KEGG   Vulpes vulpes (red fox): 112911644
Entry
112911644         CDS       T05911                                 

Gene name
CDKN2A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 2A isoform X1
  KO
K06621  cyclin-dependent kinase inhibitor 2A
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01522  Endocrine resistance
vvp01524  Platinum drug resistance
vvp04110  Cell cycle
vvp04115  p53 signaling pathway
vvp04218  Cellular senescence
vvp04934  Cushing syndrome
vvp05163  Human cytomegalovirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
vvp05206  MicroRNAs in cancer
vvp05212  Pancreatic cancer
vvp05214  Glioma
vvp05218  Melanoma
vvp05219  Bladder cancer
vvp05220  Chronic myeloid leukemia
vvp05223  Non-small cell lung cancer
vvp05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112911644 (CDKN2A)
   04115 p53 signaling pathway
    112911644 (CDKN2A)
   04218 Cellular senescence
    112911644 (CDKN2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112911644 (CDKN2A)
   05206 MicroRNAs in cancer
    112911644 (CDKN2A)
   05203 Viral carcinogenesis
    112911644 (CDKN2A)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    112911644 (CDKN2A)
   05225 Hepatocellular carcinoma
    112911644 (CDKN2A)
   05214 Glioma
    112911644 (CDKN2A)
   05220 Chronic myeloid leukemia
    112911644 (CDKN2A)
   05218 Melanoma
    112911644 (CDKN2A)
   05219 Bladder cancer
    112911644 (CDKN2A)
   05223 Non-small cell lung cancer
    112911644 (CDKN2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112911644 (CDKN2A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112911644 (CDKN2A)
   05163 Human cytomegalovirus infection
    112911644 (CDKN2A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112911644 (CDKN2A)
   01522 Endocrine resistance
    112911644 (CDKN2A)
SSDB
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank
Other DBs
NCBI-GeneID: 112911644
NCBI-ProteinID: XP_025844079
UniProt: A0A3Q7SPP0
LinkDB
Position
Unknown
AA seq 110 aa
MMMGSTRVAQLLLLHGADPNCADPATLTRPVHDAAREGFLDTVVVLHRAGARLDVRDAWG
RLPVDLAEERGHGAVAAYLRAAEGGTESGSHARTEGAEGHAARTSRIIEL
NT seq 333 nt   +upstreamnt  +downstreamnt
atgatgatgggcagcacccgcgtggcccagctgctgctgctccacggcgccgaccccaac
tgtgccgaccccgccaccctcacccgccctgtgcacgacgcggcccgggagggcttcctg
gacacggtggtggtgctgcaccgagccggggcgcggctggacgtgcgcgatgcctggggc
cgcctgcccgtggacctggctgaggagcggggccacggcgctgtcgctgcgtacctgcgc
gcagccgaggggggcaccgaaagtggtagccacgcccgtaccgaaggtgcggaaggtcac
gcagcccggacttcaagaatcattgagctctaa

DBGET integrated database retrieval system