KEGG   Vulpes vulpes (red fox): 112910801
Entry
112910801         CDS       T05911                                 

Gene name
BRCA1
Definition
(RefSeq) breast cancer type 1 susceptibility protein
  KO
K10605  breast cancer type 1 susceptibility protein [EC:2.3.2.27]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01524  Platinum drug resistance
vvp03440  Homologous recombination
vvp03460  Fanconi anemia pathway
vvp04120  Ubiquitin mediated proteolysis
vvp04151  PI3K-Akt signaling pathway
vvp05206  MicroRNAs in cancer
vvp05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    112910801 (BRCA1)
  09124 Replication and repair
   03440 Homologous recombination
    112910801 (BRCA1)
   03460 Fanconi anemia pathway
    112910801 (BRCA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112910801 (BRCA1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    112910801 (BRCA1)
  09162 Cancer: specific types
   05224 Breast cancer
    112910801 (BRCA1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112910801 (BRCA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112910801 (BRCA1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:vvp04121]
    112910801 (BRCA1)
   03036 Chromosome and associated proteins [BR:vvp03036]
    112910801 (BRCA1)
   03400 DNA repair and recombination proteins [BR:vvp03400]
    112910801 (BRCA1)
Enzymes [BR:vvp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     112910801 (BRCA1)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112910801 (BRCA1)
Ubiquitin system [BR:vvp04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    112910801 (BRCA1)
  Multi subunit Ring-finger type E3
   BRCC complex
    112910801 (BRCA1)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     112910801 (BRCA1)
DNA repair and recombination proteins [BR:vvp03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-core complex
     112910801 (BRCA1)
    BRCA1-A complex
     112910801 (BRCA1)
    BRCA1-B complex
     112910801 (BRCA1)
    BRCA1-C complex
     112910801 (BRCA1)
    BRCA complex
     112910801 (BRCA1)
   FA (Fanconi anemia) pathway
    Downstream FA components
     112910801 (BRCA1)
SSDB
Motif
Pfam: BRCT_assoc BRCT zf-C3HC4 zf-C3HC4_2 zf-C3HC4_3 zf-C3HC4_4 zf-RING_UBOX zf-RING_2 zf-RING_5 zf-Nse zf-RING_6 BRCT_2 zf-RING_10 zf-ANAPC11 Prok-RING_4 Arylsulfotran_2 zf-rbx1 Baculo_IE-1
Other DBs
NCBI-GeneID: 112910801
NCBI-ProteinID: XP_025842889
UniProt: A0A3Q7RA52
LinkDB
Position
Unknown
AA seq 1878 aa
MDLSADRVEEVQNVLNAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQRKGPSQ
CPLCKNDITKRSLQESTRFSQLVEELLKIIHAFELDTGLQFADSYNFSKKENNSPEHLKE
EVSIIQSMGYRNRAKRLRQSEPENPTLETSLSVQLSNLGIVRSLRTKQQIQPQNKSVYIE
LGSDSSEDTVNKASSCSVGDDKLEITSQGARAEASLNPAKKAACEFSEDITNIEHHQSGN
KDLTTTEKHATKKHPEKYQGISVSNLHVEPCGTNTHASSLQHENSSLLLTKHRMNVEKAE
ICNNSKQPGLARSQQSRWAESKETCNDRQTPSTEKKVVVNANLLCERKELNKQKPPRSDS
PRDSQDVPWITLNSSIRKVNEWFSRSDEILTSDDSHDRGSELNTEVGGAEVPNEVGEYSG
SSEKIDLMASDPQDALICESERVHTKPVGSNIEDKIFGKTYRRKASLRKVSHTFRTEVLT
IGACAIEPQTTQTHPLMNKAEHKRKTTSSLHPEDFIKKVELGIVPKTPEKLIEGINQIKR
DGHVINITNNGPENETEGDYVQKEKNPNPTESLEKESAFRTKTEPMSSRISNMELELDSS
SSKAPKKNRLRRKSSARHTCALEFVVNRNLNPPDHSELQIESCSSSEEMKKQHLDQVPVR
HNKTLQLMQDKEPAGRAKKSSKPGEQINKRLASHAFPELTLTNVSGFFANCSSSSKPQEY
INPGLRREEIEESRRMTQVSDSTRDPKELVLSGGRGLQTERSVESTSISLVLDTDYGTQD
SISLLEADTLRKAKTAPNQWANLCATIENPKEPIHGCSKDTRNDTEGFVVPLTCEDNHTQ
ETSIEMEESELDTQCLRNMFKVSKRQSFALFSYPRDPEEDCVTVCPRSGAFGKQGPKVTL
ECGQKEESQGKKESEIRHVQAVHTTAGFSAVSQKPKKPGDFAKCSIKGVSRLCLSSQFKG
KETELLIANYHGISQNPYHIPPLSPIRSCVKTLCQENLSEEKFEQHSVSPERAVGNERVI
QSTVSTISQNNIRECASKEVGSSSVNEVVSSTNEVGSSINEVGSSGENIQAELGRNRGPK
LNAMLRLGLMQPEVCKQSLSLSNCKHPEMKWQGQSEGAVLSVSADFSPCLISDNPEQPMG
SSRSSQVCSETPDDLLNGDKIKGKVSFAESDIKERSAVFSKSVQSGEFSRSPSPSDHTRL
AQGYQRGAKKLESSEENMSSEEEELPCFQHLLFGKVTNMPSQSTSHNAVAAEGLSNKTEE
NLDSLKNSLSDVSNQVPSAKASQEHHLSEEARCSGSLFSSQCSALEDLTVNTNNQDPFSM
FDPPSKQVRHQSENLDVLNDKELVSDDDDEREPGLEEESPQEEQSVDSDLGEVASGYESE
TSLSEDCSRLSSQSDILTTQQRDTMQDNLIKLQQEMAELEAVLEQHESQPSNSSPSLIAD
SCSPEDLLNPEQSASERVLTSEKSSDSPISQNPESLSTDKFQVFLDSSTSKNGEPGMIRS
SPSQSRSLDTKWYVHSCPRSLQDTNCPSQKELTKVVCMEEQQPTESEARDLMEQSYLSRP
DLEGAPYLESGISLFSDDPESDPSSHRASELVHVSSMPTSTSALKLPQFQVKESGKSTAV
HIASTAGYNKSEYSVSREKPEVMSSTRGVNKRISMVASGLTPKEFMLVHKFARKHHITLT
NLISEETTHVIMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKERKILDEHDFEVR
GDVVNGRNHQGPKRARESQDRESQDRKIFRGLEICCYGPFTNMPTDQLEWMVHLCGASVV
KEPSLFTLSKGTHPVVVVQPDAWTEDSGFHAIGQMCEAPVVTREWVLDSVALYQCQKLDT
YLIPQIPRAAADSSQPCV
NT seq 5637 nt   +upstreamnt  +downstreamnt
atggatttatctgcggatcgtgttgaggaagtacaaaatgttcttaatgctatgcagaaa
atcttagagtgtccaatatgtctggagttgatcaaagagcctgtttctacaaagtgtgat
cacatattttgcaaattttgtatgctgaaacttctcaaccagaggaaggggccttcacag
tgtcctttgtgtaagaacgatataaccaaaaggagcctacaagaaagtacaagatttagt
caacttgttgaagagttgttgaaaatcattcatgcttttgagctggacacaggattgcag
tttgcagacagctataacttttccaaaaaggaaaataactctcctgagcatctaaaggag
gaagtttctattatccaaagtatgggctatcgaaaccgtgccaaaagacttcgacagagt
gaacctgaaaaccctaccttggaaaccagtcttagtgtccaactctctaaccttggaatt
gtgcgatctctgaggacaaagcagcagatacagcctcagaataagtctgtctacattgaa
ttggggtctgattcttctgaagatacagttaataaggcaagttcttgcagtgtgggagat
gacaagttagaaatcacctctcaaggagccagggctgaagccagtttgaatcctgcaaaa
aaggctgcttgtgaattttctgaggacataacaaatattgaacatcatcaatccggtaat
aaagatttgaccaccactgagaagcatgcaactaagaagcatccagaaaagtatcagggt
atttctgtttcaaacttgcatgtggagccatgtggcacaaatactcatgccagctcatta
cagcatgagaacagcagtttattactcactaaacacagaatgaatgtagaaaaggctgaa
atctgtaataacagcaaacagcctggcttagcaaggagccaacagagcagatgggctgaa
agtaaggaaacatgtaatgataggcagactcccagcacagagaaaaaggtagttgtgaat
gctaatctcctgtgtgagagaaaagaactgaataaacagaaacctccacgctctgacagt
cctagagattcccaagatgttccttggataacactgaatagtagcatacggaaagttaat
gagtggttttccagaagtgatgaaatattaacttctgatgattcacatgacagaggatct
gaattgaatactgaagtaggtggtgcagaagttccaaatgaagtgggtgaatattctggt
tcttctgagaaaatagacttaatggccagtgatcctcaggatgctttgatatgtgaaagt
gaaagagtccacaccaagccagtaggaagtaacatcgaagataaaatatttggaaaaacc
tatcggaggaaggcaagcctccgtaaggtgagccacacctttagaactgaagttctaact
ataggagcgtgtgctatagaacctcagacaacgcaaacccatcccctcatgaataaagca
gagcataaaaggaaaactacatctagccttcatcctgaggattttatcaagaaagtagag
ttaggcattgttccaaagactcctgaaaagctaattgagggaatcaaccaaatcaagcga
gatggtcatgtgataaatattacaaataatggtcctgagaatgaaacagaaggtgattat
gttcagaaagagaaaaatcctaacccaacagaatcattggaaaaagaatctgcttttaga
accaaaactgaaccaatgagcagcaggataagcaatatggaactggaattagatagctcc
agttcaaaagcacctaagaagaacaggctgaggaggaagtcctctgccaggcacacttgt
gcccttgaattcgtagtcaatagaaatctaaacccacctgatcatagtgaactacagatt
gaaagttgttctagcagtgaagagatgaaaaaacagcatttggaccaagtaccagtcaga
cacaacaaaacacttcagctcatgcaagataaagaacctgcaggtagagctaagaaaagt
agtaagccaggagaacaaataaataagagactcgccagtcatgcttttccagagctaact
ttaacaaacgtatctggtttttttgctaactgttcaagttctagtaagcctcaagagtac
atcaaccctggccttcgaagagaagaaatagaagagagccgaagaatgactcaagtgtct
gatagtaccagagatcccaaagagctggtattgagtggaggaagaggtttgcaaactgag
agatctgtagagagtaccagtatctcattggtacttgatactgattatggtacacaggac
agtatctcattactggaagctgacaccctgaggaaggcaaaaacagcaccaaatcaatgg
gcgaatctgtgtgcaacaattgagaaccccaaggaacctatccatggttgttctaaggac
actagaaatgacacagagggttttgtagttccattgacgtgcgaagataaccacactcag
gagacaagcatagaaatggaagagagtgaacttgacacgcagtgcttacgcaatatgttc
aaggtttcaaagcgtcagtcatttgctctgttttcatatccaagagatccggaagaggac
tgtgtaacagtctgtccccgctctggggcctttggaaaacaaggtccaaaagtcactcta
gaatgtggacagaaggaagaaagtcagggaaagaaagagtctgaaatcagacatgtgcag
gcagttcatacaactgcaggcttttctgcagttagtcagaaacctaagaagccaggcgat
tttgccaaatgtagcataaagggagtctctcggctttgtctgtcatctcagttcaaaggc
aaggaaactgaactccttattgcaaattaccatggaatttcccaaaacccttatcatata
ccaccactttctcccatcagatcatgtgttaaaactctatgtcaggaaaacctgtcagag
gaaaagtttgagcaacattcagtgtcacccgaaagagcagtgggaaatgagagagtcatt
caaagtacagtgagcacaattagccaaaataacattagagaatgtgcttctaaagaagtc
ggctcaagcagtgttaatgaagtagtttccagtactaatgaagtaggctctagtattaat
gaagtgggttccagtggtgaaaacattcaagcagaactaggtagaaaccgaggacctaaa
ttaaatgctatgctcagactaggtcttatgcaacctgaagtctgtaagcaaagcctttct
ttaagtaattgtaaacatccagaaatgaaatggcaaggacaaagtgaaggagcagttctg
tctgttagtgcagatttctctccatgtctgatttcagataacccagaacaacctatggga
agtagtcggtcttctcaggtttgttctgagacacctgatgacctattaaatggtgacaaa
ataaagggaaaagtcagctttgctgaaagtgacattaaggaaagatctgctgtgtttagc
aaaagtgtccagagtggagagttcagcagaagccctagcccttcagaccatacacgtttg
gcccagggttaccagagaggggccaagaaattagagtcctcagaagagaacatgtctagt
gaggaggaagagcttccctgcttccaacacttactatttggtaaagtaaccaacatgcct
tctcagtctaccagtcacaatgcagttgccgcagagggtctatctaacaaaacagaggag
aacctagactcattgaagaatagtttaagtgatgtcagtaaccaggtaccgtcagcaaag
gcatcccaggaacatcaccttagtgaggaagcaagatgttctggcagcttattttcttca
cagtgcagtgctttggaagacttgactgtaaatacaaataaccaggatcctttctcgatg
tttgatcctccttccaaacaagtgaggcatcaatctgaaaatctggacgttctgaatgac
aaggaattggtttcagatgatgatgatgaaagggaacctggcctggaagaggaaagtcct
caagaagagcagagtgtggattcagacttaggtgaagtggcatctggatatgagagtgaa
acgagcctctctgaagactgttccaggttgtcctctcagagtgatattttaaccactcag
cagagagataccatgcaagataacctgataaagctccagcaggaaatggctgaactggaa
gctgtgttagagcagcatgagagccagccctctaacagctccccttcccttatagcagat
tcttgttcgcctgaggatctgctgaatccggaacaaagcgcatcagaaagagtattaact
tcagagaaaagtagtgactctcctataagccaaaatcccgaaagcctttctactgacaaa
tttcaagtatttctggatagttccaccagtaaaaatggagaaccaggaatgatacggtct
tccccttcacagtcccggtcgttagatactaagtggtatgtacacagctgcccaaggagt
cttcaggacactaactgcccatctcagaaggagctcactaaggttgtctgtatggaggag
caacaaccaactgagtcagaagcaagagatctcatggagcaatcttatttgtcaagacca
gatctggagggagccccttacctcgaatctggaatcagccttttctctgatgaccctgag
tctgatccctcgtcacacagagcctcagagctggttcatgttagcagcatgccaacttca
acctctgcgttgaaattaccccaatttcaggtcaaagaatcaggcaagagtacagctgtc
catattgctagtactgctgggtataataagagcgaatacagtgtgagcagagaaaagcca
gaagtgatgtcttcaacaagaggagtcaacaaaagaatatctatggtggcatcaggcttg
accccaaaagaatttatgcttgtgcacaagtttgccagaaaacaccacatcactttaact
aatctaatatctgaagagacaacacatgtcattatgaaaacagatgctgagtttgtgtgc
gaacgaacactgaaatattttctgggtattgcaggaggaaaatgggtagttagctatttc
tgggtaacccagtctattaaagaaagaaagatactagatgagcatgattttgaagtcaga
ggagatgttgtgaatggaagaaatcaccagggtccgaagcgagcaagagaatcccaggac
agagaatcccaagacagaaagatcttcaggggcctagaaatctgttgctatggacccttt
accaacatgcccacagatcaattagagtggatggtgcacctctgtggggcttctgtggtg
aaggagccttcgttattcaccctcagcaagggcactcatccagtggtagtcgtgcagccg
gatgcctggacagaggacagtggcttccatgcgattgggcagatgtgtgaggcacctgtg
gtgacccgagagtgggtactggacagtgtagccctctaccagtgccagaagctggacacc
tacctgatcccacagattcccagagctgctgcagactccagccagccatgcgtgtaa

DBGET integrated database retrieval system