAPQSAQSFEGHAEVGAVEGRAREDLSRLG
GPGGLHVRGYTWDGVEGGRSARRLTVALVLSPPGVAGSLGVTASRPGPLPCELARHSLAL
ALRPPRRLREAWQQVQAEAGRKGAGAGRGEEVPAAKAVGPYEADGERAGDRLPQELPAWA
AGAPGAEAQVKFGDTLPSLCSKTSGDIPSLGLAMGKRGRPVRDLPRPRGQEGAAASRPPQ
PGVLRAQGRLRPTPCSADSPCGEDAGQLGPGSRKQRVPVGRRPAWARWTHRRVADRWTEQ
VPRSDARARAPPKPRMGTAAGGRRPASGPCTLGATAALEVEALPSSCPRSEPLPPAPAPR
PALPSPDPADAGPGAEQCATLVQGKFFGYFSAAAVFPANASRCSWTLRNPDPRRYTLYMK
VAKAPAPCGGPGRVRTYQFDSFLESTRTYLGVESFDEVLQLCDPSAPLAFLQASKQFLQM
LRQQPPPDRGPRLPGGSPGPSDDFSVEYLVVGNRNPSRAACQMLCRWLDACLAGSRSSHP
CGIMQTPCACLGGDTGDPASGSLAPRGDVCLRDGVAGGPENCLTSLTQDRGGDGAAASTS
LRLPCGGWAGAARKDWRDVPPDPSPARLQGLQPPRALRVRVTSWDGLRGRHQWGLEPRLG
LVGSPGRRPSPGGGLVEAVTGRWLLLVGGSRFHNFKSSCNETVILRVVYSPTNLPGKSSG
SQEPEEGSGVSGGQAWEAGALLSSGAAWPGSAAWPHSGRGLRDTGPRALLRNSGEVLQAA
AWTLTRARPAAAGRTSSRSQSLRSTDARRREEPGDELQHFGFPSPQTGDPAAEEWSPWSV
CSSTCGEGWQTRTRFCVSSSYSTQCSGPLREQRLCNNSAVCPVHGAWDEWSPWSLCSSTC
GRGFRDRTRTCRPPQFGGNPCEGPEKQTKFCNIALCPGRAVDGNWNEWSSWSTCSASCSQ
GRQQRTRECNGPSYGGAECQGHWVETRDCFLQQCPVDGKWQAWASWGGCSVTCGGGTQRR
ERVCSGPFFGGAACQGPQDEYRQCSAQRCPEPHEICDEDNFGTVVWKETPAGEVAAVRCP
RNATGLILRRCELDEEGIAYWEPPTYIRCVSIDYRNIQMMTREHLAKAQRGLPGEGVSEV
IQTLVEISQDGTSYSGDLLSTIDVLRNMTEIFRRAYYSPTPGDAQNFVQIISNLLAEENR
DKWEEAQLMGPNAKELFRLVEDFVGVIGFRMKDLRDAYQVTDNLVLSIHKLPASGATDIS
FPMKGWRATGDWAKVPEDRVTVSKSVFSTGLAEADDSSVFVVGTVLYRNLGSFLALQRNT
TVLNSKVISVTVKPPPRSLLTPLEIEFAHVYNGTTNQTCILWDESDVPSAPPPPRERGIR
ARLSPEYIPSPRGPEAQKGIVAQETGARGPAAAWFRGGLRVRVRVWVRVRVRVLTCGPAM
CAHPGRPPWTPGGGAAAETGPGRALRVARDPQHRRSELTVGGGGVTSPQLSHVCEGAKPE
PLSRSRDRTREVSQHHTQHSTRWPREARSVPLPGVAAHAASSSPEAAGWGGGCRTGPRSP
HGPGVPHAEEPRSVLHKYLLATCHTQHRVPARPAHCGRGPRGPGALSVERVAGAEAGPGS
PLFRSRLLFRGTQPGAVWGTDPPQPGTRTPHWAQPRPGARDAGARVGVLGVERGGSGPHG
VSWGPHPGPWSAPARPLTPRSPPWTPQNMEKVIVPSVTLIVGCGVSSLTLLMLIIIYVSV
WRYIRSERSVILINFCLSIISSNALILIGQTQTRNKVVCTLVAAFLHFFFLSSFCWVLTE
AWQSYMAVTGRLRNRLIRKRFLCLGWGLPALVVAISVGFTKAKGYSTMNYCWLSLEGGLL
YAFVGPAAAVVLVNMVIGILVFNKLVSKDGITDKKLKERAGASLWSSCVVLPLLALTWMS
AVLAVTDRRSALFQILFAVFDSLEGFVIVMVHCILRREVQDAVKCRVVDRQEEGNGDSGG
SFQNGHAQLMTDFEKDVDLACRSVLNKDIAACRTATITGTLKRPSLPEEEKLKLAHAKAP
PTNFNSLPANVSKLRLHGSPRCPGGPLPDFPNHSLTLKKDRAPKSSFAGDGDIFKKLDSE
LSRAQEKALDTSYVILPTATATLRPKPPEEPKHSIHIDQMPQTRLIHLNMAPDPGLPARR
PPTPPTLEPAPPSLTEPGEPAAHPGPSSGTGTRNENVSTLSVSSLERRKSRYAELDFEKI
MHTRKRHQDMFQDLNRKLQHSEKDKEALGPDSKPEKQQTPNKRPWESLRKAHGTPAWVKK
ELEPLPPSPLELRSVEWEKSGATIPLVGQDIIDLQTEV
NT seq 6957 nt   +upstreamnt  +downstreamnt
atggccctgacctccctcctgcttgccaaggtgactttggagcagccgcttctccgagcc
tccgtgactcagggccaggagccccgccgccccgcgccccagagtgcccagagctttgag
gggcacgcagaggttggggctgtcgagggcagggctcgggaggacctgagccggctgggg
ggcccaggtggcctgcacgtgcgtggctacacctgggacggtgtggagggcgggcgcagt
gcccggcggctgacggtggccctcgtcctgtccccgccaggcgtggccggttccctgggt
gtcacggcctcccgcccggggcctctaccctgtgagctggctcggcactcccttgccctg
gccctgaggccgccccgcaggctgcgggaggcctggcagcaggtgcaggccgaagctggc
cggaagggggcaggggctggacgcggggaggaagtcccggcagccaaggcagtcgggccc
tacgaagctgatggggagagggctggggaccggcttccacaggagctcccggcctgggcc
gcgggggcccccggggctgaggctcaggtgaagtttggggacacgctgccatctctctgc
agcaagacctcaggggacatcccaagtctggggttggctatggggaagcgaggccggcca
gtgagggacttgccgaggccacggggccaggagggggcagccgcgtccaggccgccccag
cccggagtgctcagagcccaaggccgtctgcgcccgacgccctgctctgctgacagcccg
tgcggggaggacgccggccagctgggcccgggcagcaggaagcagcgggtccccgtgggc
aggcggccggcgtgggcaaggtggacacaccggcgggtggcagacaggtggacggagcag
gtgcctaggagcgacgccagggcccgtgcccccccgaagcccaggatgggcactgctgct
ggaggccgcaggccggcgtcgggaccctgcacgttaggagccacagccgccctcgaggtt
gaagcgttgccctcctcctgcccccgctcggagcccctgcccccggctcctgccccccgc
ccggccctgccgtcgccggaccctgcggacgcggggcccggggccgagcagtgcgccacg
ctggtgcagggcaagttcttcggctacttctcggccgccgccgtgttccccgccaacgcc
tcccgctgctcctggaccctgcgcaaccccgacccccggcgctacacgctctacatgaaa
gtggccaaggcgcccgcaccctgtggcggccccggccgcgtccgcacctaccagttcgac
tccttcctggagtccacgcgcacctacctgggcgtggaaagcttcgatgaggtgctgcag
ctctgtgacccctcagcgcccctggccttcctgcaggccagcaagcagttcctgcagatg
ctgcgccagcagccgccccccgaccgaggcccccggctgccaggggggtccccgggcccc
agcgacgacttctccgtggagtacctggtcgtgggcaaccgcaaccccagccgggccgcc
tgccagatgctgtgccgctggctggacgcctgtctggcgggcagccgcagctcgcacccc
tgcggcatcatgcagaccccctgtgcctgcctgggcggggacaccggcgaccctgcctct
ggctccctggccccccgaggggacgtctgcctgagggacggcgtggctggcggccccgag
aactgcctcaccagcctgacccaggaccggggtggggatggcgcagcagcttccacgtca
ctcaggcttccttgtgggggctgggctggggcggccaggaaggactggcgggacgtgccc
cccgacccgtcaccggcccgcctccaaggactccagccccctcgggccctccgggtccgc
gtgacgagctgggacggcctccgcgggcgacaccagtggggcctggagccccggctgggg
cttgtgggcagtcctggcaggcggccctcgcctggaggggggcttgtggaagctgtaacg
gggcgctggctcctccttgtcggcgggagtcgcttccataattttaaatcaagttgtaac
gagactgtcatccttcgggtggtttattcccccacgaaccttcctgggaagagcagcggc
tctcaagaacctgaggagggctctggggtgtcgggaggccaggcttgggaggccggagcg
ctgctgtccagtggggccgcatggcccgggtcggccgcctggccccactctggccgggga
ctgagggacacagggcccagagcgctcctccggaattccggggaggtgctgcaggcggcg
gcctggacgctgacccgagcccgtcccgcagccgccggccgcaccagctcccggagccag
tccctgcggtccacagacgcccggcggcgcgaggagccgggcgatgagctgcagcacttt
gggttcccgtccccgcagacaggtgaccccgcggccgaggagtggtccccgtggagcgtg
tgctccagcacctgtggtgaaggctggcagacccgcacccgcttctgcgtgtcctcgtcc
tacagcacgcagtgcagcgggcccctgcgcgagcagcggctgtgcaataactcggctgtg
tgtccagtgcacggcgcctgggacgagtggtcaccttggagcctctgctccagcacctgc
ggccgtggcttccgagaccgcacgcgcacctgcaggcccccccagtttggaggcaacccc
tgtgagggccccgagaagcaaactaagttttgcaacatcgccctgtgtcctggccgggca
gtggatggaaattggaatgagtggtcaagctggagcacgtgctccgccagctgctcccag
ggccggcagcagcgcacccgggagtgcaacgggccttcctacgggggcgccgaatgccag
ggccactgggtggagactcgagactgcttcctccagcagtgcccagtggatgggaagtgg
caggcctgggcatcgtggggcggctgtagtgtcacgtgcgggggcggcacgcagcgccgg
gaacgtgtgtgctccggtcccttcttcgggggagcagcctgccagggcccgcaggacgag
tatcggcagtgcagtgcccagcggtgtcccgagccccacgagatctgtgatgaggacaac
tttggcacagtggtctggaaggagactccagcaggagaggtggccgcagtccggtgtccc
cgcaatgccacaggcctcatcctgcggcgctgtgagctggacgaggaaggcatcgcctac
tgggagccccccacctacatccgctgtgtctccatcgactatcggaacatccagatgatg
acccgggagcacctggcgaaggctcagcgtgggctgcccggggagggggtctccgaggtc
atccagacgctggtggagatctcccaggatgggaccagctacagtggggacctcctctcc
accatcgatgtcctgaggaacatgactgagatcttccggagggcgtactacagccccacc
cctggggacgcgcagaactttgtgcagatcatcagcaacctgctggcagaagagaaccgg
gacaagtgggaggaggcccagctgatgggtcccaacgccaaggagctcttccggctggtg
gaggacttcgtgggcgtcatcggcttccgcatgaaggacctgcgggacgcgtaccaggtc
acggacaacctggtcctcagcatccataagctcccggccagcggagccacagacatcagc
ttccccatgaagggctggcgggccacgggcgactgggccaaggtgccggaggacagggtc
accgtgtccaagagcgtcttctccacggggctggcagaggcggacgactcgtctgtgttc
gtggtgggcaccgtgctctacaggaacctgggcagcttcctggccctgcagaggaacacg
accgtgctcaactccaaggtcatctccgtgaccgtgaagcccccgccccgctccctgctc
acgcccttggagatcgagtttgcccacgtgtacaacggcaccaccaaccagacctgtatc
ctgtgggacgagtcggatgtgccgtccgcccccccacccccccgagagaggggaatcaga
gcaaggctcagcccggaatacatcccttctccccgggggcctgaagctcagaaggggatt
gtagctcaggaaactggagctaggggcccggccgcagcctggttccgaggaggcctgcgg
gtgcgggtgcgggtgtgggtgcgggtgcgggtgcgggtcctgacctgcgggcctgccatg
tgcgcccacccagggcgccctccctggaccccgggcggcggggcggcggctgagacgggc
ccaggccgggcgctgcgggtggcgcgagacccccagcaccgcaggagtgagctgaccgtg
gggggcggaggagtcacgtctccgcagctgagtcacgtctgtgagggggcgaagcccgag
cctctgagccgcagcagggaccgaacccgggaggtgtcgcagcaccacacgcagcacagc
actcgctggccccgtgaagcacggtcggtgccgctgcccggggtcgccgcgcacgccgcc
tcctcaagcccagaggcagcaggctggggagggggctgcagaaccggccctcggtccccc
cacggccccggggttcctcatgcggaggagccccgctcagtcctccacaaatacctgctg
gccacctgccacacgcagcaccgtgtgccggcgcgccctgcccactgcgggaggggaccc
aggggcccgggggccctcagcgtggagcgcgtggctggtgccgaggccgggccaggaagc
ccgctgttccgctctcggctgctgttccggggcacgcagcctggggctgtctgggggaca
gaccccccccagccagggacgagaacccctcactgggcacagcccagaccaggggcccgg
gacgcaggggcgcgcgtgggggtgctgggggtggagaggggaggctcggggccgcacgga
gtgagctggggcccgcacccggggccttggtccgcacctgcccggcccctcactccgcgc
tctccgccctggacccctcagaacatggagaaggtgatcgtgccgtccgtgacgctcatc
gtgggctgcggcgtgtcgtccctcaccctgctcatgctgatcatcatctacgtctccgtg
tggaggtacatccgctcggagcgctctgtcatcctcatcaacttttgcttgtccatcatc
tcctccaacgccctcatcctcatcgggcagacccagacccgcaataaggtggtgtgcacg
ctggtggctgccttcctgcacttcttcttcctgtcgtctttctgctgggtgctcaccgag
gcctggcagtcctacatggccgtgaccggccgcctcaggaaccgcctcatccgcaagcgc
tttctctgcctgggctgggggctccctgcgctggtcgtggccatttctgtgggattcacc
aaggccaaagggtacagcaccatgaactactgctggctctccctggaggggggactgctg
tacgccttcgtgggaccggccgcggctgtcgtgctggtgaacatggtcatcgggatcctg
gtgttcaacaagctcgtgtccaaagatggcatcacggacaagaagctgaaggagcgggca
ggggcctcgctgtggagctcctgcgtggtgctgccgctgctggcgctcacctggatgtcg
gccgtgctcgccgtcaccgaccgccgctccgccctcttccagatcctgttcgccgtcttc
gactcgctggagggcttcgtcatagtgatggtgcactgcatcctgcgcagagaggtccag
gacgccgtgaagtgccgcgtggtggaccgccaggaggagggcaacggggactcggggggc
tccttccagaacggccatgcccagctcatgacggacttcgagaaggatgtggatctggcc
tgtagatcagtgctgaacaaggacatcgcggcgtgccgcacggccaccatcacgggcacg
ctcaagcggccgtcgctgcccgaggaggagaagctgaagctcgcccacgccaaggcgccc
cccaccaacttcaacagcctgccggccaacgtgtccaagctgcgcctgcacggctcgccc
cgctgcccgggcggccccctgcctgacttccccaaccactcgctgaccctcaagaaggac
agggcacccaagtcctcctttgccggcgacggggacatcttcaagaagctggactcggag
ctgagccgggcccaggagaaggccctggacaccagctacgtaatcctgccgacggccacg
gccacgctgcggcccaagcccccggaggagcccaagcacagcatccacatcgaccagatg
ccccagacccgcctcatccacctcaacatggcacctgacccgggcctgcccgcccgccgc
ccccccaccccccccaccctggagccagcgccccccagcctgacggagcccggggagcct
gctgcccacccagggcccagctcggggaccgggaccaggaacgagaatgtctccaccttg
tccgtgagctccctggagcggcggaaatctcggtacgcggaactggacttcgagaaaatc
atgcacacgcggaagcggcaccaggacatgttccaggacctgaaccgcaagctgcagcac
tcggagaaggacaaggaggcgctaggccccgacagcaagccagaaaagcagcagacgccc
aacaagcggccgtgggagagcctccggaaagcccacgggacgcccgcgtgggtgaagaag
gaactggagccgctgccaccgtccccactggagctgcggagcgtggagtgggagaagtcg
ggcgccacgatcccgctggtgggccaggacatcatcgacctccagactgaggtctga

DBGET integrated database retrieval system