KEGG   Vulpes vulpes (red fox): 112909403Help
Entry
112909403         CDS       T05911                                 

Gene name
EPN1
Definition
(RefSeq) epsin-1 isoform X1
  KO
K12471  epsin
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112909403 (EPN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvp04131]
    112909403 (EPN1)
Membrane trafficking [BR:vvp04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    112909403 (EPN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ENTH ANTH UIM VHS
Motif
Other DBs
NCBI-GeneID: 112909403
NCBI-ProteinID: XP_025841094
UniProt: A0A3Q7SH85
LinkDB All DBs
Position
Unknown
AA seq 569 aa AA seqDB search
MSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMI
WKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQG
VNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAWPQS
SGEEELQLQLALAMSKEEADQPPSCGPEDDVQLQLALSLSREEHDKEERIRRGDDLRLQM
AIEESRRETGGQEESSLMDLADVFTAPAPPPASDPWGGPAPMSAPTSDPWGGAPVPPAAD
PWGGPAPTPASGDPWRPAAPAGPSVDPWGGTQAPAAGEGPTPDPWGSSDGGAPAGGPPAS
DPWAPAPAFSDPWGGSPAKPSTNGTAAVGFDAEPDEFSDFDRLRTALPTSGSSTGELELL
AGEVPPRSPGAFDMSGVGGSLAEAVGSPPPTVAPTPPPPTRKTPESFLGPNAALVDLDSL
VSRPGPTPPGAKASNPFLPSGAPTTGPSVTNPFQPAPPATLTLNQLRLSPVPPVPGAPPT
YISPLGGGPGLPPMMPPGPPAPNTNPFLL
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacctcgtccctgcggcgccagatgaaaaacatagtccacaactactcggaggcc
gagatcaaggtccgagaagccacaagcaacgacccctggggcccatccagctccctaatg
tctgagatcgcggacctcacttacaacgtcgttgctttctctgagatcatgagcatgatc
tggaagcggctcaatgaccatggcaagaactggcggcacgtctacaaggccatgaccctg
atggagtacctcatcaagaccggctcagagcgtgtgtctcagcagtgcaaggagaacatg
tatgctgtgcagacgctgaaggacttccagtatgtggaccgtgatggcaaggaccagggt
gtgaacgtgcgtgagaaggccaaacagctggtagccctgctgcgtgacgaggaccggctg
cgagaggagcgtgcccatgcgctcaagaccaaagagaagctggcacagaccgccactgcc
tcctcagcagcggtgggctccgggcccccacccgaggcagaacaggcgtggccacagagt
agcggggaggaggagctgcagctccagctagccctggccatgagcaaggaggaggctgac
cagcccccgtcctgcggccccgaggacgacgtccagctccagctggcccttagtttgagc
cgagaggagcacgacaaggaagagcggatccgccgcggggatgacctgaggctgcagatg
gctatagaggagagcaggagggagaccggtggccaggaggagtcatccctcatggatctt
gctgatgttttcacggccccggctccaccaccagcctcagacccctggggcggcccagcg
cccatgagtgcccccacctcagacccttggggtggggcccctgtccctccagctgctgat
ccctggggtggtccggcccctacaccagcctctggggacccttggaggcctgctgcccct
gcggggccctcagttgacccttggggtgggacccaggcccctgctgctggagaggggccc
acgcctgacccatgggggagctctgatggtggggccccagctggcggaccccctgcctct
gatccctgggctccagccccggccttctcggacccctggggagggtcacctgccaagccc
agcaccaatggcaccgcagcagtggggtttgatgctgagccagatgagttctctgacttt
gaccgactgcgcacagccctaccgacctctgggagcagcacaggggagctggagctgctc
gctggagaggtgcccccccgcagtcctggggcattcgacatgagtggggtcgggggctct
ctggctgaggctgtggggagccccccacccacagttgctccaacccccccaccgcccaca
cggaagacaccagagtcattcctggggcctaatgcagccctcgttgacctggactcgctg
gtcagccggccaggccccacgccgccaggagccaaggcctccaaccccttcctgccaagc
ggagctccgaccactggcccctccgtcaccaacccctttcagcccgcgccccctgcgacg
ctcaccctgaaccagctccggctcagccctgtgcctccggtccctggagcaccaccgaca
tacatctctccccttggcgggggccccggcctgcccccaatgatgcccccaggcccccca
gcccccaacactaaccccttcctcctataa

DBGET integrated database retrieval system