KEGG   Vulpes vulpes (red fox): 112911519
Entry
112911519         CDS       T05911                                 

Gene name
RHOA
Definition
(RefSeq) transforming protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04022  cGMP-PKG signaling pathway
vvp04024  cAMP signaling pathway
vvp04062  Chemokine signaling pathway
vvp04071  Sphingolipid signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04144  Endocytosis
vvp04150  mTOR signaling pathway
vvp04270  Vascular smooth muscle contraction
vvp04310  Wnt signaling pathway
vvp04350  TGF-beta signaling pathway
vvp04360  Axon guidance
vvp04510  Focal adhesion
vvp04520  Adherens junction
vvp04530  Tight junction
vvp04611  Platelet activation
vvp04621  NOD-like receptor signaling pathway
vvp04625  C-type lectin receptor signaling pathway
vvp04660  T cell receptor signaling pathway
vvp04670  Leukocyte transendothelial migration
vvp04722  Neurotrophin signaling pathway
vvp04810  Regulation of actin cytoskeleton
vvp04921  Oxytocin signaling pathway
vvp04928  Parathyroid hormone synthesis, secretion and action
vvp04972  Pancreatic secretion
vvp05100  Bacterial invasion of epithelial cells
vvp05132  Salmonella infection
vvp05133  Pertussis
vvp05135  Yersinia infection
vvp05152  Tuberculosis
vvp05163  Human cytomegalovirus infection
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05210  Colorectal cancer
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    112911519 (RHOA)
   04015 Rap1 signaling pathway
    112911519 (RHOA)
   04310 Wnt signaling pathway
    112911519 (RHOA)
   04350 TGF-beta signaling pathway
    112911519 (RHOA)
   04072 Phospholipase D signaling pathway
    112911519 (RHOA)
   04071 Sphingolipid signaling pathway
    112911519 (RHOA)
   04024 cAMP signaling pathway
    112911519 (RHOA)
   04022 cGMP-PKG signaling pathway
    112911519 (RHOA)
   04150 mTOR signaling pathway
    112911519 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112911519 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112911519 (RHOA)
   04520 Adherens junction
    112911519 (RHOA)
   04530 Tight junction
    112911519 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112911519 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112911519 (RHOA)
   04621 NOD-like receptor signaling pathway
    112911519 (RHOA)
   04625 C-type lectin receptor signaling pathway
    112911519 (RHOA)
   04660 T cell receptor signaling pathway
    112911519 (RHOA)
   04670 Leukocyte transendothelial migration
    112911519 (RHOA)
   04062 Chemokine signaling pathway
    112911519 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    112911519 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    112911519 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    112911519 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    112911519 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112911519 (RHOA)
  09158 Development and regeneration
   04360 Axon guidance
    112911519 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112911519 (RHOA)
   05206 MicroRNAs in cancer
    112911519 (RHOA)
   05205 Proteoglycans in cancer
    112911519 (RHOA)
   05203 Viral carcinogenesis
    112911519 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112911519 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112911519 (RHOA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112911519 (RHOA)
   05135 Yersinia infection
    112911519 (RHOA)
   05133 Pertussis
    112911519 (RHOA)
   05152 Tuberculosis
    112911519 (RHOA)
   05100 Bacterial invasion of epithelial cells
    112911519 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    112911519 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvp04131]
    112911519 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vvp04147]
    112911519 (RHOA)
   04031 GTP-binding proteins [BR:vvp04031]
    112911519 (RHOA)
Membrane trafficking [BR:vvp04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    112911519 (RHOA)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112911519 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   112911519 (RHOA)
  Exosomal proteins of colorectal cancer cells
   112911519 (RHOA)
  Exosomal proteins of bladder cancer cells
   112911519 (RHOA)
GTP-binding proteins [BR:vvp04031]
 Small (monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    112911519 (RHOA)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Other DBs
NCBI-GeneID: 112911519
NCBI-ProteinID: XP_025843898
UniProt: A0A3Q7RF03
LinkDB
Position
Unknown
AA seq 193 aa
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt   +upstreamnt  +downstreamnt
atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggtaagacttgt
ttgctcatcgtctttagcaaggaccagttcccagaggtgtatgtacccacagtgtttgag
aactatgtggcagatattgaagttgatggaaagcaggtagagttggctttgtgggataca
gctgggcaggaagattatgatcgtttgaggcctctctcctatccagacactgatgttata
ctgatgtgtttctctattgacagccctgatagcttagaaaacatcccagaaaaatggacc
ccagaagtcaagcacttctgtcccaacgtgcccatcatcctggttgggaacaagaaggat
cttcggaatgatgagcacacaaggcgggagctagccaagatgaagcaggagccggtgaaa
ccggaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagctgctctgcaa
gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system