KEGG   Vulpes vulpes (red fox): 112913093
Entry
112913093         CDS       T05911                                 

Definition
(RefSeq) tropomyosin alpha-3 chain-like
  KO
K09290  tropomyosin 3
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04260  Cardiac muscle contraction
vvp04261  Adrenergic signaling in cardiomyocytes
vvp05200  Pathways in cancer
vvp05216  Thyroid cancer
vvp05410  Hypertrophic cardiomyopathy
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    112913093
   04261 Adrenergic signaling in cardiomyocytes
    112913093
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112913093
  09162 Cancer: specific types
   05216 Thyroid cancer
    112913093
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112913093
   05414 Dilated cardiomyopathy
    112913093
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:vvp04812]
    112913093
Cytoskeleton proteins [BR:vvp04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     112913093
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II DUF1110 CLZ DUF842 E2R135
Other DBs
NCBI-GeneID: 112913093
NCBI-ProteinID: XP_025845463
UniProt: A0A3Q7RJR0
LinkDB
Position
Unknown
AA seq 367 aa
MGFGLYPGKDKEPLKDSTQGVAGIRFRMITLAVAIRAVGCSQSKTESNSERRLQRRASGG
GKTQRARRAWRRRRSARSGSQQQAEDAEARAPAAGSGAGEGGGRPGREQAEAEAEAEAAS
LNRRIQLVEEELDRAQERLATALQKLEEAEKAADESERGNPTQRGQAPCRRGIQLVEEEL
DRAQERLATALQKLEEAEKAADESERGVKVIENRALKDEEKMELQEIRLKEAKHLAEEAA
GTYEEVARKLVITEGDLDRTEERCPRSELSRGREMDEPIRLMDQNLKCLSAAAEKYSQKE
DKYEEETEILRDNKVKEAEPRPEFAERSVAKLEKTIEDLEDKLKGTKEEHLCTLRMLDQT
LLDLNEM
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggggtttggactttatcctgggaaggacaaggagccattgaaggattccactcaagga
gtggcagggatcagatttagaatgattaccctggctgtagccataagagcagttggctgt
agccagagcaagactgagtcaaattcggagaggcggctgcagcgccgagcgagcggggga
ggcaagacccagcgcgcgaggcgggcctggcggaggcggcgaagcgccagatcaggttcc
cagcagcaagcggaggacgcagaggcccgagcgcccgcagccgggagtggagcgggagag
gggggcgggcggcccggccgggagcaggctgaggctgaggctgaggctgaggcggcctcc
ttgaaccgtcggatccagctggttgaagaggagctggaccgcgcccaggagcgcctggcc
actgccctgcaaaagctggaggaagcggagaaagctgctgatgagagtgagagaggaaat
ccgactcaaagaggccaagcaccttgcagaagaggcatccagctggttgaagaggagctg
gaccgcgcccaggagcgcctggccactgccctgcaaaagctggaggaagcggagaaagct
gctgatgagagtgagagaggtgtgaaggttattgagaaccgagccttgaaagatgaagaa
aagatggaactccaggaaatccgactcaaagaggccaagcaccttgcagaagaggcagcc
gggacgtatgaagaggtggctaggaagttggtgatcactgagggggacttggaccgcaca
gaggagcgatgtcccaggagcgagctgtcccgtggccgggagatggatgagcccatcagg
ctgatggaccagaacctgaagtgtctgagtgctgctgcggaaaagtactctcaaaaggaa
gacaaatatgaggaagagacagagattctcagggataataaagtcaaggaggcagagccc
cgccctgagtttgctgagagatcggtagccaagctggagaagacaattgaggacttggaa
gacaagctgaaaggcaccaaagaggagcacctgtgtacactaaggatgctggaccagact
ctccttgacctgaatgagatgtag

KEGG   Vulpes vulpes (red fox): 112913387
Entry
112913387         CDS       T05911                                 

Gene name
TFG
Definition
(RefSeq) protein TFG isoform X1
  KO
K09292  protein TFG
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp05200  Pathways in cancer
vvp05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112913387 (TFG)
  09162 Cancer: specific types
   05216 Thyroid cancer
    112913387 (TFG)
SSDB
Motif
Pfam: PB1
Other DBs
NCBI-GeneID: 112913387
NCBI-ProteinID: XP_025845721
UniProt: A0A3Q7RUI6
LinkDB
Position
Unknown
AA seq 401 aa
MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKD
EDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLL
DSLEPPGEPGPSGSIPENDTVDGRDEKPAASDSSGKQSTQVMAASMSAFDPLKNQDEINK
NVMSAFGLTDDQVSGPPSAPAEDRSGTPDSIASSSSAAHPPGVQPQQPPYTGAQTQAGQS
EGQMYQQYPQQAGYGAQQPQAPPQPPQQYGIQYSAGYSQQTGPQQPQQFQGYGQQPASQA
PAPAFAGQPQQLSAQPPQQYQASSYPPQTYTTQTSQPANYTVPPASQPGMAPSQPGAYQP
RPGFTPPPGSTMTPPPSGPNPYARTRPPFGQGYTKPGPGYR
NT seq 1206 nt   +upstreamnt  +downstreamnt
atgaatggacagttggacctaagtgggaagctaatcatcaaagctcaacttggggaggat
attcgacgaattcccattcataatgaagatattacttatgatgaattagtgctaatgatg
cagcgagttttcagaggaaaacttctgagtaatgatgaagttacgataaaatataaagat
gaagatggagatcttataacaatttttgatagttctgacctttcttttgcaattcagtgt
agtagaatactgaaactgacattatttgttaatggccagccaagaccccttgaatccagt
caggtgaaatatctccgtcgagagctgatagaactgagaaataaagtgaaccgcttattg
gatagcttggaaccacctggagagccaggaccttctggcagtattcctgaaaatgatact
gtggatggtagggatgaaaagcctgctgcttctgattcttctggaaaacaatctactcag
gttatggcagcaagtatgtcagcttttgatcctttaaaaaaccaagatgaaatcaataaa
aatgtcatgtcagcgtttggcttaacagatgatcaggtttcagggccacccagtgctcct
gcagaagaccgttcagggacacccgacagcattgcttcctcctcctctgcagctcatcca
ccaggagttcagccacagcagccaccatatacaggagctcagacacaagcaggtcagagt
gaaggccagatgtaccagcagtacccgcaacaggccggctatggtgctcagcagccccag
gcgccgcctcagccgccacagcagtatggtattcagtattcagcaggctatagtcagcag
actggaccccaacaacctcagcagttccagggatatggccagcaaccagcttcccaggca
ccagctcctgcctttgctggccagcctcaacagctgtctgctcaaccaccacagcagtac
caggcgagcagttaccctccacaaacttacactacccaaacttctcagcctgccaattac
actgtgccccctgcctcacaacctggaatggctccaagccaacctggggcctatcaacca
agaccaggttttactccacctcctggaagtaccatgactccacctcctagtgggcctaac
ccttatgcacgcacccgccctccctttggtcagggctataccaaacctggacctggttat
cgataa

KEGG   Vulpes vulpes (red fox): 112918800
Entry
112918800         CDS       T05911                                 

Gene name
NTRK1
Definition
(RefSeq) high affinity nerve growth factor receptor
  KO
K03176  neurotrophic tyrosine kinase receptor type 1 [EC:2.7.10.1]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04010  MAPK signaling pathway
vvp04014  Ras signaling pathway
vvp04020  Calcium signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04210  Apoptosis
vvp04722  Neurotrophin signaling pathway
vvp04750  Inflammatory mediator regulation of TRP channels
vvp05200  Pathways in cancer
vvp05202  Transcriptional misregulation in cancer
vvp05216  Thyroid cancer
vvp05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112918800 (NTRK1)
   04014 Ras signaling pathway
    112918800 (NTRK1)
   04020 Calcium signaling pathway
    112918800 (NTRK1)
   04151 PI3K-Akt signaling pathway
    112918800 (NTRK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112918800 (NTRK1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112918800 (NTRK1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112918800 (NTRK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112918800 (NTRK1)
   05202 Transcriptional misregulation in cancer
    112918800 (NTRK1)
   05230 Central carbon metabolism in cancer
    112918800 (NTRK1)
  09162 Cancer: specific types
   05216 Thyroid cancer
    112918800 (NTRK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112918800 (NTRK1)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112918800 (NTRK1)
Protein kinases [BR:vvp01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   112918800 (NTRK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase TPKR_C2 LRR_8 I-set Ig_3 TrkA_TMD Ig_2 LRR_4
Other DBs
NCBI-GeneID: 112918800
NCBI-ProteinID: XP_025852701
UniProt: A0A3Q7SC88
LinkDB
Position
Unknown
AA seq 784 aa
MVGDGAGWDDPDGLVLASAGAAPCPDVCCPHGPSGLRCTRAGALQSLHRLPGVENLTELY
IDNQEHLQHLDAVHLKGLGMLRDLTIVKSGLRSVAPDAFHFTPRLRRLNLSFNALESLSW
KTVQGLPLQELVLLGNPLHCSCALHWLLRWEEEGLGGVRGQRLQCPGQGPLALLSNASCG
VPVLKVQMPNASVEVGDDVLLQCQVEGRGLERAGWILSEVEELATVTQSGDLPSLGLTLA
NVTSDLNRKNVTCWAENDVGRAEVSVQVNVSFPASVQLHEAVELHHWCIPFSVDGQPAPS
LRWLFNGSVLNETSFIFTEFLEPVANETVRHGCLRLNQPTHVNNGNYTLLAANPSGRAAA
FVMAAFMDNPFEFNPEDPIPVSFSPVDTNSTSGDPVEKKDETPFGVSVAVGLAVFACLFL
STLFLALNKCGRRNKFGGNRAVVLAPEDGLAMSLHFMTLGGSSLSPTEGKGSGLQGHIIE
NPQYFSDACVHHIKRQDIVLKWELGEGAFGKVFLAECHNLLPEQDKMLVAVKALKEVSES
ARQDFQREAQLLTMLQHQHIVRFFGVCTEGRPLLMVFEYMRHGDLNRFLRSHGPDAKLLA
GGEDVAPGPLGLGQLLAVASQVAAGMVYLAGLHFVHRDLATRNCLVGQGLVVKIGDFGMS
RDIYSTDYYRVGGRTMLPIRWMPPESILYRKFTTESDVWSFGVVLWEIFTYGKQPWYQLS
NTEAIECITQGRELERPRACPPEVYAIMRGCWQREPQQRHSIKDVHARLQALAQAPPVYL
DVLG
NT seq 2355 nt   +upstreamnt  +downstreamnt
atggtgggggacggggctggctgggacgaccccgacgggctggtgctggcgtccgcgggc
gccgcgccctgccccgatgtctgctgcccccacggcccctcggggctgcgctgcacccgg
gccggggccctgcagagcctccaccgcctgccaggcgttgagaacctgacggagctctac
atcgacaaccaagagcatctgcagcatctggatgccgttcacctgaagggcctggggatg
ctgagagacctcaccatcgttaagagtgggctccgctctgtggcaccggacgccttccat
ttcactcctcggctccgtcgcctgaatctctccttcaatgctttggagtctctgtcctgg
aaaaccgtccagggcctccccctgcaggagctggtcctgttggggaacccactacattgt
tcttgtgccctccactggctgctgcgctgggaggaggaagggctgggtggagtgcgtgga
cagaggctgcagtgtcccgggcaggggcccctggccctcttgtccaatgccagctgcggc
gtccccgtgctgaaggtccagatgcccaatgcgtcggtggaggtgggggatgatgtgttg
ctgcagtgccaggtggaggggcggggcctggagcgggccggctggatcctctcagaggtc
gaggagttggccacagtgacgcaatctggggacctgccatccctggggctgaccctggcc
aatgtcaccagtgacctcaataggaagaatgtgacgtgctgggcggagaatgatgtgggc
cgggccgaagtatctgtgcaggtcaacgtctccttcccggccagcgtgcagctgcatgag
gcggtggagctgcatcactggtgcatccccttctcggtggatgggcagccggcgccctct
ctgcgctggctcttcaacggctctgtgctcaacgagaccagcttcatcttcactgagttc
ctggagccggtggccaacgagacggtgcggcacggctgcctgcgcctcaaccagcccacc
catgtcaacaacggcaactacacgctgttggccgccaacccctcgggccgggctgccgcc
tttgtcatggccgccttcatggacaaccctttcgagttcaaccctgaggaccccatcccc
gtctccttctcgccagtggacactaacagcacgtctggagacccagtggagaagaaggac
gaaaccccttttggggtctccgtggctgtgggcctggctgtctttgcctgcctcttcctt
tctacactcttccttgcactcaataagtgtggacggaggaacaaatttgggggcaaccgc
gcagtggtgctggctccagaggacggactggccatgtctctgcatttcatgacattaggt
ggcagctccttatcccccactgagggcaaaggctctgggctccaaggtcacatcatcgag
aacccacaatacttcagtgatgcctgtgttcatcatatcaagcgccaggacattgtgctc
aaatgggagctgggcgaaggcgcctttgggaaggtcttccttgctgagtgccacaacctg
ctgcctgagcaggacaagatgctagtggccgtcaaggcgctgaaggaggtgtccgagagc
gccaggcaggacttccagcgggaggcccagctgctcaccatgctgcagcaccagcacatc
gtgcgcttctttggggtctgcaccgagggccgcccactgctcatggtctttgagtacatg
cgacacggtgacctcaaccgcttccttcggtcccacgggcccgacgccaagttgctggct
ggcggggaggacgtggctccgggccccttgggcctggggcagctgctggccgttgctagc
caggtcgctgcggggatggtgtacctggcaggtctgcacttcgtgcatcgggacctggcc
acgcgcaactgtctggtgggccagggactggtggtcaagatcggggacttcggcatgagc
agggacatctacagcacggactattaccgcgtggggggccgcacgatgctgcccatccgc
tggatgccgcccgagagcatcctctaccgcaagttcaccacggagagtgacgtgtggagc
ttcggggtggtgctctgggagatcttcacctacggcaagcagccctggtaccagctgtcc
aacaccgaggcgattgagtgcatcacgcagggccgagagctggagcggccccgggcctgc
ccaccggaggtctacgccattatgcggggctgctggcagcgggagccccaacaacgccac
agcatcaaggatgtgcacgcccggctgcaagccctggcccaggcacctccggtctacttg
gatgtcctgggctag

KEGG   Vulpes vulpes (red fox): 112918879
Entry
112918879         CDS       T05911                                 

Gene name
TPM3
Definition
(RefSeq) tropomyosin alpha-3 chain isoform X1
  KO
K09290  tropomyosin 3
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04260  Cardiac muscle contraction
vvp04261  Adrenergic signaling in cardiomyocytes
vvp05200  Pathways in cancer
vvp05216  Thyroid cancer
vvp05410  Hypertrophic cardiomyopathy
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    112918879 (TPM3)
   04261 Adrenergic signaling in cardiomyocytes
    112918879 (TPM3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112918879 (TPM3)
  09162 Cancer: specific types
   05216 Thyroid cancer
    112918879 (TPM3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112918879 (TPM3)
   05414 Dilated cardiomyopathy
    112918879 (TPM3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:vvp04812]
    112918879 (TPM3)
Cytoskeleton proteins [BR:vvp04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     112918879 (TPM3)
SSDB
Motif
Pfam: Tropomyosin Tropomyosin_1 Laminin_II TMF_DNA_bd Crescentin XhlA CENP-F_leu_zip DUF1664 DUF745 Lebercilin CLZ WES_acyltransf ADIP DUF16 DHR10 CALCOCO1 Fib_alpha DUF3450
Other DBs
NCBI-GeneID: 112918879
NCBI-ProteinID: XP_025852917
UniProt: A0A3Q7SDG1
LinkDB
Position
Unknown
AA seq 248 aa
MAGITTIEAVKRKIQVLQQQADDAEERAERLQREVEGERRAREQAEAEVASLNRRIQLVE
EELDRAQERLATALQKLEEAEKAADESERGMKVIENRALKDEEKMELQEIQLKEAKHIAE
EADRKYEEVARKLVIIEGDLERTEERAELAESKCSELEEELKNVTNNLKSLEAQAEKYSQ
KEDKYEEEIKILTDKLKEAETRAEFAERSVAKLEKTIDDLEDKLKCTKEEHLCTQRMLDQ
TLLDLNEM
NT seq 747 nt   +upstreamnt  +downstreamnt
atggccgggatcaccaccatcgaggcggtgaagcgtaagatccaggttctgcagcagcaa
gccgatgacgcagaggagagggccgagcgcctgcagcgggaagtggagggggaaaggcgg
gcccgggagcaggctgaggctgaggtggcctccttgaaccgtaggatccagctggttgaa
gaggagctggaccgcgcccaggagcgcctggccactgccctgcaaaagctggaggaagcc
gagaaagctgctgatgagagtgagagaggtatgaaggttattgagaatcgagccttaaaa
gatgaagaaaagatggaactccaggaaatccaactcaaagaggccaagcacattgcagaa
gaggcagaccggaagtatgaagaggtggctaggaagttggtgatcattgagggggacttg
gaacgtacagaggaacgagctgagctggcagagtctaagtgttctgagctggaggaggag
ctgaagaatgtcaccaacaacctcaagtctcttgaggctcaggcggagaagtactctcaa
aaggaagacaaatatgaggaagagataaagattctcacggataaactcaaggaggcagag
acccgtgctgagtttgctgagagatcggtagccaagctggagaagacaattgatgatttg
gaagataagctgaaatgcaccaaagaggagcacctgtgtacacaaaggatgctggaccag
actctgcttgacctgaatgagatgtag

KEGG   Vulpes vulpes (red fox): 112921828
Entry
112921828         CDS       T05911                                 

Gene name
TPR
Definition
(RefSeq) nucleoprotein TPR
  KO
K09291  nucleoprotein TPR
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp03013  RNA transport
vvp05014  Amyotrophic lateral sclerosis
vvp05200  Pathways in cancer
vvp05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    112921828 (TPR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112921828 (TPR)
  09162 Cancer: specific types
   05216 Thyroid cancer
    112921828 (TPR)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    112921828 (TPR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:vvp03019]
    112921828 (TPR)
Messenger RNA biogenesis [BR:vvp03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     112921828 (TPR)
SSDB
Motif
Pfam: TPR_MLP1_2 Seryl_tRNA_N TFIIA DUF5082 DUF1192 Imm70
Other DBs
NCBI-GeneID: 112921828
NCBI-ProteinID: XP_025856989
UniProt: A0A3Q7SAR2
LinkDB
Position
Unknown
AA seq 2438 aa
MPSSGSVSRSRQRGRPMASRSFDGSRRGSLRRAGAREPRSEVAEAAAQASGSSWSSPFFS
ASAPPAAGAAATGPIDMAAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHE
KFKVESEQQYFEIEKRLSHSQERLVNETRECQSLRLDLEKLNNQLKALTEKNKELEVAQD
RNIAIQSQFTRTKEELEAEKRDLVRTNERLSQELEYLTEDFKRLNEKLKESNATKGDLQL
KLDELQASDVSVKYREKRLEQEKELLHNQNTWLNTELKTKTDELLALGREKGNEILELKC
NLENKKEEVSRMEEQMSGLKTSNENLQKHVEELLTKLKEAKEQQASMEEKFHNELNAHIK
LSNLYKSAADDSEAKSNELTRAVDELHKLLKEAGEANKAIQDHLLEVEESKDQMEKEMLE
KIGKLEKELENANDLLSATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVE
TQDQLLLEKLENKRINKYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSVKLEQAMKE
IQRLQEDTDKANKHSSVLERDNQRMEIQIKDLSQQIRVLLMELEEARGNHVIRDEEVSSA
DISSSSEVISQHLVSYRNIEELQQQNQRLLVALRELGETREREEQETTSSKIAELQLKLE
NALTELEQLRESRQHQMQLVDSIVRQRDMYRILLSQRGVAIPLQPSSLEDISLASTPKRS
STSQTASTPAPVPVIESAEAIEAKAALKQLQEIFENYKKEKADNEKIQNEQLEKLQDQIT
DLRSQNTKISTQLDFASKRYEMLQDNVEGYRREITSLHERNQKLTATTQKQEQIINTMTQ
DLRGANEKLAVAEVRAENLKKEKEMLKLSEVRLSQQRESLLAEQRGQNLLLTNLQTIQGI
LERSETETKQRLSSQIEKLEHEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDTETN
LHLNTKELLKNAQKEIATLKQHLSNMEVQLASQSSQRTGKGQPSNKEDVDDLLSQLRQAE
EQVNDLKERLKTSTSNVEQYRAMVTSLEESLNKEKQVTEEVRKNIEVRLKESAEFQTQLE
KKLMEVEKEKQELQDDKRKAIESMEHQLSELKKTLNSVQNEVQEALQRASTALSNEQQAR
RDCQEQAKIAVEAQNKYERELMLHAADVEALQAAKEQVSKMASVRQHLEETTQKAESQLL
ECKASWEERERMLKDEVSKCMSRCEDLEKQNRLLHDQIEKLSDKVVASVKEGVQGPLNVS
LSEEGKSQEQILEILRFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNAE
REKVQVTAKTMAQHEELMKKTETMNVVMETNKMLREEKERLEQDLQQMQAKVRKLELDIL
PLQEANAELSEKSGMLQAEKKLLEEDVKRWKARNQHLVSQQKDPDTEEYRKLLSEKEVHT
KRIQQLTEEIGRLKAEIARSNASLTNNQNLIQSLKEDLNKVRTEKETIQKDLDAKIIDIQ
EKVKTITQVKKIGRRYKTQYEELKAQQDKVMETSAQSSGDHQEQHVSVQEMQELKETLNQ
AETKAKSLESQVENLQKTLSEKEAEARNLQEQTVQLQCELSRLRQDLQDRTTQEEQLRQQ
ITEKEEKTRKAIVAAKSKIAHLAGVKDQLTKENEELKQRNGALDQQKDELDVRMTALKSQ
YEGRISRLERELREHQERHLEQRDEPQEPTNKVPEQQRQITLKTTPASGERGIASTSDPP
TANIKPTPVVSTPSKVTAAAMAGNKSTPRASIRPMVTPATVTNPTTTPTATVMPTTQVES
QEAMQSEGPVEHVPVFGSTSGSVRSTSPNVQPSIPQPILTVQQQTQATAFVQPTQQSHPQ
IEPANQELSPNIVEVVQSSPVERPSTSTAVFGTVSATPSSSLPKRTREEEEDSTIEASDQ
VSDDTVEMPLPKKLKSVTPVGTEEEVMAEESTDGEVETQVYNQDSQDSIGEGVTQGDYTP
MEDSEETSQSLQIDLGPLQSDQQTTTSSQDGQGKGDDVIVIDSDDEEEDDDENDGEHEDY
EEDEEDDDDDEDDTGMGDEGEDSNEGTGSADGNDGYEADDAEGGDGTDPGTETEESMGGG
ESNQRAADSQNSGEGNTGTAESSFSQDISREQQPSSASERQTPRAPQSPRRPPHPLPPRL
TIHAPPQELGPPVQRIQMTRRQSVGRGLQLTPGIGGMQQHFFDDEDRTVPSTPTLVVPHR
TDGFAEAIHSPQVAGVPRFRFGPPEDMPQTSSSHSDLGQLASQGGLGMYETPLFLAHEEE
SGGRSVPTTPLQVAAPVTVFTESTTSDASEHASQSVPMVTTSTGTLSTTNETATGDDGDE
VFVEAESEGISSEAGLEIDSQQEEEPVQASDESDLPSTSQDPPSSSSVDTSSSQPKPFRR
VRLQTTLRQGVRGRQFNRQRGVSHAMGGRGGINRGNIN
NT seq 7317 nt   +upstreamnt  +downstreamnt
atgccctctagtggctcagtgtctagaagccgccaaagaggacgacccatggcatcccgg
agcttcgacgggtcccgccgcgggagtctccggcgggcaggcgcgcgcgagccacggagc
gaggtggccgaggcggccgcccaggcttctgggtcctcttggtcttcgcctttcttctcc
gcttctgctccgccggcggctggcgccgcggccaccggcccgatcgacatggcggcggtg
ttgcagcaagtcctggagcgcacggaactgaacaagctgcctaagtccgtccagaacaaa
cttgaaaagttccttgctgaccagcaatccgagatcgatggcctgaaggggcggcatgag
aaattcaaggtggagagcgaacaacagtactttgagatagagaagaggttgtctcacagt
caggagagacttgtgaatgaaacccgagagtgccagagcttaaggcttgacctagagaag
ctcaacaatcaactaaaggcgctgactgagaaaaataaagaacttgaagttgcacaggat
cgcaatattgccattcagagccagtttacaaggacgaaagaagaattagaagctgaaaaa
agagacttagttagaaccaatgagagactatctcaagaacttgaatatttaacagaggat
tttaaacgtctcaatgaaaaacttaaagaaagcaatgccacaaagggtgatctgcagtta
aaattggatgaacttcaagcttctgatgtttctgttaaatatagagaaaaacgtttggag
caagaaaaggagttgttacataatcagaatacatggctgaatacagagttaaaaaccaaa
actgatgaacttttggctcttggcagagaaaaaggaaatgagattctagagcttaaatgt
aatcttgaaaacaaaaaagaagaggtttctagaatggaagaacagatgagtggcttgaaa
acatcaaatgagaatcttcaaaaacatgtagaagagctgttgaccaaactgaaagaggcc
aaggaacagcaggccagtatggaagagaaattccacaatgagttaaatgctcacataaag
ctctctaatctatacaagagtgctgctgatgactccgaggcaaagagcaatgaactgacc
cgagcagtggatgaactacacaaacttttgaaagaagctggagaagccaataaagcaata
caagatcatcttttagaagtggaggaatctaaagatcaaatggaaaaagaaatgcttgag
aaaattgggaaattggagaaggaattagagaatgcaaatgacctgctttctgccacaaaa
cgtaaaggagccatattatctgaagaagagcttgcagctatgtctcctactgcagcagct
gtggctaagatagtgaaacctggcatgaaattaactgagctgtataatgcttatgtggaa
actcaggatcagttgctcttggagaaactagagaataaaagaattaacaagtatctagat
gaaatagtgaaagaagttgaagccaaagcaccaattttgaaacgtcagcgtgaggagtat
gagcgtgcacagaaggctgtggcaagtttatctgttaagctggaacaagcgatgaaggag
attcagcgattacaggaagacactgataaagctaacaaacattcatctgtgcttgaaaga
gacaatcaaagaatggaaatacaaataaaagatctttcacaacagattagagtgcttttg
atggaacttgaagaagcaaggggcaatcatgtaattcgtgatgaggaagtaagctctgct
gatataagtagttcatcggaagtaatatcacagcatctagtatcttatagaaatattgaa
gagcttcagcagcaaaatcaacgtctcttagtggcccttagggaacttggggaaaccaga
gaaagagaggaacaagaaacaacttcatccaaaattgctgagcttcagctaaaacttgag
aatgctctcactgaattagaacaactccgtgagtcacgacaacatcaaatgcagcttgtt
gattctatagttcgtcagcgtgatatgtaccgtattttgttgtcacaaagaggagttgcc
attcctttacaaccttcaagcttagaggatatttctcttgcatcaactccgaaacgttca
agtacatctcagactgcttccactcctgctccagtacctgtaattgagtcagcagaggcc
atagaagccaaggctgcccttaaacagttgcaggaaatttttgagaattacaaaaaagaa
aaggcagataatgaaaaaatacaaaatgaacagctcgagaaacttcaggatcaaattaca
gatttgcgatcacaaaacaccaaaatttctacacaactagattttgcttctaaacgttat
gaaatgctacaagataatgttgaaggatatcgtcgagaaatcacatctctacatgagaga
aatcagaaactcaccgcaacaactcaaaagcaggaacagatcatcaatacaatgacacaa
gatttgagaggagcaaatgaaaagctagccgttgcagaagtaagagcagaaaacttgaaa
aaggaaaaggaaatgcttaaattgtcagaagtccgtctttctcagcaaagagagtcttta
ttagctgaacaaagaggacaaaacttgctgctgactaatcttcagacaattcagggaata
ttagagcgatctgaaacagaaaccaagcaaagacttagtagccagatagaaaaattggaa
catgagatatcacatctaaagaagaagctggagaatgaggtggaacaaaggcatacgctt
actagaaatctagatgttcaacttttggatacaaagagacagctggatactgagacaaat
cttcatcttaacacaaaagaactattaaaaaatgctcaaaaggaaattgctacattgaaa
cagcacctcagtaatatggaagtccagcttgcttctcagtcctcacagagaactggtaaa
ggtcagcctagcaacaaagaagatgtggatgatcttctgagtcagctacggcaggcagaa
gagcaggtgaatgatttgaaggagagactcaaaacaagtactagtaatgtggaacagtat
cgagcaatggttactagcttagaagaatctcttaacaaagaaaaacaggtgacagaagaa
gtacgtaagaatattgaagttcgtttaaaagagtctgctgagtttcagacacagttggaa
aagaagctaatggaagtggagaaagaaaaacaggaacttcaggatgacaagagaaaagcc
atagagagtatggaacatcagttgtctgagttaaagaaaacacttaatagtgttcagaat
gaagtacaagaagctcttcagagagcaagcacagctttgagtaatgaacagcaagccaga
cgtgactgtcaggaacaagctaaaatagctgtggaagctcagaataagtatgagagagaa
ttgatgctacatgctgctgatgttgaagctctacaagctgccaaggaacaggtttccaaa
atggcatcagtccgtcagcatttggaagaaacaacccagaaagcagaatcacagttattg
gagtgtaaagcatcttgggaggaaagagaaagaatgttaaaggatgaagtttccaagtgt
atgtctcgctgtgaagatctagagaaacaaaaccgattacttcatgatcagattgaaaaa
ttaagtgacaaggttgttgcctctgtgaaggaaggtgtccaaggtcccttgaacgtatct
ctcagtgaagaaggaaaatctcaagaacaaattttagaaattctcagatttattcgaaga
gaaaaagaaattgctgaaaccaggtttgaggtggctcaggttgagagtctgcgttatcga
caaagagttgaacttttagagagagaactgcaggaactgcaggatagtctaaatgctgaa
agggagaaagtccaggtaactgcaaaaacgatggcccagcatgaagaactgatgaagaaa
accgaaacaatgaatgtggtgatggagaccaataagatgctaagagaagagaaagagagg
ctagaacaggatctacagcaaatgcaagcaaaggtaagaaaactggagttagatatttta
cccttacaagaagcaaatgctgagctgagtgagaaaagcggtatgttgcaagcagagaag
aagttactagaagaagatgtcaaacgttggaaagcacgaaaccagcatctagtaagtcaa
cagaaagatccagatacagaagaatatcggaagctcctctctgaaaaggaagtgcatact
aagcgtattcaacagttgactgaagaaattgggagacttaaagctgaaattgcaagatca
aatgcatcattgaccaacaaccagaacttaatccagagtctaaaggaagatttaaataaa
gtaagaactgaaaaggaaaccattcaaaaggacttagatgccaaaataattgatatccaa
gaaaaagtcaaaactattactcaagtcaagaagattgggcgtagatacaagactcaatat
gaggaacttaaagcacaacaggataaggttatggagacctcggctcagtcttctggagac
caccaggaacagcatgtttcagttcaagaaatgcaggagctcaaagaaaccctcaatcaa
gccgaaacaaaggccaaatcactagagagtcaagtagaaaatctgcagaagacattatct
gaaaaagaggcagaagcaagaaatctgcaggaacaaactgtgcagcttcagtgtgagctt
tcacgacttcgtcaggatcttcaggatagaaccacacaagaggagcagctccgacagcag
ataactgaaaaggaagaaaaaacaagaaaggccatagtagcagcaaaatcaaagattgca
catttagctggtgtaaaagatcagctaactaaagaaaatgaggagcttaaacaaaggaat
ggagccttagatcagcagaaagatgaattggatgttcgaatgactgctcttaagtcccag
tatgaaggtcgaattagtcgcttggaaagagaactccgagagcatcaagagagacacctt
gagcagagagatgagcctcaagaacctactaataaggtcccagaacagcagagacaaatc
acattgaaaacaactccagcttctggtgaaagaggaattgccagcacatcagatccacca
acagccaatatcaagccaactcctgttgtgtctactccaagtaaagtgacagctgcagct
atggctgggaataagtcaacacccagagctagtatccgcccaatggtcacacctgcaact
gttacaaatcctactactaccccaacagctacagtgatgcccactacacaagtagaatca
caggaagctatgcaatcagaagggcctgtggaacatgttccagtttttggaagcacaagt
ggttctgtccgttctactagtcctaatgtccagccttctatccctcaacccattttaact
gttcagcaacagacacaggctacagcttttgtgcagcccacccaacagagtcatcctcag
attgagcctgcaaatcaagagctatcccccaacatagtagaagttgtacagagttcacca
gttgagcgtccttctacttccacagcagtatttggcactgtgtcagctaccccaagttct
tctttgcctaaacggacacgcgaagaggaagaggatagcaccatagaagcatcagaccag
gtctctgatgatacagtggaaatgcctcttccaaagaagttgaaaagtgttacccctgta
ggaactgaggaagaagttatggcagaagaaagtactgatggagaggtagaaactcaagta
tacaatcaagattctcaagattccattggagaaggagttactcagggagattatactcca
atggaagacagtgaagaaacctctcagtctttacaaatagaccttggaccacttcagtca
gatcagcaaacaacaacttcatcccaagatggtcagggcaaaggagatgatgtcattgta
attgacagtgatgatgaagaagaggatgatgatgaaaatgatggagaacatgaggattat
gaagaggatgaagaagatgatgacgatgatgaagatgacacagggatgggagacgagggt
gaggatagtaacgaaggcactggtagtgcagatggcaatgatggatatgaagctgatgat
gctgagggtggtgatgggactgatccaggcacagaaacagaagaaagtatgggtggaggt
gaaagtaatcagagagctgctgattctcaaaacagtggtgaaggtaatacaggtactgca
gagtcatctttttcccaggacatttctagagaacagcagccatcatcggcatctgaaaga
cagactccccgagcacctcagtctccaagacgccccccacaccctcttcctccacgattg
accatccatgctccacctcaagaattgggaccaccagttcagagaattcagatgactcgg
aggcaatctgtaggacgggggctgcagttgactccaggaataggtggcatgcagcagcat
ttttttgatgatgaagacagaactgttccaagtactccaactcttgtggttccacatcgt
actgatggatttgctgaagcaattcattccccacaagttgctggtgttcctagattccgg
tttgggccacctgaagatatgccacaaacaagttcaagtcactctgatcttggccaactt
gcttctcaaggaggcttaggaatgtatgaaacacccctcttcctagctcatgaagaagaa
tcaggtggccgaagtgttcccactacccctctacaagtagcagccccagtgaccgtgttt
actgagagtactacctctgatgcttcagagcatgcctctcagtctgttccgatggtgaca
acatccactggcactttatccacaacaaatgaaacagcaacaggtgatgatggagatgaa
gtatttgtggaggcagaatctgaaggcatcagctcagaagcaggcctagaaattgatagc
cagcaggaagaagaacctgtccaagcatctgatgaatcagatcttccttctaccagccag
gatcctccttccagttcctctgtagatactagcagtagtcaaccaaagcctttcagaaga
gtaagacttcagacaacattgagacaaggtgtccgtggtcgtcagtttaacagacagaga
ggtgtgagccatgcaatgggagggagaggaggaataaatagaggaaatattaattaa

DBGET integrated database retrieval system