KEGG   Vulpes vulpes (red fox): 112909902
Entry
112909902         CDS       T05911                                 

Gene name
BCL2L1
Definition
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01524  Platinum drug resistance
vvp04014  Ras signaling pathway
vvp04064  NF-kappa B signaling pathway
vvp04115  p53 signaling pathway
vvp04137  Mitophagy - animal
vvp04140  Autophagy - animal
vvp04151  PI3K-Akt signaling pathway
vvp04210  Apoptosis
vvp04215  Apoptosis - multiple species
vvp04621  NOD-like receptor signaling pathway
vvp04630  JAK-STAT signaling pathway
vvp05012  Parkinson disease
vvp05014  Amyotrophic lateral sclerosis
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05145  Toxoplasmosis
vvp05162  Measles
vvp05166  Human T-cell leukemia virus 1 infection
vvp05168  Herpes simplex virus 1 infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05200  Pathways in cancer
vvp05202  Transcriptional misregulation in cancer
vvp05212  Pancreatic cancer
vvp05220  Chronic myeloid leukemia
vvp05222  Small cell lung cancer
vvp05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    112909902 (BCL2L1)
   04630 JAK-STAT signaling pathway
    112909902 (BCL2L1)
   04064 NF-kappa B signaling pathway
    112909902 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    112909902 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112909902 (BCL2L1)
   04137 Mitophagy - animal
    112909902 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    112909902 (BCL2L1)
   04215 Apoptosis - multiple species
    112909902 (BCL2L1)
   04115 p53 signaling pathway
    112909902 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    112909902 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112909902 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    112909902 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    112909902 (BCL2L1)
   05225 Hepatocellular carcinoma
    112909902 (BCL2L1)
   05220 Chronic myeloid leukemia
    112909902 (BCL2L1)
   05222 Small cell lung cancer
    112909902 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    112909902 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    112909902 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    112909902 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112909902 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    112909902 (BCL2L1)
   05162 Measles
    112909902 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    112909902 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112909902 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112909902 (BCL2L1)
   01524 Platinum drug resistance
    112909902 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112909902 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:vvp03036]
    112909902 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vvp02000]
    112909902 (BCL2L1)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112909902 (BCL2L1)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    112909902 (BCL2L1)
Transporters [BR:vvp02000]
 Other transporters
  Pores ion channels [TC:1]
   112909902 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 112909902
NCBI-ProteinID: XP_025841856
UniProt: A0A3Q7R8S3
LinkDB
Position
Unknown
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcagtttagtgatgtggaagagaacagaactgaggccccagaaggg
actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacttggca
gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg
atccccatggcagcggtgaaacaagcgctgagggaggctggggatgagtttgaactgagg
taccggcgggcattcagtgacctgacatcccagcttcacatcaccccagggacagcatat
cagagctttgagcaggtagtgaacgaactcttccgggatggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcactgtgcgtggagagcgtagacaaggagatgcag
gtattggtgagtcggatcgcagcttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggatacttttgtggaactctacgggaacaatgcagca
gccgagagccggaaaggccaggagcgcttcaaccgctggttcctgacaggcatgactgtg
gctggcgtggttctgctgggctcgctcttcagtcggaaatga

DBGET integrated database retrieval system