KEGG   Vulpes vulpes (red fox): 112911512
Entry
112911512         CDS       T05911                                 

Gene name
IKBKG
Definition
(RefSeq) NF-kappa-B essential modulator isoform X1
  KO
K07210  inhibitor of nuclear factor kappa-B kinase subunit gamma
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01523  Antifolate resistance
vvp04010  MAPK signaling pathway
vvp04014  Ras signaling pathway
vvp04062  Chemokine signaling pathway
vvp04064  NF-kappa B signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04210  Apoptosis
vvp04380  Osteoclast differentiation
vvp04620  Toll-like receptor signaling pathway
vvp04621  NOD-like receptor signaling pathway
vvp04622  RIG-I-like receptor signaling pathway
vvp04623  Cytosolic DNA-sensing pathway
vvp04625  C-type lectin receptor signaling pathway
vvp04657  IL-17 signaling pathway
vvp04658  Th1 and Th2 cell differentiation
vvp04659  Th17 cell differentiation
vvp04660  T cell receptor signaling pathway
vvp04662  B cell receptor signaling pathway
vvp04668  TNF signaling pathway
vvp04920  Adipocytokine signaling pathway
vvp05132  Salmonella infection
vvp05135  Yersinia infection
vvp05142  Chagas disease
vvp05145  Toxoplasmosis
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
vvp05212  Pancreatic cancer
vvp05215  Prostate cancer
vvp05220  Chronic myeloid leukemia
vvp05221  Acute myeloid leukemia
vvp05222  Small cell lung cancer
vvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
vvp05340  Primary immunodeficiency
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112911512 (IKBKG)
   04014 Ras signaling pathway
    112911512 (IKBKG)
   04064 NF-kappa B signaling pathway
    112911512 (IKBKG)
   04668 TNF signaling pathway
    112911512 (IKBKG)
   04151 PI3K-Akt signaling pathway
    112911512 (IKBKG)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112911512 (IKBKG)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    112911512 (IKBKG)
   04621 NOD-like receptor signaling pathway
    112911512 (IKBKG)
   04622 RIG-I-like receptor signaling pathway
    112911512 (IKBKG)
   04623 Cytosolic DNA-sensing pathway
    112911512 (IKBKG)
   04625 C-type lectin receptor signaling pathway
    112911512 (IKBKG)
   04660 T cell receptor signaling pathway
    112911512 (IKBKG)
   04658 Th1 and Th2 cell differentiation
    112911512 (IKBKG)
   04659 Th17 cell differentiation
    112911512 (IKBKG)
   04657 IL-17 signaling pathway
    112911512 (IKBKG)
   04662 B cell receptor signaling pathway
    112911512 (IKBKG)
   04062 Chemokine signaling pathway
    112911512 (IKBKG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    112911512 (IKBKG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112911512 (IKBKG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112911512 (IKBKG)
   05203 Viral carcinogenesis
    112911512 (IKBKG)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112911512 (IKBKG)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    112911512 (IKBKG)
   05221 Acute myeloid leukemia
    112911512 (IKBKG)
   05220 Chronic myeloid leukemia
    112911512 (IKBKG)
   05215 Prostate cancer
    112911512 (IKBKG)
   05222 Small cell lung cancer
    112911512 (IKBKG)
  09163 Immune disease
   05340 Primary immunodeficiency
    112911512 (IKBKG)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112911512 (IKBKG)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112911512 (IKBKG)
   05135 Yersinia infection
    112911512 (IKBKG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112911512 (IKBKG)
   05170 Human immunodeficiency virus 1 infection
    112911512 (IKBKG)
   05162 Measles
    112911512 (IKBKG)
   05164 Influenza A
    112911512 (IKBKG)
   05161 Hepatitis B
    112911512 (IKBKG)
   05160 Hepatitis C
    112911512 (IKBKG)
   05168 Herpes simplex virus 1 infection
    112911512 (IKBKG)
   05163 Human cytomegalovirus infection
    112911512 (IKBKG)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112911512 (IKBKG)
   05169 Epstein-Barr virus infection
    112911512 (IKBKG)
   05165 Human papillomavirus infection
    112911512 (IKBKG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112911512 (IKBKG)
   05142 Chagas disease
    112911512 (IKBKG)
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    112911512 (IKBKG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112911512 (IKBKG)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: Other
  IKK family [OT]
   112911512 (IKBKG)
SSDB
Motif
Pfam: CC2-LZ NEMO zf_C2H2_10 Filament LLC1
Other DBs
NCBI-GeneID: 112911512
NCBI-ProteinID: XP_025843886
UniProt: A0A3Q7RNR1
LinkDB
Position
Unknown
AA seq 457 aa
MFTRAQTFSVTRGWMSPPGMFEEQQGDHYSWSRTLTCWMSRAPWKSQPSEMVQPSGGPAG
DQDVLGEESSLGKPAMLHLPSEQGTPETYQRCLEENQELRDAIRQSNQMLRERCEELQRF
QGSQRKEKEFLMQKFQEARKLVERLSLEKLDLRTQREQALQEVEHLKRCQQQMAEDKASV
KAQVTSLLGELQESQSRLEAATKERQALEGRARAASEQARQLESEREALQQQHSVQVDQL
RMQSQSVEAALRMERQAASEEKRKLAQLQVAYHQLFQEYDNHIKSSMVSSERNRGMQLED
LKQQLQQAEEALVAKQEVIDKLKEEAEQHKIVMETVPVLKAQADIYKADFQAERQAREKL
AEKKEILQDQLEQLQREYSRLKASCQESARIEDLRKRHVEVSQAPLPVTPVHASFHVPVS
IQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgtttacccgagctcagaccttttctgtgacccgaggatggatgagccctcctggtatg
ttcgaggaacagcaaggagaccactatagctggagcagaaccctgacttgttggatgagc
agggccccctggaagagtcagccaagtgagatggtgcagcccagtggcggcccggccggg
gaccaggacgtgctgggtgaagagtcttctttggggaagccagctatgctccacctacct
tctgagcagggcactcctgagacctaccaacgctgtctggaggagaatcaagagctccga
gatgccatccggcagagcaaccagatgctccgggagcgctgtgaggagctgcagcgtttc
cagggcagccagaggaaggagaaggagttcctcatgcagaagttccaggaagccaggaaa
ctggtggagagactgagtctggagaagctcgacctgaggacgcagagggagcaggccctg
caggaggtggaacacctgaagcgatgtcagcagcagatggctgaagacaaggcttccgtg
aaagcccaggtgacgtccctgctgggggagctccaggagagccagagtcgtttggaggcc
gccaccaaggagcggcaggctttggagggcagggcccgggctgccagcgagcaggcccgg
cagctggagagtgagcgggaggcgctgcagcagcagcacagcgtgcaggtggaccagctg
cgcatgcagagccagagcgtggaggcggccctgcgcatggagcgccaggctgcctcggag
gagaagcggaagctggcccagctacaggtggcctatcaccagctcttccaggagtatgac
aaccacatcaagagcagcatggtgagcagcgagcgaaaccgaggaatgcagctggaggat
ctcaagcagcagctccagcaggccgaggaggccctggtggccaaacaggaagtgatcgac
aagctgaaggaagaggctgagcagcacaagatcgtgatggagaccgtccctgtgctaaag
gctcaggcggatatctacaaggccgacttccaggccgagaggcaggcccgggagaagctg
gccgagaagaaggagatcctgcaggatcagctggagcagctgcagagggagtacagcagg
ctgaaggccagctgtcaggagtcggccaggattgaagatctgaggaagcggcacgtggag
gtctcccaggctcccttacctgtcaccccagttcacgcctcctttcacgtgcccgtgtcc
atccagaggagaagcccccctgaggagccgccggacttctgctgccccaagtgccagtat
caggcccctgatatggacaccctgcagatacacgtcatggagtgcatcgagtag

DBGET integrated database retrieval system