KEGG   Vulpes vulpes (red fox): 112911060
Entry
112911060         CDS       T05911                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04014  Ras signaling pathway
vvp04390  Hippo signaling pathway
vvp04392  Hippo signaling pathway - multiple species
vvp05200  Pathways in cancer
vvp05206  MicroRNAs in cancer
vvp05219  Bladder cancer
vvp05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    112911060 (RASSF1)
   04390 Hippo signaling pathway
    112911060 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    112911060 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112911060 (RASSF1)
   05206 MicroRNAs in cancer
    112911060 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    112911060 (RASSF1)
   05223 Non-small cell lung cancer
    112911060 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1
Other DBs
NCBI-GeneID: 112911060
NCBI-ProteinID: XP_025843177
UniProt: A0A3Q7RC71
LinkDB
Position
Unknown
AA seq 340 aa
MSTEPELIELRELEPARRGGPGRSRLERANALRIAPGTARNPARQLVAGRGHHFQPAGPA
THTWCDLCGDFIWGVVRKGLQCAHCKFTCHYRCRALVCLDCCGPRDLGWEPALERDTNVD
EPAEWEIPDLSQAEVEQKIKEYNSQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSK
KPPSLQDVRRGPGRGTAVKRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPR
KFALFERAERHGQVYLRKLSDDEQPLRLRLLAGPSEKALSFVLKENDSGEVNWDAFSMPE
LHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 1023 nt   +upstreamnt  +downstreamnt
atgtccaccgaacccgagctcattgaactgagggaactggagcccgcgcggcgcggaggt
ccgggccgcagccggctggagcgagcgaacgcgctgcgcatcgcaccggggaccgcgcgc
aatccggcacggcagctggtcgcgggccgcggccaccacttccaacctgcggggcccgcc
acgcacacgtggtgcgacctttgcggcgacttcatctggggcgtcgtgcgcaagggcctg
cagtgcgcgcattgcaagttcacatgccactaccgttgccgcgcgcttgtctgcctggac
tgctgcgggccccgggacctgggctgggaacctgcgctggagcgggacacgaacgtggat
gagcctgcggagtgggagatacctgacctttctcaggctgaggttgagcagaagataaag
gaatacaatagccagatcaacagcaacctcttcatgagcctgaacaaggatggctcctac
acaggcttcatcaaggttcaactgaagctggtgcgccctgtctcagtgccctccagcaag
aagccaccatccttgcaggatgtgaggcggggcccagggcgaggcacagctgtgaagcgt
cgcacctccttctacctgcccaaggatgctgtcaagcacctgcatgtgttgtcacgcacg
cgggcacgtgaggtcattgaggccctacttcgcaaattcttggtggtggatgacccccgc
aagtttgcactctttgagcgggctgagcgccatggccaagtgtacctccggaagctgtcg
gatgatgaacagcccctgcgtctgcggctccttgcagggcccagcgagaaggccctaagc
tttgtcctcaaggagaatgactctggggaggtgaattgggatgcctttagcatgcctgaa
ctacacaacttcctgcgcatccttcagcgggaggaagaggagcacctccgccagatcctg
caaaagtactcttattgccgtcagaagatccaggaagcccttcacgcctgccccctgggg
tga

DBGET integrated database retrieval system