KEGG   Vulpes vulpes (red fox): 112909230
Entry
112909230         CDS       T05911                                 

Gene name
PTK2
Definition
(RefSeq) focal adhesion kinase 1 isoform X1
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01522  Endocrine resistance
vvp04012  ErbB signaling pathway
vvp04062  Chemokine signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04360  Axon guidance
vvp04370  VEGF signaling pathway
vvp04510  Focal adhesion
vvp04670  Leukocyte transendothelial migration
vvp04810  Regulation of actin cytoskeleton
vvp04935  Growth hormone synthesis, secretion and action
vvp05100  Bacterial invasion of epithelial cells
vvp05135  Yersinia infection
vvp05146  Amoebiasis
vvp05163  Human cytomegalovirus infection
vvp05165  Human papillomavirus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05200  Pathways in cancer
vvp05202  Transcriptional misregulation in cancer
vvp05205  Proteoglycans in cancer
vvp05222  Small cell lung cancer
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112909230 (PTK2)
   04370 VEGF signaling pathway
    112909230 (PTK2)
   04151 PI3K-Akt signaling pathway
    112909230 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112909230 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112909230 (PTK2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    112909230 (PTK2)
   04062 Chemokine signaling pathway
    112909230 (PTK2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    112909230 (PTK2)
  09158 Development and regeneration
   04360 Axon guidance
    112909230 (PTK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112909230 (PTK2)
   05202 Transcriptional misregulation in cancer
    112909230 (PTK2)
   05205 Proteoglycans in cancer
    112909230 (PTK2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112909230 (PTK2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112909230 (PTK2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112909230 (PTK2)
   05100 Bacterial invasion of epithelial cells
    112909230 (PTK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112909230 (PTK2)
   05163 Human cytomegalovirus infection
    112909230 (PTK2)
   05165 Human papillomavirus infection
    112909230 (PTK2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112909230 (PTK2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    112909230 (PTK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112909230 (PTK2)
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112909230 (PTK2)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     112909230 (PTK2)
Protein kinases [BR:vvp01001]
 Non-receptor tyrosine kinases
  FAK family
   112909230 (PTK2)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112909230 (PTK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 112909230
NCBI-ProteinID: XP_025840855
UniProt: A0A3Q7SGL9
LinkDB
Position
Unknown
AA seq 1140 aa
MLLELAGREALRPAGAVCMEKSGCSPFPMCWAKEYDRYIASSKIMAAAYLDPNLNHTPNS
STKTHLGAGVERSPGAMERVLKVFHYFENSSEPATWASIIRHGDATDVRGIIQKIVDSHK
VKHVACYGFRLSHLRSEEVHWLHLDMGVSNVREKYELAHPPEEWKYELRIRYLPKGFLNQ
FTEDKPTLNFFYQQVKSDYMSEIADRVDQDIALKLGCLEIRRSYWEMRGNALEKKSNYEV
LEKDVGLKRFFPRSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKE
CFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFNQVQTIQYSNSEDKDRKGML
QLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGATQSFIIRPQKEGERALPSIPKL
ANSEKQGVRTHAVSVSGVSPCQHKVKKARRFLPLVFCSHEPSPTDEISGDETDDYAEIID
EEDTYTMPSKSYGIDEARDYEIQRERIELGRCIGEGQFGDVHQGVYMSPENPALAVAIKT
CKNCTSDSVREKFLQEALTMRQFDHPHIVKLIGVITENPVWIIMELCTLGELRSFLQVRK
YSLDLASLILYAYQLSTALAYLESKRFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDST
YYKASKGKLPIKWMAPESINFRRFTSASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRI
ENGERLPMPPNCPPTLYSLMTKCWAYDPSRRPRFTELKAQLSTILEEEKVQQEERMRMES
RRQVTVSWDSGGSDEAPPKPSRPGYPSPRSSEGFYPSPQHMVQTNHYQVSGYPASHGIPA
MAGSIYPGQASLLDQTDSWNHRPQEISMWQPNVEDSAALDLRGIGQVLPTHLMEERLIRQ
QQEMEEDQRWLEKEERFLKPDVRLSRGSIDREDGSLQGPTGNQHIYQPVGKPDPAAPPKK
PPRPGAPGHLGSLASLSSPGDSYNEGVKPWRLQPQEISPPPTANLDRSNDRVYENVTGLV
KAVIEMSSKIQPAPPEEYVPMVKEVGLALRTLLATVDETLPVLPASTHREIEMAQKLLNS
DLGELINKMKLAQQYVMTSLQQEYKKQMLTAAHALAVDAKNLLDVIDQARLRMLGPTRPH
NT seq 3423 nt   +upstreamnt  +downstreamnt
atgttgctggaactggcgggccgagaggccctgagaccagcaggtgccgtctgtatggag
aagagcggctgtagtccatttccaatgtgttgggctaaagagtatgacagatacatagca
tctagcaaaataatggcagctgcttacctcgacccaaacttgaatcacacaccgaattca
agtaccaagactcacctgggtgccggggtggaacgctccccgggggcaatggagcgagtg
ttgaaggtctttcattattttgaaaacagcagtgagccagctacttgggccagtattatc
aggcacggagacgctactgatgtcaggggcatcattcagaagatagtggacagtcacaaa
gtaaagcacgtggcctgctatggatttcgcctcagtcacctgcggtcagaggaggttcac
tggctccatttggatatgggtgtctccaatgtgagggagaagtatgaacttgcacaccca
ccagaggagtggaaatacgaattgagaattcgttatttgccaaaaggatttctaaaccag
tttactgaagacaagccaactctgaatttcttctatcaacaggtgaagagtgactacatg
tctgagatagctgaccgcgtggaccaggacattgctttgaagctgggctgtctagaaata
cggcggtcatactgggagatgagaggcaacgcgctggagaagaagtctaactatgaagtg
ctggaaaaagatgttggtttgaagcgattttttcctaggagtttactggattctgtcaag
gccaaaacactaagaaagctgatccaacagacatttagacagtttgccaaccttaacaga
gaagaaagtattctgaagttctttgagatcctctccccagtatacagatttgataaagaa
tgtttcaagtgtgctctggggtcaagctggattatttcagtggaactggcaatcggccca
gaagaaggaatcagttacctcacggacaaaggctgcaaccccacacacctggctgacttc
aatcaggtgcagaccattcagtattcgaacagcgaagacaaggacaggaaaggaatgctg
cagttgaagatcgccggcgcccccgagcctctgacagtgacagcgccgtccctaaccatc
gccgagaatatggctgacttgatagatgggtactgccggctggtgaacggggccacgcag
tcttttatcatcagaccccagaaagaaggtgaacgggctttgccatcgataccaaagctg
gccaacagcgagaagcaaggcgtgcggacacacgcggtctccgtgtcaggagtcagtccc
tgccaacataaagttaagaaagctaggcgctttctccctttggtcttctgttcccatgag
ccttctcctacggatgaaattagtggggacgaaacagatgattatgctgagattatagac
gaagaagatacctacaccatgccgtcaaaaagctatggaatagatgaagccagggattat
gagattcagagagaaagaatcgagcttggacgctgcatcggggaaggccagtttggagat
gtccatcaaggcgtctatatgagcccagagaatccagctttggcggttgcaattaaaaca
tgtaaaaactgtacttcggacagcgtgagagagaaattccttcaagaagccttaacaatg
cgtcagtttgaccaccctcacattgtgaagttgattggcgtcatcacggagaaccccgtc
tggataatcatggagctgtgcacgcttggagagctgaggtcatttctgcaagtaaggaag
tacagtttggatctagcatctttgatcctgtatgcctatcagcttagtacagctctcgcg
tatctggagagcaaaagatttgtgcacagggacattgctgctcggaatgttctggtgtcc
tcaaacgattgcgtaaaactaggagactttggattatcccgatatatggaagacagtact
tactacaaagcttccaaaggaaaattgcctattaagtggatggctccagagtccatcaat
tttcgacgttttacctcagctagtgatgtatggatgtttggtgtatgtatgtgggagata
ctgatgcatggtgtgaagccttttcaaggagtgaagaacaatgatgtgatcggtcgaatt
gagaatggggagagattaccaatgcctccaaattgccctcctaccctctacagccttatg
acgaaatgctgggcttatgaccccagcaggcggccccggttcactgagctcaaagctcag
ctcagcacaatcctggaggaggagaaggtgcagcaagaagaacggatgaggatggagtcc
agaagacaggtcacagtatcctgggactccggagggtccgacgaagctccacccaagccc
agcagacccggttaccctagtccaaggtccagcgaaggattttatcccagtccacagcac
atggtacaaaccaatcattaccaggtctctggttatccagcttcacatgggatcccagcc
atggccggcagcatctacccaggtcaggcatctcttttggaccagacggattcatggaat
catagaccacaggagatatcaatgtggcagcccaacgtggaggactctgctgcgctggac
ctgcgagggattgggcaggtattgccgacccacctaatggaagagcggctaatccggcag
cagcaggaaatggaagaagatcagcgctggctggaaaaagaggagagatttctgaaacct
gatgtgcggctctctcgaggcagcattgacagggaggatggaagtctccagggcccgact
ggaaaccaacacatataccagcctgtgggtaaaccagatcctgcagctccgccaaagaaa
ccgccacggcctggagcccctggtcacctgggcagcctcgccagcctcagcagccccggg
gacagttacaacgagggcgtcaagccatggaggcttcagccccaggaaatcagccccccg
cccactgccaacctggaccggtccaacgacagggtgtacgagaatgtgacgggcctggtg
aaggctgtcatcgaaatgtccagcaagatccagccagccccaccggaggagtacgttccc
atggtgaaggaagttggcctggccctgcggacgttactggccactgtggacgagaccctt
ccggtcctgccggccagcacgcaccgagagattgagatggcccagaagctgttgaactcc
gacctgggtgagctcatcaacaagatgaagctggcccagcagtacgtcatgaccagtctc
cagcaggagtacaaaaagcagatgctgaccgctgctcacgccctggccgtggatgccaaa
aacttacttgatgtcattgaccaagcgagactgcggatgctcggaccaacgaggccacac
tga

DBGET integrated database retrieval system