KEGG   Vulpes vulpes (red fox): 112912079
Entry
112912079         CDS       T05911                                 

Gene name
SHISA5
Definition
(RefSeq) protein shisa-5 isoform X1
  KO
K10135  scotin
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112912079 (SHISA5)
SSDB
Motif
Pfam: Shisa MMPL
Other DBs
NCBI-GeneID: 112912079
NCBI-ProteinID: XP_025844608
UniProt: A0A3Q7RH57
LinkDB
Position
Unknown
AA seq 239 aa
MAARVPAPRILLLLLLLPPPPGARSEVCVASHERNLFPESCPEFCCGNCYYQYCCSDELK
KFVWNEEGCGVPEASVSIDTESLEQLGSALRFYSSLDSDPMSGFGTTVAIGLTIFVLAVV
TLIICFTCSCCCLYKMCRRPPRPVVTTTTATTVVHTPYPQPPSVPPGYPGPTYQGYHPMP
PQPGMPAAPYPTQYPPPYPAQPMGPPAYHETLAGGAAMPYPASQPPYNPAYMDPPKAAP
NT seq 720 nt   +upstreamnt  +downstreamnt
atggccgcgcgggtgcccgcgccacggatcctgctgctgctgctgctgctcccgccgcct
ccaggtgctcgcagtgaggtgtgtgtggcttcccatgaacgcaacctcttccctgagtcc
tgtcctgagttctgctgtggcaactgttattaccaatactgctgctctgatgagctgaag
aaatttgtatggaatgaagaagggtgtggtgtgcctgaagccagtgtgtccattgatacg
gagtcgctggagcagctgggctcggcgctgaggttctattccagcttggacagtgatccc
atgtcagggtttgggacaactgtagccattggcctgaccatctttgtgctcgctgtggtc
accctcatcatctgcttcacgtgttcctgctgctgtctctacaagatgtgccgccggcca
ccacgtccggtggtaaccaccaccacggccaccaccgtggtacacaccccttaccctcag
cctccaagtgtgccacccggctaccctggaccgacgtaccagggctaccaccccatgccc
ccgcagccagggatgccggcagcaccctacccgacacagtacccaccaccctaccctgcc
cagccaatgggccccccggcttaccacgaaacattggccggaggtgccgccatgccctac
cctgccagccagcctccttacaacccggcctacatggaccccccgaaggcagccccctga

DBGET integrated database retrieval system