KEGG   Vulpes vulpes (red fox): 112911890
Entry
112911890         CDS       T05911                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2-like
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp00562  Inositol phosphate metabolism
vvp01100  Metabolic pathways
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp04012  ErbB signaling pathway
vvp04014  Ras signaling pathway
vvp04020  Calcium signaling pathway
vvp04062  Chemokine signaling pathway
vvp04064  NF-kappa B signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04070  Phosphatidylinositol signaling system
vvp04072  Phospholipase D signaling pathway
vvp04360  Axon guidance
vvp04370  VEGF signaling pathway
vvp04380  Osteoclast differentiation
vvp04611  Platelet activation
vvp04625  C-type lectin receptor signaling pathway
vvp04650  Natural killer cell mediated cytotoxicity
vvp04662  B cell receptor signaling pathway
vvp04664  Fc epsilon RI signaling pathway
vvp04666  Fc gamma R-mediated phagocytosis
vvp04670  Leukocyte transendothelial migration
vvp04722  Neurotrophin signaling pathway
vvp04750  Inflammatory mediator regulation of TRP channels
vvp04919  Thyroid hormone signaling pathway
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04935  Growth hormone synthesis, secretion and action
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05169  Epstein-Barr virus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05171  Coronavirus disease - COVID-19
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05214  Glioma
vvp05223  Non-small cell lung cancer
vvp05225  Hepatocellular carcinoma
Module
vvp_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112911890
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112911890
   04014 Ras signaling pathway
    112911890
   04370 VEGF signaling pathway
    112911890
   04064 NF-kappa B signaling pathway
    112911890
   04066 HIF-1 signaling pathway
    112911890
   04020 Calcium signaling pathway
    112911890
   04070 Phosphatidylinositol signaling system
    112911890
   04072 Phospholipase D signaling pathway
    112911890
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112911890
   04625 C-type lectin receptor signaling pathway
    112911890
   04650 Natural killer cell mediated cytotoxicity
    112911890
   04662 B cell receptor signaling pathway
    112911890
   04664 Fc epsilon RI signaling pathway
    112911890
   04666 Fc gamma R-mediated phagocytosis
    112911890
   04670 Leukocyte transendothelial migration
    112911890
   04062 Chemokine signaling pathway
    112911890
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    112911890
   04919 Thyroid hormone signaling pathway
    112911890
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112911890
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112911890
  09158 Development and regeneration
   04360 Axon guidance
    112911890
   04380 Osteoclast differentiation
    112911890
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112911890
   05206 MicroRNAs in cancer
    112911890
   05205 Proteoglycans in cancer
    112911890
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112911890
   05214 Glioma
    112911890
   05223 Non-small cell lung cancer
    112911890
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112911890
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112911890
   05171 Coronavirus disease - COVID-19
    112911890
   05167 Kaposi sarcoma-associated herpesvirus infection
    112911890
   05169 Epstein-Barr virus infection
    112911890
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112911890
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvp04131]
    112911890
Enzymes [BR:vvp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     112911890
Membrane trafficking [BR:vvp04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    112911890
 Endocytosis
  Macropinocytosis
   Phospholipase C
    112911890
SSDB
Motif
Pfam: PI-PLC-X SH2 PH PH_12 PH_14 GDPD EF-hand_like
Other DBs
NCBI-GeneID: 112911890
NCBI-ProteinID: XP_025844363
UniProt: A0A3Q7RGE6
LinkDB
Position
Unknown
AA seq 867 aa
MTALVHVDSLPEYEKSQIKRALELGTVMTVFSFRKSTPERRTVQVIMETRQVAWSKTADK
IEGFLDIMEIKEIRPGKNSKDFERAKAVRQKEECCFTILYGTQFVLSTLSLAADSKEDAN
KWLSGLKILHQEAMSASTPTIIESWLRKQIYSVDQTRRNSISLRELKTILPLVNFKVNSA
KFLKDKFVEIGAHKDELSFEQFHLFYKKLMFEQQKSILDEFKKDSSVFILGNTDRPDASA
VHLHDFQRFLLHEQQELWAQDLNKVRARMTKFIDDTMRETAEPFLFVDEFLTYLFSRENS
IWDEKYDVVDMQDMNNPLSHYWISSSHNTYLTGDQLRSESSTEAYIRCLRMGCRCIELDC
WDGPDGKPIIYHGWTRTTKIKFDDVVQAIKDHAFVTSSFPVILSIEEHCCVEQQRHMARV
FKEVFGDQLLTKPTEASADQLPSPSQLREKIIIKHKKLGPRGDVDVNMEDKKDEHKQQGE
LYMWDSIDQKWTRHYCAIADAKLSFSDDIEQTAEEELPQDIPPTELHFGEEWFHKKVEKR
TSAEKLLQEYCAETGGKDGTFLVRESKTFPNDYTLSFWRSGRVQHCRIRSTVEGGTMKYF
LTDNVTFTSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESKPWYYDGLSRGEAEDML
MRVPRDGAFLIRRREGTDSYAITFRARGKVKHCRIHRDGRHFVLGTSAYFESLVELVSYY
EKHALYRKMRLRYPVTPELLERYNMHLPTKALQCPLFSSRWKGDYGTRIQQYFPSNYVED
ISTVDVEELEKQIIEDNPLGSLCRGILDLNTYNVVKAPQGKNQKPFVFILEPKKQGDPPV
EFATDKVEELFEWFQSIREITWKIDTK
NT seq 2601 nt   +upstreamnt  +downstreamnt
atgactgccctggtccacgtggacagccttccggaatacgagaagagtcagatcaagaga
gccctagagctgggcacggtgatgacggtgttcagcttccgcaagtccaccccagagcgg
aggaccgtccaggtgatcatggagacgcgccaggtggcctggagcaagacagccgacaag
atcgagggcttcttggatatcatggaaatcaaggaaatccgcccagggaagaactccaag
gattttgagcgtgccaaagcagtccgccagaaggaagagtgctgttttaccatcttgtac
ggcacccagtttgttctgagcacactcagtctggcagctgactctaaagaagatgcgaat
aagtggctctctggcttgaaaatcttacaccaggaagcgatgagtgcatctacacccacc
attattgagagttggctgagaaagcagatttattcagtggaccaaaccagaagaaacagc
atcagcctccgagagttgaagaccatcttacccctggtcaactttaaggtgaacagtgcc
aagttcctcaaagataagtttgtggaaattggtgcacacaaagatgagctcagctttgag
cagttccacctgttctataaaaaacttatgtttgagcagcaaaagtcgattcttgatgaa
ttcaaaaaagattcttccgtgttcatcttgggcaacactgaccggccggacgcctctgct
gttcacctgcacgacttccagcgctttctcttacatgagcaacaggagctttgggctcag
gatctgaacaaagtccgtgcgcggatgacaaagtttatcgatgacaccatgagggaaacg
gccgagcccttcttgtttgtcgatgagttcctcacgtatctgttttcgcgggagaacagc
atctgggatgagaagtacgacgtggtggacatgcaggacatgaacaaccccttgtcccat
tactggatctcctcttcgcataacacgtacctcactggtgaccagctacggagtgagtca
tccacagaagcgtacatccgttgcctgcggatgggctgtcgctgcattgagttggactgc
tgggacgggcccgacgggaagcccatcatctaccacggctggacacggaccaccaagatc
aagtttgatgacgttgtgcaggccatcaaagaccatgcctttgtcacttcaagcttcccc
gtgatcctgtccatcgaggagcactgttgcgtggagcagcagcgccacatggccagggtg
ttcaaggaggtgtttggcgaccagctgctgacgaagcccacagaggccagtgctgaccag
ctgccctcccccagccagttgcgggagaagatcatcatcaagcataagaagctgggtccc
cgaggggacgtggatgtcaacatggaggacaagaaagatgagcacaagcaacagggtgaa
ctgtatatgtgggattccatcgaccagaaatggactcgacactactgtgccatcgccgat
gccaaactgtctttcagcgatgacattgagcagactgcagaagaggagctgccccaggac
ataccccccacggagctgcattttggggaggagtggttccacaagaaagtagagaagagg
acgagtgccgagaagctgctgcaggaatactgtgcagagaccgggggcaaggatgggact
ttccttgtgcgggagagcaagaccttccccaatgactacaccctgtccttctggcggtcg
ggccgtgtccagcactgccggatccgttccaccgtggaggggggcaccatgaagtacttc
ctgactgacaacgtcacgttcaccagcatctacgccctcatccagcactaccgcgagacc
cacctgcgctgcgccgagttcgagctgcggctcaccgaccctgtgcccaaccccaacccc
cacgagtccaagccgtggtactacgacgggctgagccgtggggaggcagaggacatgcta
atgagggtgccccgggacggcgccttcctgatccggaggcgagaaggtaccgactcctat
gccatcaccttcagggccaggggcaaggtgaagcactgccgcattcaccgggatggccgg
cactttgtgctggggacctctgcctacttcgagagcctcgtggagctagtcagctactac
gaaaagcacgcgctctaccgaaaaatgcgactgcgctaccccgtgacgcctgagctcctg
gagcgctacaatatgcacctgcccacgaaggccctccagtgccctctgttttcatctagg
tggaagggggactatggaaccagaatccagcagtacttcccatccaattacgtcgaggac
atttcaacagtcgacgtggaggagctggagaagcagattattgaagacaatcccttaggg
tctctttgtaggggaatactggatctcaatacctataacgttgtgaaagccccccagggg
aaaaaccagaagccattcgtgtttatcctggagcccaagaagcaaggcgaccccccagta
gagtttgccacggacaaggtggaggagctctttgagtggtttcagagcatccgggagatc
acctggaagatagacaccaag

KEGG   Vulpes vulpes (red fox): 112912331
Entry
112912331         CDS       T05911                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2
  KO
K05859  phosphatidylinositol phospholipase C, gamma-2 [EC:3.1.4.11]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp00562  Inositol phosphate metabolism
vvp01100  Metabolic pathways
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp04012  ErbB signaling pathway
vvp04014  Ras signaling pathway
vvp04020  Calcium signaling pathway
vvp04062  Chemokine signaling pathway
vvp04064  NF-kappa B signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04070  Phosphatidylinositol signaling system
vvp04072  Phospholipase D signaling pathway
vvp04360  Axon guidance
vvp04370  VEGF signaling pathway
vvp04380  Osteoclast differentiation
vvp04611  Platelet activation
vvp04625  C-type lectin receptor signaling pathway
vvp04650  Natural killer cell mediated cytotoxicity
vvp04662  B cell receptor signaling pathway
vvp04664  Fc epsilon RI signaling pathway
vvp04666  Fc gamma R-mediated phagocytosis
vvp04670  Leukocyte transendothelial migration
vvp04722  Neurotrophin signaling pathway
vvp04750  Inflammatory mediator regulation of TRP channels
vvp04919  Thyroid hormone signaling pathway
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04935  Growth hormone synthesis, secretion and action
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05169  Epstein-Barr virus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05171  Coronavirus disease - COVID-19
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05214  Glioma
vvp05223  Non-small cell lung cancer
vvp05225  Hepatocellular carcinoma
Module
vvp_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112912331
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112912331
   04014 Ras signaling pathway
    112912331
   04370 VEGF signaling pathway
    112912331
   04064 NF-kappa B signaling pathway
    112912331
   04066 HIF-1 signaling pathway
    112912331
   04020 Calcium signaling pathway
    112912331
   04070 Phosphatidylinositol signaling system
    112912331
   04072 Phospholipase D signaling pathway
    112912331
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112912331
   04625 C-type lectin receptor signaling pathway
    112912331
   04650 Natural killer cell mediated cytotoxicity
    112912331
   04662 B cell receptor signaling pathway
    112912331
   04664 Fc epsilon RI signaling pathway
    112912331
   04666 Fc gamma R-mediated phagocytosis
    112912331
   04670 Leukocyte transendothelial migration
    112912331
   04062 Chemokine signaling pathway
    112912331
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    112912331
   04919 Thyroid hormone signaling pathway
    112912331
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112912331
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112912331
  09158 Development and regeneration
   04360 Axon guidance
    112912331
   04380 Osteoclast differentiation
    112912331
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112912331
   05206 MicroRNAs in cancer
    112912331
   05205 Proteoglycans in cancer
    112912331
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112912331
   05214 Glioma
    112912331
   05223 Non-small cell lung cancer
    112912331
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112912331
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112912331
   05171 Coronavirus disease - COVID-19
    112912331
   05167 Kaposi sarcoma-associated herpesvirus infection
    112912331
   05169 Epstein-Barr virus infection
    112912331
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112912331
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvp04131]
    112912331
Enzymes [BR:vvp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     112912331
Membrane trafficking [BR:vvp04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    112912331
 Endocytosis
  Macropinocytosis
   Phospholipase C
    112912331
SSDB
Motif
Pfam: PI-PLC-Y SH2 C2 SH3_1 SH3_9 SH3_2 PH
Other DBs
NCBI-GeneID: 112912331
NCBI-ProteinID: XP_025844837
UniProt: A0A3Q7RGJ6
LinkDB
Position
Unknown
AA seq 681 aa
HCRIRSTVEGGTMKYFLTDNVTFTSIYALIQHYRETHLRCAEFELRLTDPVPNPNPHESK
PWYYDGLSRGEAEDMLMRVPRDGAFLIRRREGTDSYAITFRARGKVKHCRIHRDGRHFVL
GTSAYFESLVELVSYYEKHALYRKMRLRYPVTPELLERYNMERDINSLYDVSRMYVDPSE
INPSMPQRTVKALYDYKAKRSDELSFCRGALIHNVSKEPWGWWKGDYGTRIQQYFPSNYV
EDISTVDVEELEKQIIEDNPLGSLCRGILDLNTYNVVKAPQGKNQKPFVFILEPKKQGDP
PVEFATDKVEELFEWFQSIREITWKIDTKENNMKYWEKNQSIAIELSDLVVYCKPTSKTK
DNLENPDFREIRSFVETKADSVVRQKPVDLLKYNQKGLTRVYPKGQRVDSSNYDPFRLWL
CGSQMVALNFQTPDKYMQMNHALFSLNGRTGYVLQPESMRTEKYDPMPPESQRKILMTLS
VKVLGARHLPKLGRSIACPFVEVEICGAEYDNNKFKTTVVNDNGLSPVWAPTQEKVTFEI
YDPNLAFLRFVVYEEDMFSDPNFLAHATYPIKGIKSGFRSVPLKNGYSEDIELASLLVFC
EMQPVLESEEELYSSCRQLRRRQEELNNQLFLYDTHQNLRNANRDALVKEFNVNENQLQL
YQEKCNRRLREKRVSNSRFYS
NT seq 2046 nt   +upstreamnt  +downstreamnt
cactgccggatccgttccaccgtggaggggggcaccatgaagtacttcctgactgacaac
gtcacgttcaccagcatctacgccctcatccagcactaccgcgagacccacctgcgctgc
gccgagttcgagctgcggctcaccgaccctgtgcccaaccccaacccccacgagtccaag
ccgtggtactacgacgggctgagccgtggggaggcagaggacatgctaatgagggtgccc
cgggacggcgccttcctgatccggaggcgagaaggtaccgactcctacgccatcaccttc
agggccaggggcaaggtgaagcactgccgcattcaccgggatggccggcactttgtgctg
gggacctctgcctacttcgagagcctcgtggagctagtcagctactacgaaaagcacgcg
ctctaccgaaaaatgcgactgcgctaccccgtgacgcctgagctcctggagcgctacaat
atggaaagagatataaactccctctatgacgtcagcagaatgtatgtggatcccagtgag
atcaatccttctatgcctcagaggaccgtgaaagctctgtatgactacaaagccaagcga
agcgatgagctgagtttctgccgtggggccctcattcacaacgtctcgaaggagccctgg
ggctggtggaagggggactatggaaccagaatccagcagtacttcccatccaattacgtc
gaggacatttcaacagtcgacgtggaggagctggagaagcagattattgaagacaatccc
ttagggtctctttgtaggggaatactggatctcaatacctataacgttgtgaaagccccc
caggggaaaaaccagaagccattcgtgtttatcctggagcccaagaagcaaggcgacccc
ccagtagagtttgccacggacaaggtggaggagctctttgagtggtttcagagcatccgg
gagatcacctggaagatagacaccaaggagaacaacatgaagtactgggagaagaaccag
tccattgccatcgagctctcggacctggtcgtctactgcaagccaaccagcaagaccaag
gacaatttagaaaaccctgacttccgagaaatccggtcctttgtggagacaaaggcagac
agtgttgtcagacagaaacctgttgacctcctgaagtacaatcagaagggcctgacccgt
gtttacccgaagggacagagggtggactcctccaactacgacccctttcgcctctggctg
tgcggctcccagatggtggcactcaatttccagactccagacaagtatatgcagatgaat
cacgccttgttctcactcaatgggcgaacgggctacgtcctacagcctgagagcatgagg
acggagaagtatgaccccatgccacctgagtcccagaggaagatcctgatgactctgtca
gtcaaggttcttggggctcgccatctccccaaacttggacgaagtatcgcgtgtcccttt
gtggaggtggaaatttgtggagctgaatatgacaacaacaagtttaagacaacagtcgtg
aatgacaatggcctaagccctgtttgggctccaacacaggagaaagtgacctttgaaatt
tacgaccccaacctggcgtttctgcgctttgtggtctacgaggaagatatgttcagtgac
cccaatttccttgctcacgccacttaccccatcaaaggaatcaaatcaggattcagatct
gttcctctgaagaacgggtacagtgaagacattgagctggcttccctcctggttttctgt
gagatgcagccagtcctggagagcgaagaggaactttattcctcctgtcgccagctgcga
aggcggcaggaagagctcaacaatcagctctttctgtacgacacacaccagaacttgcgc
aacgccaaccgggatgccctcgttaaagagttcaacgtcaacgagaaccagctccagctg
taccaggagaagtgcaaccggaggttgagagagaagcgagtcagcaacagcaggttttac
tcctag

KEGG   Vulpes vulpes (red fox): 112928123
Entry
112928123         CDS       T05911                                 

Gene name
PLCG1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 isoform X1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp00562  Inositol phosphate metabolism
vvp01100  Metabolic pathways
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp04012  ErbB signaling pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04020  Calcium signaling pathway
vvp04062  Chemokine signaling pathway
vvp04064  NF-kappa B signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04070  Phosphatidylinositol signaling system
vvp04072  Phospholipase D signaling pathway
vvp04360  Axon guidance
vvp04370  VEGF signaling pathway
vvp04650  Natural killer cell mediated cytotoxicity
vvp04658  Th1 and Th2 cell differentiation
vvp04659  Th17 cell differentiation
vvp04660  T cell receptor signaling pathway
vvp04664  Fc epsilon RI signaling pathway
vvp04666  Fc gamma R-mediated phagocytosis
vvp04670  Leukocyte transendothelial migration
vvp04722  Neurotrophin signaling pathway
vvp04750  Inflammatory mediator regulation of TRP channels
vvp04919  Thyroid hormone signaling pathway
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04935  Growth hormone synthesis, secretion and action
vvp05012  Parkinson disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05135  Yersinia infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05171  Coronavirus disease - COVID-19
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05214  Glioma
vvp05223  Non-small cell lung cancer
vvp05225  Hepatocellular carcinoma
vvp05231  Choline metabolism in cancer
vvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
vvp_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112928123 (PLCG1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112928123 (PLCG1)
   04014 Ras signaling pathway
    112928123 (PLCG1)
   04015 Rap1 signaling pathway
    112928123 (PLCG1)
   04370 VEGF signaling pathway
    112928123 (PLCG1)
   04064 NF-kappa B signaling pathway
    112928123 (PLCG1)
   04066 HIF-1 signaling pathway
    112928123 (PLCG1)
   04020 Calcium signaling pathway
    112928123 (PLCG1)
   04070 Phosphatidylinositol signaling system
    112928123 (PLCG1)
   04072 Phospholipase D signaling pathway
    112928123 (PLCG1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    112928123 (PLCG1)
   04660 T cell receptor signaling pathway
    112928123 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    112928123 (PLCG1)
   04659 Th17 cell differentiation
    112928123 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    112928123 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    112928123 (PLCG1)
   04670 Leukocyte transendothelial migration
    112928123 (PLCG1)
   04062 Chemokine signaling pathway
    112928123 (PLCG1)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    112928123 (PLCG1)
   04919 Thyroid hormone signaling pathway
    112928123 (PLCG1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112928123 (PLCG1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112928123 (PLCG1)
  09158 Development and regeneration
   04360 Axon guidance
    112928123 (PLCG1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112928123 (PLCG1)
   05206 MicroRNAs in cancer
    112928123 (PLCG1)
   05205 Proteoglycans in cancer
    112928123 (PLCG1)
   05231 Choline metabolism in cancer
    112928123 (PLCG1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112928123 (PLCG1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    112928123 (PLCG1)
   05214 Glioma
    112928123 (PLCG1)
   05223 Non-small cell lung cancer
    112928123 (PLCG1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    112928123 (PLCG1)
   05022 Pathways of neurodegeneration - multiple diseases
    112928123 (PLCG1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112928123 (PLCG1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112928123 (PLCG1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112928123 (PLCG1)
   05171 Coronavirus disease - COVID-19
    112928123 (PLCG1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112928123 (PLCG1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112928123 (PLCG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvp04131]
    112928123 (PLCG1)
Enzymes [BR:vvp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     112928123 (PLCG1)
Membrane trafficking [BR:vvp04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    112928123 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    112928123 (PLCG1)
SSDB
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 PH SH3_9 SH3_2 PH_12 GDPD PH_9
Other DBs
NCBI-GeneID: 112928123
NCBI-ProteinID: XP_025865442
UniProt: A0A3Q7TW26
LinkDB
Position
Unknown
AA seq 1282 aa
MTLFYSKKSQRPERKTFQVKLETRQITWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQ
EDPAFRPDQSHCFVILYGMEFRLKTLSLQATSEDEVNMWIKGLTWLMEDTLQAATPLQIE
RWLRKQFYSVDRNREDRISAKDLKNMLSQVNYRVPNMRFLRERLTDLEQRSSDITYGQFA
QLYRSLMYSAQKTMDLPFLEASALRAGERPELCRVSLPEFQQFLLEYQGELWAVDRLQVQ
EFMLSFLRDPLREIEEPYFFLDEFVTFLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSS
HNTYLTGDQFSSESSLEAYARCLRMGCRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVL
HTIKEHAFVASEYPVILSIEDHCSIAQQRNMAQYFKKVLGDTLLTKPVDIAADGLPSPNQ
LKRKILIKHKKLAEGSAYEEVPTSVMYSENDISNSIKNGILYLEDPVNHEWYPHYFVLTS
SKIYYSEETSSDQGNEDEEEPKEASGSTELHSSEKWFHGKLGAGRDGRHIAERLLTEYCI
ETGAPDGSFLVRESETFVGDYTLSFWRNGKVQHCRIHSRQDAGAPKFFLTDNLVFDSLYD
LITHYQQVPLRCNEFEMRLSEPVPQTNAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVR
KRNEPNSYAISFRAEGKIKHCRVQQEGQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRY
PINEEALEKIGTAEPDYGALYEGRNPGFYVEANPMPTFKCAVKALFDYKAQRDDELTFTK
SAIIQNVEKQEGGWWRGDYGGKKQLWFPSNYVEEMVSPAALEPEREHLDENSPLGDLLRG
VLDVPACQIAIRPEGKNNRLFVFSISMASVAHWSLDVAADSQEELQDWVKKIREVAQTAD
ARLTEGKMMERRKKIALELSELVVYCRPVPFDEDKIGTERACYRDMSSFPETKAEKYVNK
AKGKKFLQYNRLQLSRIYPKGQRLDSSNYDPLPMWICGSQLVALNFQTPDKPMQMNQALF
MAGGHCGYVLQPSTMRDEAFDPFDKSSLRGLEPYAICIEVLGARHLPKNGRGIVCPFVEI
EVAGAEYDSIKQKTEFVVDNGLNPVWPAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLA
QATFPVKGLKTGYRAVPLKNNYSEDLELASLLVKIDVFPAKVRVVGVAGSLSRPREVLTP
RALLLLKQENGDLSPFGMSLRERGSDASGQLFHGRAREGSFEARYQQPFEDFRISQEHLA
DHFDSRERRAPRRTRVNGDNRL
NT seq 3849 nt   +upstreamnt  +downstreamnt
atgactttgttctactccaagaagtcgcagcggccggagcggaagaccttccaggtcaag
ctggagacgcggcagatcacgtggagccgtggcgccgacaagatcgagggggccattgac
attcgagaaatcaaggagatccgcccagggaagacctcacgggattttgatcgctaccaa
gaggaccctgctttccgaccagaccagtcacactgcttcgtcatcctgtatgggatggaa
ttccgcctgaagactctgagcctgcaagctacatctgaggatgaagtgaacatgtggatc
aagggtttaacttggctgatggaggatactttgcaggcagccacacctctgcagattgag
aggtggctgcggaagcagttctactcagtggatcggaatcgtgaggatcgtatatcagcc
aaggacttgaagaacatgctgtcccaggtcaactaccgggttcccaacatgcgcttcctc
cgagagcgtctgacggacctggagcagcgcagcagtgacatcacctacgggcagtttgct
caactgtaccgcagcctcatgtacagcgcccagaagacgatggacctccccttcttggaa
gccagtgccctgagggcaggggagcgcccggagctctgtcgtgtgtcccttcctgagttc
cagcagttcctcctcgagtaccagggggagctgtgggctgttgaccggcttcaggtgcag
gagttcatgctcagcttccttcgagatcctttgcgagaaattgaagagccttacttcttc
ctggacgagtttgtcaccttcttgttctccaaagagaacagcgtgtggaattcacagctg
gatgcagtgtgcccagacaccatgaacaaccctctgtcccactactggatctcctcctcc
cacaacacgtacctgactggggaccagttctccagtgagtcctccctggaagcctatgct
cgctgcctgcggatgggctgtcgctgcattgagttggactgctgggatggcccagatggg
atgccagtcatttaccatgggcacacccttaccaccaagatcaagttctcagatgttcta
cataccatcaaggagcatgccttcgtggcttcagagtatccggtcatcctgtccatcgag
gaccactgcagcatcgcccagcagagaaacatggcgcagtacttcaagaaggtgcttggg
gacacactcctcaccaagcctgtggacatcgctgctgacgggctcccctcacccaaccag
ctcaagaggaagatcctcatcaagcacaagaagctggcagagggcagtgcctacgaagag
gtgcctacgtcagtgatgtactctgagaacgatatcagcaactccatcaagaatggcatc
ctctacctggaggacccggtgaaccatgagtggtacccccactacttcgttctgaccagc
agcaagatctactactctgaggagaccagcagtgaccagggcaatgaggatgaggaggaa
cccaaggaggccagtggcagcacagagctgcactccagtgagaagtggttccacgggaag
cttggggcaggacgggatggacgacacattgccgagcgcctgctcaccgagtattgcatt
gagaccggggcccctgatggctccttcctcgtgcgggagagcgagaccttcgtgggcgac
tataccctctctttctggaggaacgggaaagtccagcactgtcggatccattcccggcag
gatgctggggcccccaagttcttcttgacagacaacctggtctttgattcgctctatgac
ctcatcacgcactaccagcaagtgcccctgcgctgcaacgaatttgagatgcgcctttca
gagccggtcccgcagaccaatgcccacgagagcaaagagtggtaccacgccagcctgacc
agagctcaggccgagcacatgctgatgcgtgttccccgggatggggccttcctggtgagg
aaacggaatgagcccaactcctatgccatctctttccgggccgagggcaagatcaaacat
tgccgcgtccagcaggagggccagactgtgatgctgggcaactctgagtttgacagcctc
gtggacctcatcagctactatgagaagcacccgctataccgcaaaatgaagctgcgctat
cccatcaatgaggaagcgctggagaagataggcacagctgagcctgactatggagccctg
tatgagggacgcaaccctggcttctatgtggaggcaaatcctatgccaacttttaagtgt
gccgtcaaagccctctttgactacaaggctcagagggatgacgagctgacattcacgaag
agtgccatcattcagaatgtggagaagcaagaaggcggctggtggcggggggactacggg
gggaaaaagcagctctggttcccgtcaaactacgtagaagagatggtcagccctgcagcc
ctggagcctgagagggagcacttggatgagaacagccccctgggggacttgctccgtggg
gtcttggatgtgccagcctgtcagattgccatccgtcctgagggcaagaacaaccggctc
ttcgtcttctccatcagcatggcttcagtggcacactggtccttggatgtcgctgctgat
tcacaggaagagctgcaggactgggtgaagaagatccgagaagtggcccagacggcagac
gccaggctcacggaggggaagatgatggagcgcaggaagaagatcgccctggagctctct
gagctggttgtctactgcaggccggttcccttcgatgaagacaagattggcacagaacgt
gcgtgctaccgggacatgtcatcctttccggaaaccaaggctgagaaatatgtgaacaag
gccaaaggcaagaagttcctccagtacaaccggctgcagctctcgcgcatctaccccaag
ggccagcggctggactcctccaattatgaccccctgcccatgtggatctgtggcagtcag
ctcgtagccctcaacttccagaccccagacaagcccatgcagatgaaccaggccctcttc
atggctggcggccactgcggctacgtgctgcagccgagcaccatgcgggacgaggccttt
gatccctttgacaagagcagcctccgaggcctggaaccatatgccatctgcattgaggtg
ctgggggctcggcacctgccaaagaacggccgaggcatcgtgtgtcctttcgtggagatt
gaagtggccggagcagagtacgacagcatcaagcagaagacagagttcgtggtggacaat
ggactgaaccctgtgtggcctgccaagcccttccacttccagatcagtaacccggaattc
gcctttttgcgctttgtggtgtatgaggaagacatgtttagtgaccagaacttcctggct
caggctacattcccggtgaaaggcctgaagacaggatacagagctgtgcctttgaagaac
aactacagtgaggacctagagctggcctccctgctcgtcaagatcgatgtgttccctgcc
aaggtaagggtggtgggggtggcggggagcctctccaggccccgggaggtgctgacccct
cgtgcactgctgttgttgaagcaggagaatggggacctcagtcccttcgggatgtctctt
cgggagcggggctctgatgcctcaggccagctgttccatggccgggcccgtgaaggttcc
tttgaggcccgctaccagcagccatttgaggactttcgtatctcccaggagcacctggca
gaccattttgacagtcgggaacggagggccccacggaggacacgggtcaacggagacaac
cgcctctag

DBGET integrated database retrieval system