KEGG   Vulpes vulpes (red fox): 112910741
Entry
112910741         CDS       T05911                                 

Gene name
STAT3
Definition
(RefSeq) signal transducer and activator of transcription 3 isoform X1
  KO
K04692  signal transducer and activator of transcription 3
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp04062  Chemokine signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04068  FoxO signaling pathway
vvp04217  Necroptosis
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04630  JAK-STAT signaling pathway
vvp04659  Th17 cell differentiation
vvp04917  Prolactin signaling pathway
vvp04920  Adipocytokine signaling pathway
vvp04931  Insulin resistance
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04935  Growth hormone synthesis, secretion and action
vvp05145  Toxoplasmosis
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05169  Epstein-Barr virus infection
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05212  Pancreatic cancer
vvp05221  Acute myeloid leukemia
vvp05223  Non-small cell lung cancer
vvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
vvp05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    112910741 (STAT3)
   04066 HIF-1 signaling pathway
    112910741 (STAT3)
   04068 FoxO signaling pathway
    112910741 (STAT3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    112910741 (STAT3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112910741 (STAT3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    112910741 (STAT3)
   04062 Chemokine signaling pathway
    112910741 (STAT3)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112910741 (STAT3)
   04917 Prolactin signaling pathway
    112910741 (STAT3)
   04935 Growth hormone synthesis, secretion and action
    112910741 (STAT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112910741 (STAT3)
   05206 MicroRNAs in cancer
    112910741 (STAT3)
   05205 Proteoglycans in cancer
    112910741 (STAT3)
   05203 Viral carcinogenesis
    112910741 (STAT3)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112910741 (STAT3)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    112910741 (STAT3)
   05221 Acute myeloid leukemia
    112910741 (STAT3)
   05223 Non-small cell lung cancer
    112910741 (STAT3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    112910741 (STAT3)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    112910741 (STAT3)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112910741 (STAT3)
  09172 Infectious disease: viral
   05162 Measles
    112910741 (STAT3)
   05161 Hepatitis B
    112910741 (STAT3)
   05160 Hepatitis C
    112910741 (STAT3)
   05163 Human cytomegalovirus infection
    112910741 (STAT3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112910741 (STAT3)
   05169 Epstein-Barr virus infection
    112910741 (STAT3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112910741 (STAT3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112910741 (STAT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vvp03000]
    112910741 (STAT3)
Transcription factors [BR:vvp03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    112910741 (STAT3)
SSDB
Motif
Pfam: STAT_alpha STAT_bind STAT_int SH2 Syntaxin-6_N AP1AR KGG
Other DBs
NCBI-GeneID: 112910741
NCBI-ProteinID: XP_025842776
UniProt: A0A3Q7RBL1
LinkDB
Position
Unknown
AA seq 770 aa
MAQWNQLQQLDTRYLEQLHQLYSDSFPMELRQFLAPWIESQDWAYAASKESHATLVFHNL
LGEIDQQYSRFLQESNVLYQHNLRRIKQFLQSRYLEKPMEIARIVARCLWEESRLLQTAA
TAAQQGGQASHPTAAVVTEKQQMLEQHLQDVRKRVQDLEQKMKVVENLQDDFDFNYKTLK
SQGDMQDLNGNNQSVTRQKMQQLEQMLTALDQMRRSIVSELAGLLSTMEYVQKTLTDEEL
ADWKRRQQIACIGGPPNICLDRLENWITSLAESQLQTRQQIKKLEELQQKVSYKGDPIVQ
HRPMLEERIVELFRNLMKSAFVVERQPCMPMHPDRPLVIKTGVQFTTKVRLLVKFPELNY
QLKIKVCIDKDSGDVAALRGSRKFNILGTNTKVMNMEESNNGSLSAEFKHLTLREQRCGN
GGRANCDASLIVTEELHLITFETEVYHQGLKIDLETHSLPVVVISNICQMPNAWASILWY
NMLTSNPKNVNFFTKPPIGTWDQVAEVLSWQFSSTTKRGLSIEQLTTLAEKLLGPGVNYS
GCQITWAKFCKENMAGKGFSFWVWLDNIIDLVKKYILALWNEGYIMGFISKERERAILST
KPPGTFLLRFSESSKEGGVTFTWVEKDISGKTQIQSVEPYTKQQLNNMSFAEIIMGYKIM
DATNILVSPLVYLYPDIPKEEAFGKYCRPESQEHPEADPGSAAPYLKTKFICVTPTTCSN
TIDLPMSPRTLDSLMQFGNNGEGAEPSAGGQFETLTFDMELTSECATSPM
NT seq 2313 nt   +upstreamnt  +downstreamnt
atggcccaatggaatcagctacagcaactcgacacacggtacttagagcagcttcatcag
ctgtacagcgacagcttcccaatggagctacggcagtttctggccccgtggatcgagagt
caagattgggcatatgcagccagcaaagaatcacatgctactttggtgtttcataatctc
ttgggtgagattgaccagcagtacagccgttttctacaggagtcaaatgttctctatcag
cacaatctgcgaagaatcaagcagttccttcagagcagatatctggagaagccaatggag
attgcccgaattgtggcccggtgtttgtgggaagagtcccgcctgctacaaactgcagcc
actgcagctcagcaagggggccaggccagccaccccacagccgccgtggtgacggagaag
caacagatgctggagcagcatcttcaagatgttcggaagcgagtacaggatctagaacag
aaaatgaaagtggtcgagaatctccaggatgactttgatttcaactacaaaaccctcaag
agtcaaggagacatgcaggatctgaatggaaacaaccagtcggtgaccagacagaagatg
cagcagttggagcagatgctcactgcactggaccagatgcggcggagcatcgtgagtgag
ttagcggggctgttgtcaactatggagtacgtgcagaaaactctcaccgatgaagagctg
gctgattggaagaggcggcaacagattgcgtgcattggaggcccccccaacatctgccta
gatcgcctagaaaactggataacctcattagcagagtcacaacttcagacccgccaacaa
attaagaaactggaggagttacaacaaaaagtgtcctataaaggggatcccatcgtccag
caccggccaatgctagaggagaggattgtagagctgtttaggaacttaatgaaaagtgcc
tttgtggttgagcggcagccctgcatgcccatgcatcctgaccggccgttagtcatcaag
actggcgtccagttcactaccaaagtcagattgctggtcaaattcccggagttaaattat
cagcttaaaattaaagtgtgcattgacaaagactccggggatgtcgccgctctcagagga
tctcggaaatttaacattctgggcacaaacacaaaagtgatgaacatggaagagtccaac
aacggcagcctgtctgcagaattcaaacacctgaccctgagagagcaaagatgtggtaac
gggggccgagccaactgtgatgcctccctgattgtcactgaggagctacacctgatcacc
tttgagacggaggtgtatcaccaaggcctcaagattgaccttgagacccactccttgcca
gttgtggtgatctccaatatctgtcagatgccaaatgcctgggcatcaatcctgtggtat
aacatgctgaccagcaaccccaagaacgtgaactttttcaccaagcccccgattggaacc
tgggatcaagtggctgaggtgctgagctggcagttctcctccaccacaaagcgaggattg
agcatcgagcagttgactacgctggcagagaaactcttaggacctggtgtgaactactca
gggtgtcagattacgtgggctaaattttgcaaagaaaacatggctggcaaaggcttctcc
ttctgggtttggctagacaatatcattgacctcgtgaaaaagtatatcctggctctttgg
aatgaaggatacataatgggttttatcagtaaggagcgggagcgggccatcctgagcaca
aagcccccaggcaccttcctgctacggttcagtgaaagcagcaaagaaggaggtgtcacc
ttcacttgggtagagaaggacatcagcggtaagacccagatccagtcggtggaaccatat
accaagcaacagctgaacaacatgtcgtttgctgaaatcatcatgggctataagatcatg
gatgctaccaacatcctcgtgtctccgctggtctatctctaccccgacattcctaaggaa
gaggcgtttggaaagtactgtcgaccagagagccaggaacatcctgaagccgacccaggt
agtgctgccccatacctgaagaccaagtttatctgtgtgacaccaacgacgtgcagcaat
accattgacctgccgatgtccccccgcactttagattcattgatgcagtttggaaataat
ggtgaaggtgctgagccctcagcaggagggcagttcgagaccctcacgttcgacatggag
ttgacctcggagtgcgctacctccccgatgtga

DBGET integrated database retrieval system