KEGG   Vulpes vulpes (red fox): 112910878
Entry
112910878         CDS       T05911                                 

Definition
(RefSeq) cyclin-G1
  KO
K10145  cyclin G1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04115  p53 signaling pathway
vvp05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112910878
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    112910878
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 112910878
NCBI-ProteinID: XP_025842977
UniProt: A0A3Q7RBQ6
LinkDB
Position
Unknown
AA seq 295 aa
MIEVLTTTESQKLLHQLNALLEQESRCQPKVCSLRLIESAHDNGLRMTARLRDFEVKDLL
SLTQFFGFDTETFSLAVNLLDRFLSKMKVQPKHLGCVGLSCFYLAVKSIEEERNVPLATD
LIRISQYRFTVSDLMRMEKIVSEKVCWKVKATTAFQFLQLYYSLIQENLPIERKNSLNFE
RLEAQLKACHCRIIFSKAKPSVLALSIIALEIQAQKFVELTEGIECLQTHSKINGRDLTF
WQELVSKCLTEYSSNKCSKPNVQKLKWIVSGRTARQLKHSYYRITHLPTIPEVVP
NT seq 888 nt   +upstreamnt  +downstreamnt
atgatagaagtactgacaacaactgaatctcagaaactgctacaccagctgaatgcccta
ttggaacaggagtccagatgtcagccaaaggtctgcagcttgagactaattgaatctgca
cacgataatggcctcagaatgactgcaagactaagggactttgaagtaaaagatcttctt
agtctaactcagttctttggctttgacacggagacattttctctagctgtgaatttactg
gacagattcctgtccaaaatgaaggtacagcccaagcaccttggctgtgttgggctgagc
tgcttctatttggctgttaaatcaatagaagaggaaaggaatgtcccattggcaactgac
ttgatccgaataagccagtataggttcacagtttcagacttgatgagaatggaaaagatt
gtatcggagaaagtgtgttggaaagtcaaagctactactgcctttcaatttctgcaactc
tactactcacttattcaagagaacttaccaattgaaaggaagaatagccttaattttgaa
agactagaagctcaacttaaggcatgccactgcaggatcatattttctaaagcaaagcct
tctgtgttggcattgtctatcattgcactggagatccaagcacagaagtttgtagagtta
actgaaggaatagaatgtcttcagacacattccaagataaatggcagagatttgaccttc
tggcaagaacttgtatccaagtgtttaactgaatattcatcaaacaagtgttccaaacca
aatgttcagaagttgaaatggattgtttctggacgtactgcacggcaattgaagcatagt
tactacagaataacccaccttccaacaattcctgaagtggtcccttaa

KEGG   Vulpes vulpes (red fox): 112919717
Entry
112919717         CDS       T05911                                 

Gene name
CCNG2
Definition
(RefSeq) cyclin-G2
  KO
K10146  cyclin G2
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04068  FoxO signaling pathway
vvp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112919717 (CCNG2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112919717 (CCNG2)
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 112919717
NCBI-ProteinID: XP_025854011
UniProt: A0A3Q7SFJ3
LinkDB
Position
Unknown
AA seq 343 aa
MKDLGAEYLAGREGVQLFGLLNLYLEQEQRFQPREKGLSLIEATPEDDNTLCPRLRNAKV
EDLRSLTNFFGSCTETFVLAVNILDRFLALMKVKPKHLSCIGVCCFLLAARIVEEECNIP
STHDVIRISQCKCTASDIKRMEKIISEKLHYELEATTALNFLHLYHTIVLCHTSERKEIL
SLDKLEAQLKACNCRLTFSKAKPSVLALCLLNLEVETLKSIELLEILLLVKKHSKVNDTE
FIYWRELVSKCLAEYSSPECCKPDHKKLVWIVSRRTAQSLHNSYYSVPELPTIPEGGCFD
ESESEDSCEDMSCEESLSSSPSSDQECTFFFNFKVAQTLCFPS
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgaaggatttgggggcagagtatttggcaggtcgtgaaggggtccagctcttcggattg
ttgaacctctacctagagcaggaacagagattccaacctcgagaaaaagggctgagcttg
atcgaggctaccccggaggatgataacactttgtgtccaagactgagaaatgctaaagta
gaagatctaaggagtttaaccaacttttttggatcttgcactgagacttttgtcttggct
gtcaatattctggacagattcttggctcttatgaaggtgaaacctaaacatttgtcttgc
attggagtctgttgttttttgctggctgctagaatagttgaagaagaatgcaatattcca
tccactcatgatgtaatccggattagtcaatgtaaatgcactgcttctgacataaaacgg
atggaaaaaataatttcagaaaaattgcactatgaattggaagcaactactgccttaaac
tttttgcacttataccatactattgtactttgtcatacatcagaaaggaaagaaatacta
agtctagataaactagaagctcaactgaaagcttgcaactgccgacttaccttttcaaaa
gcaaaaccatctgtgttagctttgtgccttctcaatttggaagtagaaactttgaaatcc
attgaattactggaaattcttctgcttgttaaaaaacattccaaggttaatgacaccgag
ttcatttattggagggagttagtttctaaatgcctagccgaatattcttctcctgaatgt
tgcaaaccagatcataagaaattggtttggattgtttcaaggcgcacagcccagagcctc
cacaacagctactatagtgttcctgagctgccaacgataccagaggggggttgttttgat
gaaagtgaaagtgaggactcttgtgaagatatgagttgtgaagagagtctcagcagctct
ccttccagtgatcaagagtgcactttctttttcaacttcaaagtggcacagacactgtgc
tttccatcttag

KEGG   Vulpes vulpes (red fox): 112926540
Entry
112926540         CDS       T05911                                 

Gene name
CCNG1
Definition
(RefSeq) cyclin-G1
  KO
K10145  cyclin G1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04115  p53 signaling pathway
vvp05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112926540 (CCNG1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    112926540 (CCNG1)
SSDB
Motif
Pfam: Cyclin_N
Other DBs
NCBI-GeneID: 112926540
NCBI-ProteinID: XP_025863385
UniProt: A0A3Q7U7K7
LinkDB
Position
Unknown
AA seq 295 aa
MIEVLTTTESQKLLHQLNALLEQESRCQPKVCSLRLIESAHDNGLRMTARLRDFEVKDLL
SLTQFFGFDTETFSLAVNLLDRFLSKMKVQPKHLGCVGLSCFYLAVKSIEEERNVPLATD
LIRISQYRFTVSDLMRMEKIVLEKVCWKVKATTAFQFLQLYYSLIQENLPIERKNSLNFE
RLEAQLKACHCRIIFSKAKPSVLALSIIALEIQAQKFVELTEGIECLQTHSKINGRDLTF
WQELVSKCLTEYSSNKCSKPNVQKLKWIVSGRTAWQLKHTYYRITHLPTIPEMVP
NT seq 888 nt   +upstreamnt  +downstreamnt
atgatagaagtactgacaacaactgaatctcagaaactgctacaccagctgaatgcccta
ttggaacaggagtccagatgtcagccaaaggtctgcagcttgagactaattgaatctgca
cacgataatggcctcagaatgactgcaagactaagggactttgaagtaaaagatcttctt
agtctaactcagttctttggctttgacacggagacattttctctagctgtgaatttactg
gacagattcctgtccaaaatgaaggtacagcccaagcaccttggctgtgttgggctgagc
tgcttctatttggctgttaaatcaatagaagaggaaaggaatgtcccattggcaactgac
ttgatccgaataagccagtataggttcacggtttcagacttgatgagaatggaaaagatt
gtattggagaaagtgtgttggaaagtcaaagctactactgcctttcaatttctgcaactc
tactactcacttattcaagagaacttaccaattgaaaggaagaatagccttaattttgaa
agactagaagctcaacttaaggcatgccactgcaggatcatattttctaaagcaaagcct
tctgtgttggcattgtctatcattgcactggagatccaagcacagaagtttgtagagtta
actgaaggaatagaatgtcttcagacacattccaagataaatggcagagatttgaccttc
tggcaagaacttgtatccaagtgtttaactgaatattcatcaaacaagtgttccaaacca
aatgttcagaagttgaaatggattgtttctggacgtactgcatggcaattgaagcatact
tactacagaataacccaccttccaacaattcctgaaatggtcccttaa

DBGET integrated database retrieval system