KEGG   Vulpes vulpes (red fox): 112910678
Entry
112910678         CDS       T05911                                 

Gene name
FZD2
Definition
(RefSeq) frizzled-2
  KO
K02235  frizzled 2
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112910678 (FZD2)
   04390 Hippo signaling pathway
    112910678 (FZD2)
   04150 mTOR signaling pathway
    112910678 (FZD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112910678 (FZD2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112910678 (FZD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112910678 (FZD2)
   05205 Proteoglycans in cancer
    112910678 (FZD2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112910678 (FZD2)
   05226 Gastric cancer
    112910678 (FZD2)
   05217 Basal cell carcinoma
    112910678 (FZD2)
   05224 Breast cancer
    112910678 (FZD2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112910678 (FZD2)
   05022 Pathways of neurodegeneration - multiple diseases
    112910678 (FZD2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112910678 (FZD2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112910678 (FZD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:vvp04030]
    112910678 (FZD2)
G protein-coupled receptors [BR:vvp04030]
 Frizzled / Smoothened family
  112910678 (FZD2)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 112910678
NCBI-ProteinID: XP_025842709
UniProt: A0A3Q7R9J6
LinkDB
Position
Unknown
AA seq 678 aa
MTLQEELPPLPQSGRENDEATPGTKLTEATLWPHRDQCLASTPATDIEHGVHLLPKTLPA
SRNRAARSWSHLPRTSKFHAEVRAGGRHKEVAGRRREGRGKRRRKKREGKRRAVSPAAQS
DRGEQAGRRAAPXGPAQFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQE
DAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEALMNK
FGFQWPERLRCEHFPRHGAEQICVGQNHSEDGTPALLTTAPPPGLQPGAGGTPGGPGGGG
SPPRYATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFARLW
ILTWSVLCCASTFFTVTTYLVDMQRFRYPERPIIFLSGCYTMVSVAYIAGFVLQERVVCN
ERFSEDGYRTVVQGTKKEGCTILFMMLYFFSMASSIWWVILSLTWFLAAGMKWGHEAIEA
NSQYFHLAAWAVPAVKTITILAMGQIDGDLLSGVCFVGLNSLDPLRGFVLAPLFVYLFIG
TSFLLAGFVSLFRIRTIMKHDGTKTEKLERLMVRIGVFSVLYTVPATIVIACYFYEQAFR
EHWERSWVSQHCKSLAIPCPAHYTPRMSPDFTVYMIKYLMTLIVGITSGFWIWSGKTLHS
WRKFYTRLTNSRHGETTV
NT seq 2037 nt   +upstreamnt  +downstreamnt
atgaccctccaggaggagctgccgcctctgccacaatcaggtagggagaatgatgaggct
acccctggaactaagctcacagaggcaaccctgtggccccacagggatcagtgcctggct
tctactcctgccacagacattgaacacggagtgcacctccttcccaagacgttgcctgcc
agcaggaatagagcagcaagatcgtggtctcatctccctcgaacctccaagttccacgcc
gaggtgagggctggaggaaggcacaaagaagtcgctgggcggagaagggaggggagaggc
aagaggaggaggaagaagagagagggcaagcggcgcgcggtgtctccggcggctcagtcg
gaccgcggcgagcaagccggcaggcgcgccgcccccnccgggccggcccagttccacggg
gagaagggcatctccatcccggaccacggcttctgccagcccatctccatcccgctgtgc
acggacatcgcctacaaccagaccatcatgcccaaccttctgggccacacgaaccaggag
gacgcgggcctggaggtgcaccagttctacccgctggtgaaggtgcagtgctcccccgaa
ctgcgcttcttcttgtgctccatgtacgcacccgtgtgcacggtgctggagcaggccatc
ccgccgtgccgctccatctgcgagcgcgcgcgccagggctgcgaggcgctcatgaacaag
ttcggcttccagtggcccgagcgcctgcgctgcgagcactttccgcgccacggcgcggag
cagatctgcgtgggccagaaccactcggaggacggcacgccggcgctgctcaccaccgcg
cctccgccgggcctgcagccgggggccgggggcaccccgggcggcccgggcggcggcggc
tctcccccgcgctacgccacgctggagcacccgttccactgcccgcgcgtcctcaaggtg
ccgtcctatctcagctacaagttcctgggcgagcgcgactgcgcggcgccctgcgagccc
gcgcggccggacggctccatgttcttctcgcaggaggagacgcgcttcgcgcgcctctgg
atcctcacctggtcggtgctgtgctgcgcctccaccttcttcaccgtcactacgtacctg
gtcgacatgcagcgcttccgctacccggagcgacccatcatctttctgtccggctgctac
actatggtttcggtggcgtacatcgcgggcttcgtgctccaggagcgcgtcgtgtgcaac
gagcgcttctccgaggacggctaccgcacggtggtgcagggcaccaagaaggagggctgc
accatcctctttatgatgctctacttcttcagcatggccagttccatctggtgggtcatc
ctgtcgctcacttggttcctggcggcgggcatgaagtggggccacgaggccatcgaggct
aactcgcagtacttccacctggccgcgtgggccgtgccggcggtcaagaccatcaccatc
ctggccatgggccagattgacggcgacctgctgagcggcgtgtgcttcgtgggcctcaac
agcctggacccgctgcggggcttcgtgctggcgccgctcttcgtgtacctgttcataggc
acgtccttcctcctggccggcttcgtgtcactctttcgcatccgcaccatcatgaagcac
gacggcaccaagacggagaagctggagcggcttatggtgcgcatcggcgtcttctccgtg
ctctacaccgtgcccgccaccatcgtcatcgcctgctacttctacgagcaggcctttcgg
gagcactgggagcgctcgtgggtgagccagcactgcaagagcctggccatcccgtgcccg
gcgcactacacgccgcgcatgtcgcccgacttcaccgtctacatgatcaaatacctcatg
acgctcatcgtgggcatcacgtcgggcttctggatctggtccggcaagacgttgcactcg
tggaggaagttctacacgcgtctcaccaacagccggcacggcgagaccaccgtgtga

KEGG   Vulpes vulpes (red fox): 112916996
Entry
112916996         CDS       T05911                                 

Gene name
FZD6
Definition
(RefSeq) frizzled-6
  KO
K02376  frizzled 6
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112916996 (FZD6)
   04390 Hippo signaling pathway
    112916996 (FZD6)
   04150 mTOR signaling pathway
    112916996 (FZD6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112916996 (FZD6)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112916996 (FZD6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112916996 (FZD6)
   05205 Proteoglycans in cancer
    112916996 (FZD6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112916996 (FZD6)
   05226 Gastric cancer
    112916996 (FZD6)
   05217 Basal cell carcinoma
    112916996 (FZD6)
   05224 Breast cancer
    112916996 (FZD6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112916996 (FZD6)
   05022 Pathways of neurodegeneration - multiple diseases
    112916996 (FZD6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112916996 (FZD6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112916996 (FZD6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:vvp04030]
    112916996 (FZD6)
G protein-coupled receptors [BR:vvp04030]
 Frizzled / Smoothened family
  112916996 (FZD6)
SSDB
Motif
Pfam: Frizzled Fz Folate_rec RseC_MucC Integrin_alpha
Other DBs
NCBI-GeneID: 112916996
NCBI-ProteinID: XP_025850586
UniProt: A0A3Q7RVV0
LinkDB
Position
Unknown
AA seq 712 aa
MEMFTFLWTCVFLPFVRGHSLFTCEPITVPRCMKMAYNMTFFPNLMRHYDQSTAAVKMEP
FLPLANLECSPNIETFLCKAFVPACTDQINVVPPCRKFCEKVYSDCKKLIDTFGMRWPEE
LECDRLQYCDETIPVTFDPHTQFLGTQKNTEQVQRDIGFWCPRHLKTSGGQGYKFLGIDQ
CAPPCPNMYFKSDELEFAKSFIGIVSIFCLCATLFTFLTFLIDVKRFRYPERPIIYYSVC
YSIVSLMYFIGFLLGDRTACNKADEKLELGDTVVLGSQNKACTVLFMFLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGIPGFLTVMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYEQVNRITWEITWVSDHCRQYHIPCPYQAKTETRPELALFMIKY
LMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHK
KKHYKPSSHKLKVISKSMGTSTGATANHGTSAVTITNHDYLGQETLTEIQTSPETSVREV
RADGASTPRSREQDCGEPASPAASSSRLCEEQADRKGRAGNGTDKISISESTRSEGRVTP
KSDVTETGPVQSSNLQVPGSSEPGSLKGSTSLLVHSASGGRKEPGTGSHSDT
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggaaatgtttacgttcttgtggacgtgtgtttttctacccttcgtaagagggcacagt
cttttcacttgtgaaccaatcactgtgccccgatgtatgaaaatggcctacaacatgacg
tttttccctaatttgatgagacattatgaccagagtacagctgctgtgaaaatggagccc
tttcttccccttgcaaatttggaatgttcaccaaacattgaaactttcctttgcaaagct
ttcgtaccagcgtgcacagaccaaattaatgtggttccaccttgtcgtaagttttgtgag
aaagtatattctgattgcaaaaaactaatcgacacttttggtatgcgatggcctgaggaa
cttgaatgtgacagattgcagtactgtgatgagactattcctgtaacttttgatccacac
acacagtttcttggtactcagaagaacacagagcaagtccagagagacattggattttgg
tgtccaaggcatcttaagacttctgggggacaaggctataagtttctggggattgaccag
tgcgcgcctccatgccctaacatgtattttaaaagcgatgagctagagtttgcaaaaagt
tttattggaatagtttcaatattttgtctctgtgcaactctgttcacattccttactttc
ttaattgatgttaaaagattcagatacccagagagaccaattatatattactccgtctgc
tacagcattgtgtccctaatgtactttatcggattcttgttaggcgatcgcacagcctgc
aacaaggcggatgagaagctagaactcggtgacacagtagttctgggttctcagaataag
gcttgcactgttctgtttatgtttttgtattttttcacaatggctggcaccgtgtggtgg
gtgattcttaccattacgtggttcttagctgcaggaagaaaatggagttgtgaagccatt
gaacaaaaagcagtgtggtttcatgctgttgcatggggaataccaggttttctgactgtt
atgcttcttgctatgaacaaagttgaaggagacaacattagtggcgtttgctttgttggc
ctttatgacctggatgcttctcgctactttgtactcttgccactgtgcctttgtgtgttt
gtcgggctgtctcttcttttagctggcattatttccttaaatcatgttcgacaagttata
caacatgacggccggaaccaagagaaactaaagaaatttatgattcgaattggagtcttt
agtggcctgtatcttgtgccactggtgacacttctgggatgttacgtctatgagcaggtg
aataggatcacctgggagataacttgggtctctgaccactgtcgtcagtaccatatcccg
tgtccttatcaggctaaaacagaaactcgaccagaattggctttatttatgataaaatat
ctgatgacattaattgttggtatctctgctgtcttctgggttggaagcaaaaagacatgc
acagaatgggctgggttttttaaacgaaatcgtaagagagatccaatcagtgaaagtaga
agagtactacaggagtcatgtgagttcttcttaaagcacaattctaaagttaagcacaaa
aagaagcactacaaaccaagttcgcacaagctgaaggtcatttccaaatccatgggaacc
agcacaggtgctacagccaatcatggcacttctgcagtgacaatcactaaccacgattac
ttaggacaagaaactttgacagaaatacaaacctcccctgaaacatcagtgagagaggtg
agagcagatggagcgagcactcccagatcaagagaacaggactgtggggagccagcctcc
ccagcagcatccagctcccgactctgtgaggaacaggctgacaggaaaggccgggcaggc
aatgggactgataagatcagcatatctgaaagtacacggagtgaaggaagggtaactcca
aaaagtgatgtcactgaaaccggcccagtgcagagcagcaacttgcaggtcccaggctct
tcagagcccggcagcctgaaaggctccacatcactgctcgttcactcagcttcaggaggt
agaaaagagcctggcactggaagtcactctgatacctga

KEGG   Vulpes vulpes (red fox): 112921504
Entry
112921504         CDS       T05911                                 

Gene name
FZD8
Definition
(RefSeq) LOW QUALITY PROTEIN: frizzled-8
  KO
K02375  frizzled 5/8
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112921504 (FZD8)
   04390 Hippo signaling pathway
    112921504 (FZD8)
   04150 mTOR signaling pathway
    112921504 (FZD8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112921504 (FZD8)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112921504 (FZD8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112921504 (FZD8)
   05205 Proteoglycans in cancer
    112921504 (FZD8)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112921504 (FZD8)
   05226 Gastric cancer
    112921504 (FZD8)
   05217 Basal cell carcinoma
    112921504 (FZD8)
   05224 Breast cancer
    112921504 (FZD8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112921504 (FZD8)
   05022 Pathways of neurodegeneration - multiple diseases
    112921504 (FZD8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112921504 (FZD8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112921504 (FZD8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:vvp04030]
    112921504 (FZD8)
G protein-coupled receptors [BR:vvp04030]
 Frizzled / Smoothened family
  112921504 (FZD8)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 112921504
NCBI-ProteinID: XP_025856567
UniProt: A0A3Q7T7P7
LinkDB
Position
Unknown
AA seq 615 aa
MEWGYLLEVTSLLAALALLQRSSGAAAASAKDLACQEITVPLCKGIGYNYTYMPNQFNHD
TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
LMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTARPPGGGPAPCEPGCQCRAPMV
SVSSERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTF
LIDMERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGXGXRGEYEEL
GAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYSQ
YFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLRGFVLAPLVIYLFIGTMF
LLAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTVPAAVVVACLFYEQHNRP
RWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITSGVWVWSGKTLESWRALCTR
CCWASKSAPGGGGAAAGSAGGXXXXXXXXXXXXXXXXXXXXXXXXLYSDVSTGLTWRSGT
ASSVSYPKQMPLSQV
NT seq 1848 nt   +upstreamnt  +downstreamnt
atggagtggggctacctgctggaggtgacctcgctgctggccgccctggcgctgctgcag
cgctcgagcggcgcggcggccgcgtcggccaaggacctggcgtgccaggagatcaccgtg
ccgctgtgcaagggcatcggctacaactacacgtacatgcccaaccagttcaaccacgac
acgcaggacgaggcgggcctggaggtgcaccagttctggccgctggtggagatccagtgc
tcgcccgacctcaagttcttcctgtgcagcatgtacacgcccatctgcctggaggactac
aagaagccgctgcccccgtgccgctcggtgtgcgagcgcgccaaggccggctgcgcgccg
ctcatgcgccagtacggcttcgcctggcccgaccgcatgcgctgcgaccggctgccggag
cagggcaaccccgacacgctgtgcatggactacaaccgcacggacctgaccacggcgcgg
ccccctggcggcggccctgcgccctgcgagccgggctgccagtgccgcgcgcccatggtg
agcgtgtccagcgagcggcacccgctctacaaccgcgtcaagaccggccagatcgccaac
tgcgcgctgccctgccacaaccccttcttcagccaggacgagcgcgccttcacggtcttc
tggatcgggctgtggtccgtgctgtgcttcgtgtccaccttcgccaccgtgtccaccttc
ctcatcgacatggagcgcttcaagtaccctgagcggcccatcatcttcctgtccgcctgc
tacctcttcgtgtccgtcggctacctggtgcgcctggtggcgggccacgagaaggtggcg
tgcagcggcggcgcgccgggcgcgggcggcntcggcangcgcggcgagtacgaggagctg
ggggcggtggagcagcacgtgcgctacgagaccacgggccccgcgctgtgcaccgtggtc
ttcctgctcgtctacttcttcggcatggccagctccatctggtgggtgatcctgtcgctc
acctggttcctggcggcgggcatgaagtggggcaacgaggccatcgccggctactcgcag
tacttccacctggccgcgtggctggtgcccagcgtcaagtccatcgccgtgctggcgctc
agctccgtggacggcgacccggtggccggcatctgctacgtgggcaaccagagcctggac
aacctgcgcggcttcgtgctggcgccgctcgtcatctacctcttcatcggcaccatgttc
ctgctggccggcttcgtgtcgctgttccgcatccgctcggtcatcaagcagcagggcggc
cccaccaagacgcacaagctggagaagctcatgatccgcctgggcctcttcaccgtgctc
tacacggtgcccgccgccgtcgtcgtggcctgcctcttctacgagcagcacaaccgcccg
cgctgggaggccacgcacaactgcccgtgcctgcgggacctgcagccggaccaggcgcgc
cggcccgactacgccgtcttcatgctcaagtacttcatgtgcctggtggtgggcatcacc
tcgggcgtgtgggtctggtcgggcaagacgctggagtcgtggcgtgccctgtgcacccgc
tgctgctgggcgagcaagagcgccccgggaggcgggggcgcggccgcagggagcgcgggg
ggnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnccctctacagcgacgtcagcaccggcctgacgtggcgatcgggcacg
gccagctccgtgtcttatccaaaacagatgccgttgtcccaggtctga

KEGG   Vulpes vulpes (red fox): 112922465
Entry
112922465         CDS       T05911                                 

Gene name
FZD5
Definition
(RefSeq) frizzled-5
  KO
K02375  frizzled 5/8
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112922465 (FZD5)
   04390 Hippo signaling pathway
    112922465 (FZD5)
   04150 mTOR signaling pathway
    112922465 (FZD5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112922465 (FZD5)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112922465 (FZD5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112922465 (FZD5)
   05205 Proteoglycans in cancer
    112922465 (FZD5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112922465 (FZD5)
   05226 Gastric cancer
    112922465 (FZD5)
   05217 Basal cell carcinoma
    112922465 (FZD5)
   05224 Breast cancer
    112922465 (FZD5)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112922465 (FZD5)
   05022 Pathways of neurodegeneration - multiple diseases
    112922465 (FZD5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112922465 (FZD5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112922465 (FZD5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:vvp04030]
    112922465 (FZD5)
G protein-coupled receptors [BR:vvp04030]
 Frizzled / Smoothened family
  112922465 (FZD5)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 112922465
NCBI-ProteinID: XP_025857825
UniProt: A0A3Q7TRI6
LinkDB
Position
Unknown
AA seq 545 aa
ARPDPCAPPSLLLLLLAQLLGRAAAASKAPVCQEITVPMCRGIGYNLTHMPNQFNHDTQD
EAGLEVHQFWPLVEIHCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMR
QYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPRPFPAKPTLPGPAGAPAPGAE
CAAGGPSVCKCREPFVPILKESHPLYNKVRTGQVPNCAVPCYQPSFSPDERTFATFWIGL
WSVLCFISTSTTVATFLIDMERFRYPERPIIFLSACYLCVSLGFLVRLVVGHASVACSRE
HSHIHYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWFLAAGMKWGNEAIAGYAQYFH
LAAWLIPSVKSITALALSSVDGDPVAGICYVGNQNLNSLRGFVLGPLVLYLLVGTLFLLA
GFVSLFRIRSVIKQGGTKTDKLEKLMIRIGIFTLLYTVPASIVVACYLYEQHYRESWEAA
LTCACPGPDAGQPRAKPEYWVLMLKYFMCLVVGITSGVWIWSGKTVESWRRFTSRCCCRA
RRGHK
NT seq 1635 nt   +upstreamnt  +downstreamnt
gctcggcctgacccgtgcgcgccgccctcgctgctgctgctgctcctggcgcagctgttg
ggccgcgcggcggccgcgtccaaggccccggtgtgccaggagatcacggtgcccatgtgc
cgcggcatcggctacaacctgacgcacatgcccaaccagttcaaccacgacacgcaggac
gaggcgggcctggaggtgcaccagttctggccgctggtggagatccactgctcgcccgac
ctgcgcttcttcctctgctccatgtacacgcccatctgcctgcccgactaccacaagccg
ctgccgccctgccgctcggtgtgcgagcgcgccaaggccggctgctcgccgctcatgcgg
cagtacggcttcgcctggcccgagcgcatgagctgcgaccggctgccggtgctgggccgc
gacgccgaggtgctgtgcatggattacaaccgcagcgaggccaccacggcgccccccagg
cccttcccggccaaacccaccctcccgggccccgcgggggcgccggccccgggcgccgag
tgcgccgccgggggcccgtcggtgtgcaagtgccgcgagcccttcgtgcccatcctgaag
gagtcgcacccgctctacaacaaggtgcgcacgggccaggtgcccaactgcgcggtgccc
tgctaccagccctccttcagccccgacgagcgcacgttcgccaccttctggatcggcctg
tggtccgtgctgtgcttcatctccacgtccaccacggtggccaccttcctgatcgacatg
gagcgcttccgctaccccgagcgccccatcatcttcctgtccgcctgctacctgtgcgtg
tcgctgggcttcctggtgcgcctggtggtgggccacgccagcgtcgcctgcagccgcgag
cacagccacatccactacgagacgacgggccccgcgctgtgcaccgtcgtcttcctgctg
gtctacttcttcggcatggccagctccatctggtgggtcatcctgtcgctcacctggttc
ctggcagccggcatgaagtggggcaacgaggccatcgcgggctatgcgcagtacttccac
ctggccgcgtggctcatccccagcgtcaagtccatcacggcgctggccctgagctcggtg
gacggggacccggtggccggcatctgctacgtgggcaaccagaacctcaactcgctgcgc
ggcttcgtgctgggcccgctggtgctctacctgctggtgggcaccctcttcctcctggcg
ggcttcgtgtccctgttccgcatccgcagcgtcatcaagcagggcggcaccaagacggac
aagctggagaagctcatgatccgcatcgggatcttcacgctgctctacaccgtgccggcc
agcatcgtggtggcctgctacctgtacgagcagcactaccgcgagagctgggaggccgcg
ctcacctgcgcgtgcccgggccccgacgccggccagccgcgcgccaagcccgagtactgg
gtgctcatgctcaagtacttcatgtgcctcgtcgtgggcatcacgtcgggcgtctggatt
tggtccggcaagacggtggagtcgtggcggcgcttcaccagccgctgctgctgccgcgcg
cggcggggccacaag

KEGG   Vulpes vulpes (red fox): 112922796
Entry
112922796         CDS       T05911                                 

Gene name
FZD7
Definition
(RefSeq) frizzled-7
  KO
K02432  frizzled 1/7
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112922796 (FZD7)
   04390 Hippo signaling pathway
    112922796 (FZD7)
   04150 mTOR signaling pathway
    112922796 (FZD7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112922796 (FZD7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112922796 (FZD7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112922796 (FZD7)
   05205 Proteoglycans in cancer
    112922796 (FZD7)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112922796 (FZD7)
   05226 Gastric cancer
    112922796 (FZD7)
   05217 Basal cell carcinoma
    112922796 (FZD7)
   05224 Breast cancer
    112922796 (FZD7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112922796 (FZD7)
   05022 Pathways of neurodegeneration - multiple diseases
    112922796 (FZD7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112922796 (FZD7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112922796 (FZD7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:vvp04030]
    112922796 (FZD7)
G protein-coupled receptors [BR:vvp04030]
 Frizzled / Smoothened family
  112922796 (FZD7)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 112922796
NCBI-ProteinID: XP_025858237
UniProt: A0A3Q7TAR8
LinkDB
Position
Unknown
AA seq 711 aa
MTVAATLSLANPEWIDPWNGLAVVLGETVRDGFSLSQTVTFLHGNSRYSLLPGEGRAPPP
PVNSDLSRSNRGAHGSAQCREQDGGFDREQKTASPSENATGAHGGPGAAAARSPLGLCTL
ALALLGALPAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQED
AGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKF
GFQWPERLRCENFPVHGAGEICVGQNTSDGSGGAGGGPTAYPTAPYMPDLPFTALPPGAA
DGRGRAAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGLMYFKEEERRFARLWVG
VWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVAHVAGFLLEDRAVCVER
FSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLTWFLAAGMKWGHEAIEANS
QYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALRGFVLAPLFVYLFIGTS
FLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPATIVLACYFYEQAFREH
WERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIVGITTGFWIWSGKTLQSWR
RFYHRLSHSSKGETAACSHGWCVLQTHRRKTSDSPHQEEEATPLHSVQSIF
NT seq 2136 nt   +upstreamnt  +downstreamnt
atgacagtggctgcaacactgtcattagccaaccctgaatggatagatccctggaatggg
ctggcggtggtccttggagagacagtgagagacggatttagcctttctcaaactgtcact
ttcctgcatgggaattcgcgatactccctgcttcccggagaggggagagcccccccaccc
ccggtgaattctgacctctcccggagtaaccggggagctcacggcagcgcccagtgccgc
gagcaagacggaggatttgaccgggaacaaaagaccgctagcccgtcagaaaacgccact
ggagcacacgggggccccggcgcggccgcggcgcgctcgcccctgggcctgtgcaccctg
gcgcttgcgctgctgggcgcgctgcccgccggcgccggggcgcagccgtaccacggcgag
aagggcatctcggtgccggaccacggcttctgccagcccatctccatcccgctgtgcacg
gacattgcctacaaccagaccatcctgcccaacctgctgggccacacgaaccaggaggac
gcgggcctcgaggtgcaccagttctacccgctggtgaaggtgcagtgttctcccgagctg
cgcttcttcctgtgctccatgtacgcgcccgtgtgcaccgtgctggaccaggccatcccg
ccgtgccgctccctgtgcgagcgtgcccgccagggctgcgaggcgctcatgaacaagttc
ggcttccagtggcccgagcggctgcgctgtgagaacttccccgtgcacggcgccggcgag
atctgcgtgggccagaacacgtccgacggctcggggggcgcgggcggcggccccacggcc
taccccactgcgccctacatgccggacctgcccttcaccgccctgcccccgggggcagct
gacggcaggggccgcgccgccttcccgttctcgtgcccccgccagctcaaggtgcccccc
tacctgggctaccgcttcctgggcgagcgcgactgcggcgccccgtgcgagccgggccga
gccaacggcctgatgtactttaaggaggaggagaggcgcttcgcccgtctctgggtgggc
gtgtggtcggtgctgtgctgcgcctcgacgctcttcaccgtgctcacctacttggtggac
atgcggcgcttcagctaccccgagcggcccatcatctttctgtcgggctgctacttcatg
gtggccgtggcgcacgtggccggcttcctgctggaggaccgcgccgtgtgcgtggagcgc
ttctcagacgacggctaccgcacggtggcgcagggcaccaagaaggagggctgcactatc
ctcttcatggtgctgtacttcttcggcatggccagctccatctggtgggtcatcctgtcg
ctcacctggttcctggcagccggcatgaagtggggccatgaggccatcgaagccaactcg
cagtacttccacctggccgcgtgggctgtgcccgctgtcaagaccatcaccatcctggcc
atgggccaggtggacggggacttgctcagcggggtgtgctacgtgggcctgtccagcgtg
gatgcgctgcggggcttcgtgctggcgcccctgttcgtctacctcttcattggcacgtcc
ttcctgctggccggcttcgtgtccctcttccgtatccgcaccatcatgaagcacgacgga
accaagaccgagaagctggagaagctcatggtgcgcatcggcgtcttcagcgtgctctac
acggtgccagccaccatcgtcctggcctgctacttctacgagcaggccttccgcgaacac
tgggagcgcacctggctcctgcagacgtgcaagagctacgcggtgccctgcccgcctggc
catttcccgcccatgagccccgacttcactgtcttcatgatcaagtacctgatgaccatg
atcgtgggcatcaccaccggcttctggatctggtccggcaagactctgcagtcttggcgc
cgcttctaccacagactcagccacagcagcaagggggagactgcggcttgctcacatggc
tggtgtgttttacaaacacacagaaggaaaaccagtgacagtcctcaccaggaggaggaa
gccacaccgctgcactctgtgcagagcatcttttaa

KEGG   Vulpes vulpes (red fox): 112923874
Entry
112923874         CDS       T05911                                 

Gene name
FZD1
Definition
(RefSeq) frizzled-1
  KO
K02432  frizzled 1/7
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112923874 (FZD1)
   04390 Hippo signaling pathway
    112923874 (FZD1)
   04150 mTOR signaling pathway
    112923874 (FZD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112923874 (FZD1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112923874 (FZD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112923874 (FZD1)
   05205 Proteoglycans in cancer
    112923874 (FZD1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112923874 (FZD1)
   05226 Gastric cancer
    112923874 (FZD1)
   05217 Basal cell carcinoma
    112923874 (FZD1)
   05224 Breast cancer
    112923874 (FZD1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112923874 (FZD1)
   05022 Pathways of neurodegeneration - multiple diseases
    112923874 (FZD1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112923874 (FZD1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112923874 (FZD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:vvp04030]
    112923874 (FZD1)
G protein-coupled receptors [BR:vvp04030]
 Frizzled / Smoothened family
  112923874 (FZD1)
SSDB
Motif
Pfam: Frizzled Fz 7tm_2 Dicty_CAR
Other DBs
NCBI-GeneID: 112923874
NCBI-ProteinID: XP_025859520
UniProt: A0A3Q7TW39
LinkDB
Position
Unknown
AA seq 651 aa
MAEEEAPNKSRAAGGRASWELCAGALRAGPVAEGSGDAGGRRRRRPRADSGRLARRLLLL
LWLLEAPLLPGARGQAVGQGPGQGPGPGQQPPPPPPQQQQSGQQYNGERGISIPDHGYCQ
PISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSAELKFFLCSMYAPVC
TVLEQALPPCRSLCERARQGCEALMNKFGFQWPDTLKCEKFPVHGAGELCVGQNTSDKGT
PTPSLLPEFWTSNPQHGGGGHRGGGFPGGAGASERGKFSCPRALKVPSYLNYHFLGEKDC
GAPCEPTKVYGLMYFGPEELRFSRTWIGIWSVLCCASTLFTVLTYLVDMRRFSYPERPII
FLSGCYTAVAVAYIAGFLLEDRVVCNDKFSEDGARTVAQGTKKEGCTILFMMLYFFSMAS
SIWWVILSLTWFLAAGMKWGHEAIEANSQYFHLAAWAVPAIKTITILALGQVDGDVLSGV
CFVGLNNVDALRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVR
IGVFSVLYTVPATIVIACYFYEQAFRDQWERSWVAQSCKSYAIPCPHLQAGGGAPPHPPM
SPDFTVFMIKYLMTLIVGITSGFWIWSGKTLNSWRKFYTRLTNSKQGETTV
NT seq 1956 nt   +upstreamnt  +downstreamnt
atggctgaagaggaggcgcctaacaagtcccgggccgccggcggccgcgcgagctgggaa
ctttgcgctggggcgctgcgggctggccccgtggcggaggggagcggggacgcgggcggc
cgtcgccgccgccgcccccgagctgactctggacgcctggcgcgccggctgctgctactg
ctctggctgctggaggctccgctgctgccgggggcccgggggcaggcggtgggccagggg
ccgggccaggggcccgggccggggcagcagccgccgccgccgccgcctcagcagcagcag
agcgggcagcagtacaacggcgagaggggcatctccatcccggaccacggctactgccag
cccatctccatcccgctgtgcacggacatcgcgtacaaccagaccatcatgcccaacctc
ttgggccacaccaaccaagaggacgcgggcctcgaggtgcaccagttctaccccttggtg
aaggtgcagtgttcggcggagctcaagttcttcctgtgctccatgtacgcgcccgtgtgc
accgtgctggagcaggcgctgccgccctgccgctctctgtgcgagcgcgcgcgccagggc
tgcgaggcgctcatgaacaagttcggcttccagtggcccgacacgctcaagtgcgagaag
ttcccggtgcacggcgccggcgagctgtgcgtgggccagaacacgtcggacaagggcacg
ccgacgccctccttgctgcccgagttctggaccagcaacccccagcacggcggcgggggg
caccgcggcggcggctttccggggggcgcgggcgcgtcggagcgcggcaagttctcgtgc
ccgcgcgccctcaaggtgccctcctacctcaactaccacttcctgggggagaaagactgc
ggcgcgccgtgtgagccgaccaaggtgtacggcctcatgtactttgggcccgaggaactg
cgcttctcgcgcacctggatcggcatctggtcagtgctgtgctgcgcctccacgctcttc
acggtgctcacctacctggtggacatgcggcgcttcagctacccggagcggcccatcatc
ttcctgtcgggctgctacacggcggtggccgtggcctacatcgccggcttcctgctggag
gaccgtgtggtgtgtaacgacaagttctccgaggacggggcgcgcacggtggcgcagggc
accaagaaggagggctgcaccatcctcttcatgatgctctacttctttagcatggccagc
tccatctggtgggtgattctgtcgctcacctggttcctggcagccggcatgaagtggggt
cacgaagccatcgaggctaactcgcagtattttcacctggcagcgtgggccgtgccagcc
atcaagaccatcaccatcctggcgctgggccaggtggacggcgacgtgctgagcggggtg
tgcttcgtggggctcaataacgtggacgcgctgcgcggcttcgtgctggcgccgctcttc
gtgtacctgttcatcggcacgtctttcctgctggccggcttcgtgtccctcttccgcatt
cgcaccatcatgaagcacgacggcaccaagacggagaagctggagaagctcatggtgcgc
atcggcgtcttcagcgtgctctacaccgtgcccgccactatcgtcatcgcctgctacttc
tacgagcaggccttccgggaccagtgggagcgcagctgggtggcccagagctgcaagagc
tatgccatcccctgcccccacctccaggcgggtggaggcgccccgccccacccgcccatg
agcccagacttcacagtcttcatgatcaagtaccttatgacactgatcgtgggcatcacg
tcgggcttctggatctggtccggcaagaccctcaactcctggaggaagttctataccagg
cttaccaacagcaaacagggagagaccaccgtctga

KEGG   Vulpes vulpes (red fox): 112926772
Entry
112926772         CDS       T05911                                 

Gene name
FZD3
Definition
(RefSeq) frizzled-3
  KO
K02329  frizzled 3
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04360  Axon guidance
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112926772 (FZD3)
   04390 Hippo signaling pathway
    112926772 (FZD3)
   04150 mTOR signaling pathway
    112926772 (FZD3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112926772 (FZD3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112926772 (FZD3)
  09158 Development and regeneration
   04360 Axon guidance
    112926772 (FZD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112926772 (FZD3)
   05206 MicroRNAs in cancer
    112926772 (FZD3)
   05205 Proteoglycans in cancer
    112926772 (FZD3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112926772 (FZD3)
   05226 Gastric cancer
    112926772 (FZD3)
   05217 Basal cell carcinoma
    112926772 (FZD3)
   05224 Breast cancer
    112926772 (FZD3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112926772 (FZD3)
   05022 Pathways of neurodegeneration - multiple diseases
    112926772 (FZD3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112926772 (FZD3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112926772 (FZD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:vvp04030]
    112926772 (FZD3)
G protein-coupled receptors [BR:vvp04030]
 Frizzled / Smoothened family
  112926772 (FZD3)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 112926772
NCBI-ProteinID: XP_025863631
UniProt: A0A3Q7T2N7
LinkDB
Position
Unknown
AA seq 666 aa
MAMSWIVFYFWPLTMFVGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSELMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLAGDPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASSPAQYKASTVTQGSHNKACTMLFMVLYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSIFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSVHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSSNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggctatgagttggattgtcttctacttttggcccttgactatgtttgtggggcatata
ggtgggcacagtttgttttcttgtgaacccattaccttgaggatgtgccaagatttgcct
tataatactacctttatgcctaatcttctgaatcactatgaccaacagacagcagcttta
gcaatggagccattccacccaatggtgaatctggattgttctcgggattttcggccattt
ctttgtgcactctatgctcctatttgtatggaatatggacgtgtcacacttccttgtcgt
aggctgtgtcagcgggcttacagtgagtgctcggagctcatggagatgtttggtgttcct
tggcctgaagatatggaatgcagtaggttcccagattgtgatgagccatatcctcgactt
gtggatctgaatttagctggtgatcctaccgaaggagctccagtggcagtgcagagggac
tatggtttttggtgtcctcgagagttgaaaattgatcctgatcttggttattctttttta
cacgtgcgtgattgttcacctccttgtccaaatatgtactttagaagagaagaactttca
tttgctcgatacttcataggattgatttcaatcatttgcctctctgccacattgtttact
tttttaacttttttgattgatgtcacaagattccgttatcctgaaagacctattatattt
tatgcagtctgctacatgatggtatcattaattttcttcattgggtttttgcttgaggac
cgagtagcctgcaatgcatctagccctgcacagtataaggcttccacagtgacacaagga
tctcataataaagcctgtaccatgctttttatggtactctatttttttactatggctggc
agtgtttggtgggtaattcttaccatcacatggttcttggcagctgtgccaaagtggggt
agtgaagcaattgagaagaaagcattgctatttcacgccagtgcatggggcatccccgga
actctaactatcatccttttagcgatgaataaaattgaaggtgacaatatcagtggcgtg
tgttttgttggcctctacgatgttgatgcattgagatattttgttcttgctcccctctgc
ctgtatgtggtagttggagtttctctcctcttagctggcattatatccctaaacagagtt
cgaattgaaattccattagaaaaggagaatcaagataaattggtgaagtttatgatccgg
attggtgttttcagcattctttatctcgtaccactcttggttgtaattggatgctacttt
tatgagcaagcttaccgtggcatctgggaaacaacatggatacaagaacgctgcagagaa
tatcacattccatgtccatatcaggttactcaaatgagtcgtccagacctgattctcttt
ctgatgaaatacctgatggctctcatagttggtattccctccattttttgggttggaagc
aaaaagacatgctttgaatgggccagtttttttcacggtcgtaggaaaaaagagatagta
aatgaaagccgacaggtactacaggaacctgattttgctcagtctcttctgagggatcca
aatactcctattataagaaaatcaagaggaacttccactcaaggaacgtccacacatgct
tcttcaactcagcttgctatggtggatgatcagagaagcaaagcagggagtgtccacagc
aaagtaagcagctaccacggcagtctccacaggtcccgtgatggcaggtacactccctgc
agttacagaggaatggaagagagactacctcatggcagcatgtcacgactgacggatcac
tccaggcacagtagttctcatcggctcaatgaacagtcacgacatagcagcatcagagac
ctcagtagtaatcccatgactcacatcacacatggtactagcatgaatcgagttattgaa
gaagatggaaccagtgcttaa

KEGG   Vulpes vulpes (red fox): 112932336
Entry
112932336         CDS       T05911                                 

Gene name
FZD4
Definition
(RefSeq) frizzled-4
  KO
K02354  frizzled 4
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112932336 (FZD4)
   04390 Hippo signaling pathway
    112932336 (FZD4)
   04150 mTOR signaling pathway
    112932336 (FZD4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112932336 (FZD4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112932336 (FZD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112932336 (FZD4)
   05205 Proteoglycans in cancer
    112932336 (FZD4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112932336 (FZD4)
   05226 Gastric cancer
    112932336 (FZD4)
   05217 Basal cell carcinoma
    112932336 (FZD4)
   05224 Breast cancer
    112932336 (FZD4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112932336 (FZD4)
   05022 Pathways of neurodegeneration - multiple diseases
    112932336 (FZD4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112932336 (FZD4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112932336 (FZD4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:vvp04030]
    112932336 (FZD4)
   04090 CD molecules [BR:vvp04090]
    112932336 (FZD4)
G protein-coupled receptors [BR:vvp04030]
 Frizzled / Smoothened family
  112932336 (FZD4)
CD molecules [BR:vvp04090]
 Proteins
  112932336 (FZD4)
SSDB
Motif
Pfam: Frizzled Fz Chol_subst-bind
Other DBs
NCBI-GeneID: 112932336
NCBI-ProteinID: XP_025871053
UniProt: A0A3Q7TN04
LinkDB
Position
Unknown
AA seq 669 aa
MAEEQAMKRGIPNPGIVAFGKASPQRHDVYTVSPSTLEHYQSELYPPFLLAVVPSHTSSP
NQYTRHRTLHVLFGIEIPSWKVCWGRADQPPVSRMKCKPGDLQKLEPLTMELLMHLAQDS
EKLKEELMQVQGLPQPITGAPGGVDLSLRRLRLLLLLLLLLLLEPARGFGDEEERRCDPI
RISMCQNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTE
KINIPIGPCGGMCLSVKRRCEPVLKEFGFAWPESLNCSKFPPQNDHNHMCMEGPGDEEVP
LPHKTPIQPGEECHSVGTNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWAS
LCFISTAFTVLTFLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAA
EPVLIQEGLKNTGCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFH
IAAWAIPAVKTIVILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAA
GLVALFKIRSNLQKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYS
ADDSNMAVEMLKIFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVK
PGKGNETVV
NT seq 2010 nt   +upstreamnt  +downstreamnt
atggcagaagagcaagccatgaaaagaggcattccaaacccggggatcgttgcatttgga
aaggcgagcccccagaggcacgatgtttacaccgtgtcaccttccactttggaacactat
caaagtgagctctaccctcccttcctactggctgtggtgccaagccacacctccagcccc
aatcagtacacaagacaccgcactctacacgtactgttcggtatcgagatccctagctgg
aaggtgtgttggggccgtgccgaccagcctcctgtgtcacgcatgaaatgcaagcccggt
gacctgcagaagctagagcccttaaccatggagctactcatgcacctggcccaagattca
gagaagctgaaggaagagctcatgcaggtccaagggctgccccagccaataacgggggcg
cccgggggcgtcgatctcagcctgcggcggctgcggctgctgctgctgctgctgctgctg
ctgctcctcgagccagcgcggggcttcggggacgaggaggagcggcgctgcgaccccatc
cgcatctccatgtgccagaacctgggctacaacgtgaccaagatgcccaacctggtgggg
cacgagctgcagacagacgccgagctgcagctgacaactttcacgccgctcatccagtac
ggctgctccagccagctgcagttcttcctttgttcagtctatgtgccaatgtgcacagag
aagatcaacatccccataggcccgtgcggcggcatgtgtctttcagtcaagaggcgctgt
gaacctgtcctgaaggaatttggatttgcctggccagagagcctgaactgcagcaaattc
ccaccccagaatgaccacaaccatatgtgcatggaagggccaggtgatgaggaggtgccg
ttacctcacaaaacccccatccagcccggggaagagtgccattcggtaggcaccaactcg
gatcagtacatctgggtgaaaaggagcctgaactgtgttctcaagtgtggctatgatgct
ggcttatacagtcgctcggccaaggagttcacggacatctggatggccgtgtgggccagc
ctgtgcttcatctccaccgccttcacagtgctcaccttcctcatcgattcctctaggttt
tcctaccctgagcgccccatcatatttctcagtatgtgctataatatttatagcattgct
tatattgtcaggctgactgtaggccgggaaaggatatcctgcgattttgaagaggcagca
gaacctgttctcatccaagaaggacttaagaacacaggatgtgcaatcattttcttgctg
atgtacttttttggaatggccagttccatctggtgggttattctgacactcacttggttt
ttggcagcgggactcaaatggggtcatgaggccattgaaatgcacagctcttatttccac
atcgccgcctgggccatccccgcagtgaaaaccattgtcatcttgattatgagactggtg
gacgcggatgaactgactggcctgtgctacgtcgggaaccaaaacctcgatgccctcaca
ggctttgtggtggcccccctcttcacttacctggtaatcggaactttgttcatcgctgcg
ggcttagtggccttgttcaaaattcggtccaatctgcaaaaggatgggacaaagactgac
aagttggaaaggctgatggtcaagatcggggtcttctcagtcctgtacacggtgcctgcc
acctgtgtgattgcctgttacttctatgaaatctccaactgggcgctcttccgctattct
gcagatgactccaacatggccgttgagatgttgaaaatttttatgtctttgctggtgggc
atcacctcaggcatgtggatttggtctgccaaaactctgcacacatggcagaagtgttct
aacagattggtgaattctgggaaggtaaagagagaaaagcgagggaacggttgggtgaag
cctgggaagggcaacgaaactgtggtataa

KEGG   Vulpes vulpes (red fox): 112933856
Entry
112933856         CDS       T05911                                 

Gene name
FZD10
Definition
(RefSeq) frizzled-10
  KO
K02842  frizzled 9/10
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112933856 (FZD10)
   04390 Hippo signaling pathway
    112933856 (FZD10)
   04150 mTOR signaling pathway
    112933856 (FZD10)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112933856 (FZD10)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112933856 (FZD10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112933856 (FZD10)
   05205 Proteoglycans in cancer
    112933856 (FZD10)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112933856 (FZD10)
   05226 Gastric cancer
    112933856 (FZD10)
   05217 Basal cell carcinoma
    112933856 (FZD10)
   05224 Breast cancer
    112933856 (FZD10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112933856 (FZD10)
   05022 Pathways of neurodegeneration - multiple diseases
    112933856 (FZD10)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112933856 (FZD10)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112933856 (FZD10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:vvp04030]
    112933856 (FZD10)
   04090 CD molecules [BR:vvp04090]
    112933856 (FZD10)
G protein-coupled receptors [BR:vvp04030]
 Frizzled / Smoothened family
  112933856 (FZD10)
CD molecules [BR:vvp04090]
 Proteins
  112933856 (FZD10)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 112933856
NCBI-ProteinID: XP_025872932
UniProt: A0A3Q7UIB2
LinkDB
Position
Unknown
AA seq 581 aa
MPRPGPRLWLVLQVMGSCAAISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHEN
QREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPI
MEQFNFKWPDSLDCSKLPNKNDPNYLCMEAPNNGSDEPSRGSGLFPPLFRPQRPHSAQEH
PLRDAGQGRTGCDNPGKFHHVGKSAACAPLCTPGVDVYWSRGDKRFAVVWLAVWAVLCFF
SSAFTVLTFLIDPARFRYPERPIIFLSMCYCVYSVGYIIRLFAGAESIACDRDSGQLYVI
QEGLESTGCTLVFLVLYYFGMASSLWWVILTLTWFLAAGKKWGHEAIEANSSYFHLAAWA
IPAVKTILILVMRRVAGDELTGVCYVGSMDVNALTGFVLIPLACYLVIGTSFILSGFVAL
FHIRRVMKTGGENTDKLEKLMVRIGVFSVLYTVPATCVIACYFYERLNMEYWKILATQHK
CKMNNQTKSLDCVMAASIPAVEIFMVKIFMLLVVGITSGMWIWTSKTLQSWQNVCSRRFK
RKSRRKPASVITNSGIYKKAQHPPKTHLGKYEIPAQPPTCV
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgccgcgcccgggcccccgcctgtggctggtcctgcaggtgatgggttcgtgcgccgcc
atcagttccatggacatggagcgcccgggcgacggcaagtgccaacccattgagatcccg
atgtgcaaggacatcggctacaacatgacccgcatgcccaacctgatgggccacgagaac
cagcgcgaggccgccatccagctgcatgagttcgcgccgctggtggagtacggctgccac
ggccacctccgcttcttcctgtgctcgctgtacgcgcccatgtgcaccgagcaagtctcc
acccccatccctgcctgccgggtcatgtgcgagcaggcccggctcaagtgctccccgatc
atggagcagttcaacttcaagtggcccgactcgctggactgcagcaagctccccaacaag
aacgaccccaactacctgtgcatggaggcgcccaacaatggctcggacgagccctcccgg
ggctccggcctgttcccgccgctcttccggccgcagcggccgcacagcgcgcaggagcac
ccgctccgggacgcgggccaggggcgcaccggctgcgacaacccgggcaagttccaccac
gtggggaagagcgcggcgtgcgccccgctctgcacgcccggggtggacgtgtactggagc
cgcggcgacaagcgcttcgcggtggtctggctggccgtctgggcggtgctgtgcttcttc
tccagcgccttcaccgtgctcaccttcctcatcgacccggcccgcttcaggtacccggag
cgccccatcatcttcctctccatgtgctactgcgtctactccgtgggctacatcatccgc
ctcttcgctggcgccgagagcatcgcctgcgaccgggacagcggacagctctatgtcatc
caggaggggctggagagcacgggctgcaccctcgtcttcctggtgctctactacttcggc
atggccagctcgctgtggtgggtgattctcacactcacctggttcctggctgcgggcaag
aagtggggccatgaggccatcgaggccaatagcagctacttccacctggcagcctgggcc
atcccggccgtgaagaccatcctgatcctggtgatgcgcagggtggctggggacgagctc
accggggtgtgctacgtgggcagcatggacgtgaacgccctcaccggcttcgtgctcatc
ccgctggcctgctacctcgtcatcggcacttccttcatcctgtctggcttcgtggccctc
ttccacatccggagggtgatgaagaccggtggggagaacacggacaaactggagaagctc
atggtgagaatcggggtcttctcggtgctttacaccgtgccggccacctgtgtgatcgcc
tgttacttttacgaacgcctcaacatggagtactggaagatcctagccacgcagcacaag
tgcaaaatgaacaaccagaccaaaagtctggactgtgtgatggctgcgtccatcccagcg
gtggagatcttcatggtgaagatcttcatgctgctggtggtgggcatcaccagcggcatg
tggatctggacatcgaagaccctgcagtcctggcagaatgtttgcagccgcaggttcaag
agaaagagcaggaggaaacctgccagcgtgatcaccaatagtgggatttacaaaaaagcc
cagcatcccccaaaaacccacctcggaaaatatgagatccctgcacagcctcccacgtgt
gtgtga

KEGG   Vulpes vulpes (red fox): 112935737
Entry
112935737         CDS       T05911                                 

Gene name
FZD9
Definition
(RefSeq) frizzled-9
  KO
K02842  frizzled 9/10
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04150  mTOR signaling pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04916  Melanogenesis
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112935737 (FZD9)
   04390 Hippo signaling pathway
    112935737 (FZD9)
   04150 mTOR signaling pathway
    112935737 (FZD9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112935737 (FZD9)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    112935737 (FZD9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112935737 (FZD9)
   05205 Proteoglycans in cancer
    112935737 (FZD9)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112935737 (FZD9)
   05226 Gastric cancer
    112935737 (FZD9)
   05217 Basal cell carcinoma
    112935737 (FZD9)
   05224 Breast cancer
    112935737 (FZD9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112935737 (FZD9)
   05022 Pathways of neurodegeneration - multiple diseases
    112935737 (FZD9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112935737 (FZD9)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112935737 (FZD9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:vvp04030]
    112935737 (FZD9)
   04090 CD molecules [BR:vvp04090]
    112935737 (FZD9)
G protein-coupled receptors [BR:vvp04030]
 Frizzled / Smoothened family
  112935737 (FZD9)
CD molecules [BR:vvp04090]
 Proteins
  112935737 (FZD9)
SSDB
Motif
Pfam: Frizzled Fz Dicty_CAR
Other DBs
NCBI-GeneID: 112935737
NCBI-ProteinID: XP_025875403
UniProt: A0A3Q7U083
LinkDB
Position
Unknown
AA seq 855 aa
MTYRSSPDTTWSTRSQAQRTPYDSIYTTVENRCSQAGMQAVRGAERLAGADRREAAHGGN
RPAPFLHQGGGHGAIFTLLIIGQAEPMGLVHLSSKSGSNGDEETTVSRGIVLSKDVAPAR
NDGTCLGAYKGHECWDPGLHEWEWYRSTPAPAQKQVRHCTCQVLLHIDSPPKGVQGTDGR
RCGGGLGATPGRSSAVHARNMSFTLGNGKLLLAFWETVILDQLINARSFFARFRKENAAL
QGAVRVVATGFLARGDPQRKPLLLWQLLAAGGAALEIGRFDPERGRGPAPCQAVEIPMCR
GIGYNLTRMPNLLGHTSQGEAAAELAEFAPLVQYGCHSHLRFFLCSLYAPMCTDQVSTPI
PACRPMCEQARLRCAPIMEQFNFGWPESLDCARLPXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTCENPEKFQYVEKSRSCAPRCG
PGVEVFWSRRDKDFALVWMAVWSALCFFSTAFTVLTFLLEPHRFQYPERPIIFLSMCYNV
YSLAFLIRAVAGAQSVACDQEAGALYVIQEGLENTGCTLVFLLLYYFGMASSLWWVVLTL
TWFLAAGKKWGHEAIEAHGSYFHMAAWGLPALKTIVILTLRKVAGDELTGLCYVASMDAA
ALTGFVLVPLSCYLVLGTSFLLTGFVALFHIRKIMKTGGTNTEKLEKLMVKIGVFSILYT
VPATCVIVCYVYERLNMDFWRLRATEQPCLAATVPGGRRDCSLPGGSVPTVAVFMLKIFM
SLVVGITSGVWVWSSKTFQTWQSLCHRKMAAGRARAKACRASGGYGRGTHCHYKAPTVVL
HMTKTDPSLENPTHL
NT seq 2568 nt   +upstreamnt  +downstreamnt
atgacgtacaggagtagcccagataccacgtggagcacaaggagccaggcacagcgaaca
ccgtatgattccatttatacgaccgtcgagaacaggtgcagccaagcagggatgcaggcc
gtgagaggagccgagcggctggctggagctgacagacgggaggcggcccacggggggaac
aggccggctccgtttctccatcagggtggtggtcacggggccatattcactctgttaata
attggtcaagctgaacccatgggacttgtgcatcttagcagtaaatcaggaagcaatggt
gatgaagagaccacagtcagcagagggattgtcctgagcaaagatgtggccccagccagg
aatgacggcacatgtttaggggcctacaaggggcatgagtgctgggaccctggcctccat
gaatgggagtggtatcgctccacaccggcccctgcccagaagcaggtgcgtcattgtacc
tgccaggtcctgctgcacattgacagccctcctaagggggtacaggggactgatggcagg
agatgtggaggtgggttgggggccacgcctggaaggtcttctgctgttcatgccaggaac
atgagcttcaccctgggcaatgggaagctgctgctggcattttgggaaactgttatcctt
gaccagctgatcaatgccaggtccttttttgcaaggttcaggaaggagaatgcagctctc
cagggggctgttcgggtggtggccacaggcttcctggccagaggggatccccagcgaaag
cccttgctgctgtggcagctgctggcggcgggcggcgcggcgctggagatcggccgtttc
gacccggagcgcgggcgcgggccggcgccctgccaggcggtggagatccccatgtgccgc
ggcatcggctacaacctgacccgcatgcccaacctgctgggccacacgtcgcagggtgag
gcggccgcggagctggccgagttcgcgccgctcgtgcagtacggctgccacagccacctg
cgcttcttcctgtgctcgctgtacgcgcccatgtgcaccgaccaggtctcgacgcccatc
cccgcctgccggcccatgtgcgagcaggcgcgcctgcgctgcgcgcccatcatggagcag
ttcaacttcggctggcccgagtcgctcgactgcgcccggctgcccnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnngcacctgc
gagaacccggagaagttccagtacgtggagaagagccgctcgtgcgcgccgcgctgcggg
cccggcgtcgaggtgttctggtcgcggcgcgacaaggacttcgcgctcgtctggatggcc
gtgtggtcggcgctgtgcttcttctccaccgccttcacggtgctcaccttcctgctggag
ccccaccgcttccagtaccccgagcgccccatcatcttcctgtccatgtgctacaacgtc
tactcgctggccttcctcatccgcgccgtggcgggcgcccagagcgtggcctgcgaccag
gaggcgggcgcgctctacgtgatccaggaggggctggagaacacgggctgcaccctggtc
ttcctgttgctctactacttcggcatggccagctcgctgtggtgggtggtgctgaccctc
acctggttcctggcggcgggcaagaagtggggccacgaggccattgaggcccacggcagc
tacttccacatggcggcctggggcctgccggccctcaagaccatcgtgatcctgacgctg
cgcaaggtggccggggacgagctgaccgggctgtgctacgtggccagcatggatgcggcc
gcgctcacgggcttcgtgctggtgcccctctcctgctacctggtgctgggcaccagcttc
ctcctgaccggcttcgtggccctcttccacatccgcaagatcatgaagacaggtggcacc
aacacggagaagctggagaagctcatggtcaagatcggggtcttctccatcctctacacg
gtgcctgccacctgcgtcattgtgtgctacgtctatgaacgcctcaacatggacttctgg
cgccttcgggccacagagcagccctgcctggcagccacggtgcccgggggccggagggac
tgctcgctaccggggggctcggtgcccaccgtggccgtctttatgcttaaaatcttcatg
tcgctggtggtggggatcaccagcggcgtctgggtttggagctccaagactttccagacc
tggcagagcttgtgccaccgcaagatggcagccggccgggcccgggcaaaggcctgccgg
gcttccgggggctatggccgtggcacccactgccactacaaggcccccaccgtggtcttg
cacatgactaagacggacccttctctggagaaccccacgcacctctag

DBGET integrated database retrieval system