KEGG   Vulpes vulpes (red fox): 112913170
Entry
112913170         CDS       T05911                                 

Gene name
PIK3R2
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit beta
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp01524  Platinum drug resistance
vvp04012  ErbB signaling pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04024  cAMP signaling pathway
vvp04062  Chemokine signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04068  FoxO signaling pathway
vvp04070  Phosphatidylinositol signaling system
vvp04071  Sphingolipid signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04140  Autophagy - animal
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04210  Apoptosis
vvp04211  Longevity regulating pathway
vvp04213  Longevity regulating pathway - multiple species
vvp04218  Cellular senescence
vvp04360  Axon guidance
vvp04370  VEGF signaling pathway
vvp04380  Osteoclast differentiation
vvp04510  Focal adhesion
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04611  Platelet activation
vvp04613  Neutrophil extracellular trap formation
vvp04620  Toll-like receptor signaling pathway
vvp04625  C-type lectin receptor signaling pathway
vvp04630  JAK-STAT signaling pathway
vvp04650  Natural killer cell mediated cytotoxicity
vvp04660  T cell receptor signaling pathway
vvp04662  B cell receptor signaling pathway
vvp04664  Fc epsilon RI signaling pathway
vvp04666  Fc gamma R-mediated phagocytosis
vvp04668  TNF signaling pathway
vvp04670  Leukocyte transendothelial migration
vvp04722  Neurotrophin signaling pathway
vvp04725  Cholinergic synapse
vvp04750  Inflammatory mediator regulation of TRP channels
vvp04810  Regulation of actin cytoskeleton
vvp04910  Insulin signaling pathway
vvp04914  Progesterone-mediated oocyte maturation
vvp04915  Estrogen signaling pathway
vvp04917  Prolactin signaling pathway
vvp04919  Thyroid hormone signaling pathway
vvp04923  Regulation of lipolysis in adipocytes
vvp04926  Relaxin signaling pathway
vvp04929  GnRH secretion
vvp04930  Type II diabetes mellitus
vvp04931  Insulin resistance
vvp04932  Non-alcoholic fatty liver disease
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04935  Growth hormone synthesis, secretion and action
vvp04960  Aldosterone-regulated sodium reabsorption
vvp04973  Carbohydrate digestion and absorption
vvp05010  Alzheimer disease
vvp05017  Spinocerebellar ataxia
vvp05020  Prion disease
vvp05100  Bacterial invasion of epithelial cells
vvp05135  Yersinia infection
vvp05142  Chagas disease
vvp05146  Amoebiasis
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05171  Coronavirus disease - COVID-19
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05210  Colorectal cancer
vvp05211  Renal cell carcinoma
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05218  Melanoma
vvp05220  Chronic myeloid leukemia
vvp05221  Acute myeloid leukemia
vvp05222  Small cell lung cancer
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05230  Central carbon metabolism in cancer
vvp05231  Choline metabolism in cancer
vvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112913170 (PIK3R2)
   04014 Ras signaling pathway
    112913170 (PIK3R2)
   04015 Rap1 signaling pathway
    112913170 (PIK3R2)
   04370 VEGF signaling pathway
    112913170 (PIK3R2)
   04630 JAK-STAT signaling pathway
    112913170 (PIK3R2)
   04668 TNF signaling pathway
    112913170 (PIK3R2)
   04066 HIF-1 signaling pathway
    112913170 (PIK3R2)
   04068 FoxO signaling pathway
    112913170 (PIK3R2)
   04070 Phosphatidylinositol signaling system
    112913170 (PIK3R2)
   04072 Phospholipase D signaling pathway
    112913170 (PIK3R2)
   04071 Sphingolipid signaling pathway
    112913170 (PIK3R2)
   04024 cAMP signaling pathway
    112913170 (PIK3R2)
   04151 PI3K-Akt signaling pathway
    112913170 (PIK3R2)
   04152 AMPK signaling pathway
    112913170 (PIK3R2)
   04150 mTOR signaling pathway
    112913170 (PIK3R2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112913170 (PIK3R2)
  09143 Cell growth and death
   04210 Apoptosis
    112913170 (PIK3R2)
   04218 Cellular senescence
    112913170 (PIK3R2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112913170 (PIK3R2)
   04550 Signaling pathways regulating pluripotency of stem cells
    112913170 (PIK3R2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112913170 (PIK3R2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112913170 (PIK3R2)
   04613 Neutrophil extracellular trap formation
    112913170 (PIK3R2)
   04620 Toll-like receptor signaling pathway
    112913170 (PIK3R2)
   04625 C-type lectin receptor signaling pathway
    112913170 (PIK3R2)
   04650 Natural killer cell mediated cytotoxicity
    112913170 (PIK3R2)
   04660 T cell receptor signaling pathway
    112913170 (PIK3R2)
   04662 B cell receptor signaling pathway
    112913170 (PIK3R2)
   04664 Fc epsilon RI signaling pathway
    112913170 (PIK3R2)
   04666 Fc gamma R-mediated phagocytosis
    112913170 (PIK3R2)
   04670 Leukocyte transendothelial migration
    112913170 (PIK3R2)
   04062 Chemokine signaling pathway
    112913170 (PIK3R2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112913170 (PIK3R2)
   04923 Regulation of lipolysis in adipocytes
    112913170 (PIK3R2)
   04929 GnRH secretion
    112913170 (PIK3R2)
   04915 Estrogen signaling pathway
    112913170 (PIK3R2)
   04914 Progesterone-mediated oocyte maturation
    112913170 (PIK3R2)
   04917 Prolactin signaling pathway
    112913170 (PIK3R2)
   04926 Relaxin signaling pathway
    112913170 (PIK3R2)
   04935 Growth hormone synthesis, secretion and action
    112913170 (PIK3R2)
   04919 Thyroid hormone signaling pathway
    112913170 (PIK3R2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    112913170 (PIK3R2)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112913170 (PIK3R2)
  09156 Nervous system
   04725 Cholinergic synapse
    112913170 (PIK3R2)
   04722 Neurotrophin signaling pathway
    112913170 (PIK3R2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112913170 (PIK3R2)
  09158 Development and regeneration
   04360 Axon guidance
    112913170 (PIK3R2)
   04380 Osteoclast differentiation
    112913170 (PIK3R2)
  09149 Aging
   04211 Longevity regulating pathway
    112913170 (PIK3R2)
   04213 Longevity regulating pathway - multiple species
    112913170 (PIK3R2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112913170 (PIK3R2)
   05206 MicroRNAs in cancer
    112913170 (PIK3R2)
   05205 Proteoglycans in cancer
    112913170 (PIK3R2)
   05203 Viral carcinogenesis
    112913170 (PIK3R2)
   05230 Central carbon metabolism in cancer
    112913170 (PIK3R2)
   05231 Choline metabolism in cancer
    112913170 (PIK3R2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112913170 (PIK3R2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112913170 (PIK3R2)
   05212 Pancreatic cancer
    112913170 (PIK3R2)
   05225 Hepatocellular carcinoma
    112913170 (PIK3R2)
   05226 Gastric cancer
    112913170 (PIK3R2)
   05214 Glioma
    112913170 (PIK3R2)
   05221 Acute myeloid leukemia
    112913170 (PIK3R2)
   05220 Chronic myeloid leukemia
    112913170 (PIK3R2)
   05218 Melanoma
    112913170 (PIK3R2)
   05211 Renal cell carcinoma
    112913170 (PIK3R2)
   05215 Prostate cancer
    112913170 (PIK3R2)
   05213 Endometrial cancer
    112913170 (PIK3R2)
   05224 Breast cancer
    112913170 (PIK3R2)
   05222 Small cell lung cancer
    112913170 (PIK3R2)
   05223 Non-small cell lung cancer
    112913170 (PIK3R2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112913170 (PIK3R2)
   05017 Spinocerebellar ataxia
    112913170 (PIK3R2)
   05020 Prion disease
    112913170 (PIK3R2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112913170 (PIK3R2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112913170 (PIK3R2)
   04932 Non-alcoholic fatty liver disease
    112913170 (PIK3R2)
   04931 Insulin resistance
    112913170 (PIK3R2)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112913170 (PIK3R2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112913170 (PIK3R2)
   05100 Bacterial invasion of epithelial cells
    112913170 (PIK3R2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112913170 (PIK3R2)
   05170 Human immunodeficiency virus 1 infection
    112913170 (PIK3R2)
   05161 Hepatitis B
    112913170 (PIK3R2)
   05160 Hepatitis C
    112913170 (PIK3R2)
   05171 Coronavirus disease - COVID-19
    112913170 (PIK3R2)
   05164 Influenza A
    112913170 (PIK3R2)
   05162 Measles
    112913170 (PIK3R2)
   05168 Herpes simplex virus 1 infection
    112913170 (PIK3R2)
   05163 Human cytomegalovirus infection
    112913170 (PIK3R2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112913170 (PIK3R2)
   05169 Epstein-Barr virus infection
    112913170 (PIK3R2)
   05165 Human papillomavirus infection
    112913170 (PIK3R2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112913170 (PIK3R2)
   05142 Chagas disease
    112913170 (PIK3R2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112913170 (PIK3R2)
   01524 Platinum drug resistance
    112913170 (PIK3R2)
   01522 Endocrine resistance
    112913170 (PIK3R2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvp04131]
    112913170 (PIK3R2)
Membrane trafficking [BR:vvp04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112913170 (PIK3R2)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 ATG11 Ribosomal_L22e Tai4
Other DBs
NCBI-GeneID: 112913170
NCBI-ProteinID: XP_025845563
UniProt: A0A3Q7RK27
LinkDB
Position
Unknown
AA seq 705 aa
MAGAEGFQYRALYPFRRERPEDLELLPGDVLVVSRAALQVLGVAEGNERCPQSVGWMPGL
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDGPPEPGLTLPDLPEQFSP
PDVAPPLLVKLVEAIERTGLDSESLYRPELPAPRTDWSLSDVEQWDAAALTDGVKSFLLA
LPAPLVTPEAAAEARRALRAFIECLLHIQKQESASHTCLSSTLPYTCLPVPLPQAAKHGP
THCPPLPPRTEPSPDFPVLLVEKLLQEHLEEQEVTPPALPPKPPKAKPAPAGLANGGSPP
SLQDAEWYWGDISREEVNEKLRDTPDGTFLVRDASSKIQGEYTLTLRKGGNNKLIKVFHR
DGHYGFSEPLTFCSVVDLITHYRHESLAQYNAKLDTRLLYPVSKYQQDQIVKEDSVEAVG
AQLKVYHQQYQDKSREYDQLYEEYTRTSQELQMKRTAIEAFNETIKIFEEQGQTQEKCSK
EYLERFRREGNEKEMQRILLNSERLKSRIAEIHESRTKLEQELRAQASDNREIDKRMNSL
KPDLMQLRKIRDQYLVWLTQKGARQKKINEWLGIKNETEDQYALMEDEDDLPHHEERTWY
VGKINRTQAEEMLSGKRDGTFLIRESSQRGCYACSVVVDGDTKHCVIYRTATGFGFAEPY
NLYGSLKELVLHYQHASLVQHNDALTVTLAHPVRAPGPGPPPATR
NT seq 2118 nt   +upstreamnt  +downstreamnt
atggccggtgctgagggcttccagtaccgagcactgtacccattccgccgggagcggccg
gaggacctggagctgctgccgggcgacgtgctggtggtgagccgggcagccctgcaggtg
ctgggcgtggctgagggcaacgagcgctgcccacagagcgtgggctggatgcctggcctc
aatgaacgcacgcggcaacgaggtgacttccccggcacctacgtcgagttcctgggtcct
gtagccctggcccggcccggccctcgtccacgtggcccccgcccactgcccgccaggccc
cgggatgggccccctgagccaggcctcacactccccgacctgccagagcagttctcccca
cctgatgttgctcctccactcctcgtgaagctggtggaggccattgaacggacagggcta
gacagcgagtccctctacaggcctgagctgcccgccccgcgcacagactggtccctgagc
gacgtggagcagtgggacgccgcggccctgacggacggcgtcaagagcttcctgctggcg
ctgcccgcgcccctcgtgacgcccgaggccgcggccgaggcgcgccgggccctgcgggca
tttattgagtgcctgctgcatatacagaagcaggagtcagcctcccacacctgcctgtca
tcgaccctgccctacacgtgccttcccgtacctctgccccaggcggccaagcacggtcct
acccactgccctcctcttccccctaggactgagcccagccctgacttccctgtgctgctg
gtggagaagttgctccaggaacacctggaggagcaggaggtcacacccccagcgctgcca
cctaaacctcccaaggcaaagccagcccctgcaggcctcgccaacggagggagtccgccc
tccctgcaggacgctgagtggtactggggtgacatctctagggaggaagtgaatgagaaa
ctccgggacacacctgatggcacctttctggtccgagatgcatctagcaagatccaggga
gagtacacactgaccctcaggaaaggcgggaataacaagctgattaaggtcttccaccgc
gatgggcactatggcttctcagagccactcaccttctgctctgtcgtggacctcatcacc
cactaccgccatgagtcgctggcccagtacaacgccaaactggacacacgcctcctctac
ccagtgtccaagtaccagcaggaccagattgtcaaggaggacagcgtggaggcggtgggt
gcccagctcaaagtctatcaccagcagtaccaggacaaaagccgcgagtatgaccagctc
tatgaggagtacacccgcacctcccaggaactgcagatgaagcgcacagcaattgaggcc
ttcaatgagaccatcaagatctttgaagaacagggccagacgcaagagaagtgtagcaag
gagtatttggagcgcttccgacgtgagggcaatgagaaagaaatgcagaggatcctactg
aactcagagcggctcaagtctcgcatcgctgagatccatgagagccgcacaaagctggag
caggagctgcgggcacaggcttcagacaaccgggagattgacaagcgcatgaacagcctc
aagccagacctcatgcagctgcgcaagatccgagaccaatacctagtgtggcttacccag
aaaggtgcccggcagaagaaaatcaacgagtggttggggatcaaaaatgagactgaggac
cagtatgcgctgatggaggacgaggacgacctcccccaccacgaggaacgcacgtggtat
gtgggcaagatcaaccggacacaggctgaggaaatgctgagtggcaagcgggatggtacc
ttcctcatccgtgagagcagccagcggggctgctatgcctgctctgtggtggtggacggc
gacaccaagcactgcgtcatctaccgcacggccactggcttcggcttcgcggagccctac
aacctatacgggtctctgaaggagctggtgctgcactaccagcacgcctccctggtgcaa
cacaacgacgcgctcacggtcacgctcgcccaccccgtgcgggcccccggccccgggcct
ccgcccgccacccgctga

KEGG   Vulpes vulpes (red fox): 112914774
Entry
112914774         CDS       T05911                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp01524  Platinum drug resistance
vvp04012  ErbB signaling pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04024  cAMP signaling pathway
vvp04062  Chemokine signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04068  FoxO signaling pathway
vvp04070  Phosphatidylinositol signaling system
vvp04071  Sphingolipid signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04140  Autophagy - animal
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04210  Apoptosis
vvp04211  Longevity regulating pathway
vvp04213  Longevity regulating pathway - multiple species
vvp04218  Cellular senescence
vvp04360  Axon guidance
vvp04370  VEGF signaling pathway
vvp04380  Osteoclast differentiation
vvp04510  Focal adhesion
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04611  Platelet activation
vvp04613  Neutrophil extracellular trap formation
vvp04620  Toll-like receptor signaling pathway
vvp04625  C-type lectin receptor signaling pathway
vvp04630  JAK-STAT signaling pathway
vvp04650  Natural killer cell mediated cytotoxicity
vvp04660  T cell receptor signaling pathway
vvp04662  B cell receptor signaling pathway
vvp04664  Fc epsilon RI signaling pathway
vvp04666  Fc gamma R-mediated phagocytosis
vvp04668  TNF signaling pathway
vvp04670  Leukocyte transendothelial migration
vvp04722  Neurotrophin signaling pathway
vvp04725  Cholinergic synapse
vvp04750  Inflammatory mediator regulation of TRP channels
vvp04810  Regulation of actin cytoskeleton
vvp04910  Insulin signaling pathway
vvp04914  Progesterone-mediated oocyte maturation
vvp04915  Estrogen signaling pathway
vvp04917  Prolactin signaling pathway
vvp04919  Thyroid hormone signaling pathway
vvp04923  Regulation of lipolysis in adipocytes
vvp04926  Relaxin signaling pathway
vvp04929  GnRH secretion
vvp04930  Type II diabetes mellitus
vvp04931  Insulin resistance
vvp04932  Non-alcoholic fatty liver disease
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04935  Growth hormone synthesis, secretion and action
vvp04960  Aldosterone-regulated sodium reabsorption
vvp04973  Carbohydrate digestion and absorption
vvp05010  Alzheimer disease
vvp05017  Spinocerebellar ataxia
vvp05020  Prion disease
vvp05100  Bacterial invasion of epithelial cells
vvp05135  Yersinia infection
vvp05142  Chagas disease
vvp05146  Amoebiasis
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05171  Coronavirus disease - COVID-19
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05210  Colorectal cancer
vvp05211  Renal cell carcinoma
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05218  Melanoma
vvp05220  Chronic myeloid leukemia
vvp05221  Acute myeloid leukemia
vvp05222  Small cell lung cancer
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05230  Central carbon metabolism in cancer
vvp05231  Choline metabolism in cancer
vvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112914774
   04014 Ras signaling pathway
    112914774
   04015 Rap1 signaling pathway
    112914774
   04370 VEGF signaling pathway
    112914774
   04630 JAK-STAT signaling pathway
    112914774
   04668 TNF signaling pathway
    112914774
   04066 HIF-1 signaling pathway
    112914774
   04068 FoxO signaling pathway
    112914774
   04070 Phosphatidylinositol signaling system
    112914774
   04072 Phospholipase D signaling pathway
    112914774
   04071 Sphingolipid signaling pathway
    112914774
   04024 cAMP signaling pathway
    112914774
   04151 PI3K-Akt signaling pathway
    112914774
   04152 AMPK signaling pathway
    112914774
   04150 mTOR signaling pathway
    112914774
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112914774
  09143 Cell growth and death
   04210 Apoptosis
    112914774
   04218 Cellular senescence
    112914774
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112914774
   04550 Signaling pathways regulating pluripotency of stem cells
    112914774
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112914774
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112914774
   04613 Neutrophil extracellular trap formation
    112914774
   04620 Toll-like receptor signaling pathway
    112914774
   04625 C-type lectin receptor signaling pathway
    112914774
   04650 Natural killer cell mediated cytotoxicity
    112914774
   04660 T cell receptor signaling pathway
    112914774
   04662 B cell receptor signaling pathway
    112914774
   04664 Fc epsilon RI signaling pathway
    112914774
   04666 Fc gamma R-mediated phagocytosis
    112914774
   04670 Leukocyte transendothelial migration
    112914774
   04062 Chemokine signaling pathway
    112914774
  09152 Endocrine system
   04910 Insulin signaling pathway
    112914774
   04923 Regulation of lipolysis in adipocytes
    112914774
   04929 GnRH secretion
    112914774
   04915 Estrogen signaling pathway
    112914774
   04914 Progesterone-mediated oocyte maturation
    112914774
   04917 Prolactin signaling pathway
    112914774
   04926 Relaxin signaling pathway
    112914774
   04935 Growth hormone synthesis, secretion and action
    112914774
   04919 Thyroid hormone signaling pathway
    112914774
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    112914774
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112914774
  09156 Nervous system
   04725 Cholinergic synapse
    112914774
   04722 Neurotrophin signaling pathway
    112914774
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112914774
  09158 Development and regeneration
   04360 Axon guidance
    112914774
   04380 Osteoclast differentiation
    112914774
  09149 Aging
   04211 Longevity regulating pathway
    112914774
   04213 Longevity regulating pathway - multiple species
    112914774
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112914774
   05206 MicroRNAs in cancer
    112914774
   05205 Proteoglycans in cancer
    112914774
   05203 Viral carcinogenesis
    112914774
   05230 Central carbon metabolism in cancer
    112914774
   05231 Choline metabolism in cancer
    112914774
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112914774
  09162 Cancer: specific types
   05210 Colorectal cancer
    112914774
   05212 Pancreatic cancer
    112914774
   05225 Hepatocellular carcinoma
    112914774
   05226 Gastric cancer
    112914774
   05214 Glioma
    112914774
   05221 Acute myeloid leukemia
    112914774
   05220 Chronic myeloid leukemia
    112914774
   05218 Melanoma
    112914774
   05211 Renal cell carcinoma
    112914774
   05215 Prostate cancer
    112914774
   05213 Endometrial cancer
    112914774
   05224 Breast cancer
    112914774
   05222 Small cell lung cancer
    112914774
   05223 Non-small cell lung cancer
    112914774
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112914774
   05017 Spinocerebellar ataxia
    112914774
   05020 Prion disease
    112914774
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112914774
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112914774
   04932 Non-alcoholic fatty liver disease
    112914774
   04931 Insulin resistance
    112914774
   04933 AGE-RAGE signaling pathway in diabetic complications
    112914774
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112914774
   05100 Bacterial invasion of epithelial cells
    112914774
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112914774
   05170 Human immunodeficiency virus 1 infection
    112914774
   05161 Hepatitis B
    112914774
   05160 Hepatitis C
    112914774
   05171 Coronavirus disease - COVID-19
    112914774
   05164 Influenza A
    112914774
   05162 Measles
    112914774
   05168 Herpes simplex virus 1 infection
    112914774
   05163 Human cytomegalovirus infection
    112914774
   05167 Kaposi sarcoma-associated herpesvirus infection
    112914774
   05169 Epstein-Barr virus infection
    112914774
   05165 Human papillomavirus infection
    112914774
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112914774
   05142 Chagas disease
    112914774
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112914774
   01524 Platinum drug resistance
    112914774
   01522 Endocrine resistance
    112914774
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvp04131]
    112914774
Membrane trafficking [BR:vvp04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112914774
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Transcrip_act Fez1 DUF5638 PI_PP_I
Other DBs
NCBI-GeneID: 112914774
NCBI-ProteinID: XP_025847703
UniProt: A0A3Q7RR73
LinkDB
Position
Unknown
AA seq 461 aa
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVTNGMKDSSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKKQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNAWLGIKNEDADETYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgtacaatacggtgtggagtatggaccgcgatgacgcagactggagggaggtgatgatg
ccctattcgacagaactgatattttatattgaaatggatcctccagctcttccaccaaag
ccacctaagccaatgacttcagccgttacaaatggaatgaaggacagttctgtttctctt
caggatgcagaatggtactggggggatatctcaagggaggaggtaaatgacaaattaagg
gatatgccagatggtacgttcttggtcagagatgcctcaacaaaaatgcagggggattac
accttgactttgcggaagggaggcaataataagttaataaagatctatcatcgagatggt
aaatatggcttttctgatcctctgacatttaattctgtggtggagctcattaaccactat
catcatgaatctcttgctcagtacaatcccaaacttgatgtgaagctgatgtacccagtg
tccagataccaacaggaccaattggtaaaagaagacaacattgatgcagttggtaaaaaa
ctgcaagagtaccactctcagtatcaggaaaagagtaaagagtatgaccggctatatgag
gaatataccagaacatcccaggaaatacagatgaagaggactgcaattgaagcctttaat
gaaacaattaaaatatttgaagagcaatgtcacacacaagaacaacatagcaaagaatat
attgagcgatttcgcagagaggggaatgaaaaggaaattgaacgaattatgatgaattat
gacaaattgaaatcacgtctgggtgagattcatgatagcaaaatgcgtctagagcaggat
ttgaagaaacaagctttggacaaccgggaaatagataaaaaaatgaacagtatcaaacct
gatctgatccagctgcgcaagatccgagatcagcaccttgtatggctcaatcataaagga
gtgagacagaagcgtctaaatgcctggctaggaatcaagaatgaggatgctgatgagacc
tattttatcaatgaggaagatgaaaacctaccccattatgatgagaaaacctggtttgtt
gaggatatcaatcgagtacaagcagaggacttgctttatgggaaacctgatggtgcattt
ttaattcgtgagagtagcaagaaaggatgttatgcttgctctgtggttgccgatggggaa
gtgaagcactgtgtgatctacagcactgctcggggctatggctttgcagagccctacaac
ctgtacagctccctgaaggagctggtgctccattaccagcagacgtccctcgtgcagcac
aacgactccctcaacgtcaggcttgcctaccctgtccacgcacagatgccctcactctgc
agataa

KEGG   Vulpes vulpes (red fox): 112924665
Entry
112924665         CDS       T05911                                 

Gene name
PIK3CD
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp00562  Inositol phosphate metabolism
vvp01100  Metabolic pathways
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp01524  Platinum drug resistance
vvp04012  ErbB signaling pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04024  cAMP signaling pathway
vvp04062  Chemokine signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04068  FoxO signaling pathway
vvp04070  Phosphatidylinositol signaling system
vvp04071  Sphingolipid signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04140  Autophagy - animal
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04210  Apoptosis
vvp04211  Longevity regulating pathway
vvp04213  Longevity regulating pathway - multiple species
vvp04218  Cellular senescence
vvp04360  Axon guidance
vvp04370  VEGF signaling pathway
vvp04380  Osteoclast differentiation
vvp04510  Focal adhesion
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04611  Platelet activation
vvp04613  Neutrophil extracellular trap formation
vvp04620  Toll-like receptor signaling pathway
vvp04625  C-type lectin receptor signaling pathway
vvp04630  JAK-STAT signaling pathway
vvp04650  Natural killer cell mediated cytotoxicity
vvp04660  T cell receptor signaling pathway
vvp04662  B cell receptor signaling pathway
vvp04664  Fc epsilon RI signaling pathway
vvp04666  Fc gamma R-mediated phagocytosis
vvp04668  TNF signaling pathway
vvp04670  Leukocyte transendothelial migration
vvp04722  Neurotrophin signaling pathway
vvp04725  Cholinergic synapse
vvp04750  Inflammatory mediator regulation of TRP channels
vvp04810  Regulation of actin cytoskeleton
vvp04910  Insulin signaling pathway
vvp04914  Progesterone-mediated oocyte maturation
vvp04915  Estrogen signaling pathway
vvp04917  Prolactin signaling pathway
vvp04919  Thyroid hormone signaling pathway
vvp04923  Regulation of lipolysis in adipocytes
vvp04926  Relaxin signaling pathway
vvp04929  GnRH secretion
vvp04930  Type II diabetes mellitus
vvp04931  Insulin resistance
vvp04932  Non-alcoholic fatty liver disease
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04935  Growth hormone synthesis, secretion and action
vvp04960  Aldosterone-regulated sodium reabsorption
vvp04973  Carbohydrate digestion and absorption
vvp05010  Alzheimer disease
vvp05017  Spinocerebellar ataxia
vvp05020  Prion disease
vvp05100  Bacterial invasion of epithelial cells
vvp05132  Salmonella infection
vvp05135  Yersinia infection
vvp05142  Chagas disease
vvp05146  Amoebiasis
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05171  Coronavirus disease - COVID-19
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05210  Colorectal cancer
vvp05211  Renal cell carcinoma
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05218  Melanoma
vvp05220  Chronic myeloid leukemia
vvp05221  Acute myeloid leukemia
vvp05222  Small cell lung cancer
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05230  Central carbon metabolism in cancer
vvp05231  Choline metabolism in cancer
vvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112924665 (PIK3CD)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112924665 (PIK3CD)
   04014 Ras signaling pathway
    112924665 (PIK3CD)
   04015 Rap1 signaling pathway
    112924665 (PIK3CD)
   04370 VEGF signaling pathway
    112924665 (PIK3CD)
   04630 JAK-STAT signaling pathway
    112924665 (PIK3CD)
   04668 TNF signaling pathway
    112924665 (PIK3CD)
   04066 HIF-1 signaling pathway
    112924665 (PIK3CD)
   04068 FoxO signaling pathway
    112924665 (PIK3CD)
   04070 Phosphatidylinositol signaling system
    112924665 (PIK3CD)
   04072 Phospholipase D signaling pathway
    112924665 (PIK3CD)
   04071 Sphingolipid signaling pathway
    112924665 (PIK3CD)
   04024 cAMP signaling pathway
    112924665 (PIK3CD)
   04151 PI3K-Akt signaling pathway
    112924665 (PIK3CD)
   04152 AMPK signaling pathway
    112924665 (PIK3CD)
   04150 mTOR signaling pathway
    112924665 (PIK3CD)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112924665 (PIK3CD)
  09143 Cell growth and death
   04210 Apoptosis
    112924665 (PIK3CD)
   04218 Cellular senescence
    112924665 (PIK3CD)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112924665 (PIK3CD)
   04550 Signaling pathways regulating pluripotency of stem cells
    112924665 (PIK3CD)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112924665 (PIK3CD)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112924665 (PIK3CD)
   04613 Neutrophil extracellular trap formation
    112924665 (PIK3CD)
   04620 Toll-like receptor signaling pathway
    112924665 (PIK3CD)
   04625 C-type lectin receptor signaling pathway
    112924665 (PIK3CD)
   04650 Natural killer cell mediated cytotoxicity
    112924665 (PIK3CD)
   04660 T cell receptor signaling pathway
    112924665 (PIK3CD)
   04662 B cell receptor signaling pathway
    112924665 (PIK3CD)
   04664 Fc epsilon RI signaling pathway
    112924665 (PIK3CD)
   04666 Fc gamma R-mediated phagocytosis
    112924665 (PIK3CD)
   04670 Leukocyte transendothelial migration
    112924665 (PIK3CD)
   04062 Chemokine signaling pathway
    112924665 (PIK3CD)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112924665 (PIK3CD)
   04923 Regulation of lipolysis in adipocytes
    112924665 (PIK3CD)
   04929 GnRH secretion
    112924665 (PIK3CD)
   04915 Estrogen signaling pathway
    112924665 (PIK3CD)
   04914 Progesterone-mediated oocyte maturation
    112924665 (PIK3CD)
   04917 Prolactin signaling pathway
    112924665 (PIK3CD)
   04926 Relaxin signaling pathway
    112924665 (PIK3CD)
   04935 Growth hormone synthesis, secretion and action
    112924665 (PIK3CD)
   04919 Thyroid hormone signaling pathway
    112924665 (PIK3CD)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    112924665 (PIK3CD)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112924665 (PIK3CD)
  09156 Nervous system
   04725 Cholinergic synapse
    112924665 (PIK3CD)
   04722 Neurotrophin signaling pathway
    112924665 (PIK3CD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112924665 (PIK3CD)
  09158 Development and regeneration
   04360 Axon guidance
    112924665 (PIK3CD)
   04380 Osteoclast differentiation
    112924665 (PIK3CD)
  09149 Aging
   04211 Longevity regulating pathway
    112924665 (PIK3CD)
   04213 Longevity regulating pathway - multiple species
    112924665 (PIK3CD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112924665 (PIK3CD)
   05206 MicroRNAs in cancer
    112924665 (PIK3CD)
   05205 Proteoglycans in cancer
    112924665 (PIK3CD)
   05203 Viral carcinogenesis
    112924665 (PIK3CD)
   05230 Central carbon metabolism in cancer
    112924665 (PIK3CD)
   05231 Choline metabolism in cancer
    112924665 (PIK3CD)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112924665 (PIK3CD)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112924665 (PIK3CD)
   05212 Pancreatic cancer
    112924665 (PIK3CD)
   05225 Hepatocellular carcinoma
    112924665 (PIK3CD)
   05226 Gastric cancer
    112924665 (PIK3CD)
   05214 Glioma
    112924665 (PIK3CD)
   05221 Acute myeloid leukemia
    112924665 (PIK3CD)
   05220 Chronic myeloid leukemia
    112924665 (PIK3CD)
   05218 Melanoma
    112924665 (PIK3CD)
   05211 Renal cell carcinoma
    112924665 (PIK3CD)
   05215 Prostate cancer
    112924665 (PIK3CD)
   05213 Endometrial cancer
    112924665 (PIK3CD)
   05224 Breast cancer
    112924665 (PIK3CD)
   05222 Small cell lung cancer
    112924665 (PIK3CD)
   05223 Non-small cell lung cancer
    112924665 (PIK3CD)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112924665 (PIK3CD)
   05017 Spinocerebellar ataxia
    112924665 (PIK3CD)
   05020 Prion disease
    112924665 (PIK3CD)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112924665 (PIK3CD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112924665 (PIK3CD)
   04932 Non-alcoholic fatty liver disease
    112924665 (PIK3CD)
   04931 Insulin resistance
    112924665 (PIK3CD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112924665 (PIK3CD)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112924665 (PIK3CD)
   05135 Yersinia infection
    112924665 (PIK3CD)
   05100 Bacterial invasion of epithelial cells
    112924665 (PIK3CD)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112924665 (PIK3CD)
   05170 Human immunodeficiency virus 1 infection
    112924665 (PIK3CD)
   05161 Hepatitis B
    112924665 (PIK3CD)
   05160 Hepatitis C
    112924665 (PIK3CD)
   05171 Coronavirus disease - COVID-19
    112924665 (PIK3CD)
   05164 Influenza A
    112924665 (PIK3CD)
   05162 Measles
    112924665 (PIK3CD)
   05168 Herpes simplex virus 1 infection
    112924665 (PIK3CD)
   05163 Human cytomegalovirus infection
    112924665 (PIK3CD)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112924665 (PIK3CD)
   05169 Epstein-Barr virus infection
    112924665 (PIK3CD)
   05165 Human papillomavirus infection
    112924665 (PIK3CD)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112924665 (PIK3CD)
   05142 Chagas disease
    112924665 (PIK3CD)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112924665 (PIK3CD)
   01524 Platinum drug resistance
    112924665 (PIK3CD)
   01522 Endocrine resistance
    112924665 (PIK3CD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvp04131]
    112924665 (PIK3CD)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     112924665 (PIK3CD)
Membrane trafficking [BR:vvp04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112924665 (PIK3CD)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DUF4135
Other DBs
NCBI-GeneID: 112924665
NCBI-ProteinID: XP_025860847
UniProt: A0A3Q7THN3
LinkDB
Position
Unknown
AA seq 1044 aa
MPPGVDCPMEFWTKEENQSVAVDFLLPTGVYLNFPVSRNANLSTIKKVLWHRAQYEPLFH
MLSDPEAYVFTCVNQTAEQQELEDEQRRLCDIQPFLPVLRLVAREGDRVKKLVNSQISLL
IGKGLHEFDSLRDPEVNDFRTKMRQFCEEAAARRQQLGWEAWLQYCFPLQLEPSARSWGP
GTLRVPSRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYT
LQVNGKHEYLYGSYPLCQFQYICSCLHSGLTPHLTMVHSSSILAMRDEQSNPAPQVQKPR
TKPPPIPMKKPSSLSLWSLEQPFCVELIQGSKVNADERMKLVVQAGLFHGNETLCKTVSS
SEVSVCSEPVWKQRLEFDINVCDLPRMARLCFALYAVIEKAKKARSTKKKSKKADCPIAW
ANLMLFDYKDQLKTGECCLYMWPSVPDEKGELLNPTGTVRSNPNTESAAALVICLPEVAP
YPVYYPTLDKILELGRHGEHGRFSEEEQLQLREILERRGSGELYEHEKDLVWKMRHEVQE
RFPEALARLLLVTKWNKHEDVAQMLYLLCSWPELPVLSALELLDFSFPDRHVGSFAIKSL
RKLTDDELFQYLLQLVQVLKYESYLDCELTKFLLDRALANRKIGHFLFWHLRSEMHVPSV
ALRFGLIMEAYCRGSTHHMKVLMKQGEALSKLKALNDFVKVSSQKTTKPQTKELMHLCMR
QEAYLEALSNLQSPLDPSTLLAEVCVEQCTFMDSKMKPLWVMYSNEEAGSDGSVGIIFKN
GDDLRQDMLTLQMIQLMDVLWKQEGLDLRMTPYGCLSTGDRTGLIEVVLHSDTIANIQLN
KSNMAATAAFNKDALLNWLKSKNPGEALDRAIEEFTLSCAGYCVATYVLGIGDRHSDNIM
IRENGQLFHIDFGHFLGNFKTKFGINRERVPFILTYDFVHVIQQGKTNNSEKFERFRGYC
ERAYTILRRHGLLFLHLFALMRAAGLPELSCSKDIQYLKDSLALGKTEEEALKHFRVKFN
EALRESWKTKVNWLAHNVSKDNRQ
NT seq 3135 nt   +upstreamnt  +downstreamnt
atgccccctggggttgactgccccatggaattctggaccaaggaggagaatcagagtgtg
gctgttgacttcctgttgcccactggggtctatctgaacttccctgtgtctcggaatgcc
aacctcagcaccatcaagaaggtgttgtggcaccgagcccagtatgagccactcttccac
atgctcagcgaccctgaggcctatgtgttcacctgcgtcaaccagactgcggagcagcag
gagctggaagatgagcagcggcggctatgtgacattcagcccttcctgccagtgctgcgc
ctggtggcccgagagggtgacagggtgaagaagcttgtcaactcacagatcagcctcctc
atcggcaaaggcctccatgagttcgactccttgcgggaccccgaggtgaatgactttcgc
accaagatgcgccagttctgtgaggaggcggctgcccggcggcagcaactgggctgggag
gcctggcttcagtattgcttccccctgcagctggagccctcggcccggagctgggggcct
ggcaccctgcgggtccccagccgggccctcctggtcaacgtcaagttcgagggcagcgag
gagagcttcaccttccaggtgtccaccaaggatgtgccgctggcgctgatggcctgtgcc
ctccggaagaaggccacggtgttccggcagccgctggtggagcagccggaggactacacg
ctgcaggtgaacgggaagcacgagtacctgtatggcagctaccccctctgccagttccag
tacatctgcagctgcctgcacagcgggctgaccccccacctgaccatggtgcactcctcc
tccatcctcgccatgcgggacgagcagagcaaccctgccccccaagtccaaaaaccacgc
accaaaccaccccccattcccatgaagaagccttcttccttgtccctgtggtccctggag
cagcctttctgcgtggagctgatccagggcagcaaagtgaatgccgatgagcggatgaag
ctggtggtgcaggctgggcttttccacggcaatgagacgctgtgcaagacggtttcgagc
tcggaggtgagcgtgtgctcagagcctgtgtggaaacagcgactggagttcgacatcaac
gtgtgtgacctgcctcgcatggcccgtctctgctttgcactttatgctgtgatcgagaag
gccaagaaggctcgctcgaccaagaagaagtccaagaaggcggactgccccatcgcctgg
gccaacctcatgctgtttgactataaggaccagctcaagaccggtgaatgctgcctgtac
atgtggccctccgtcccagacgagaaaggggagctgctgaaccccacaggaacagtgcgg
agtaaccccaacacagagagcgcagcggccctggtcatctgcctgcctgaggtggctccc
taccccgtctactaccccaccctggacaagattctggagctggggcgacatggcgagcat
gggcgcttcagtgaggaggagcagctacagctgcgggaaatcctggagcggcgggggtcc
ggggagctgtatgagcacgagaaggacctggtgtggaagatgcggcacgaggtccaggag
cgcttccccgaggcgctggcccgcctgctgctggtcaccaagtggaacaagcatgaggat
gtggcccagatgctctacctgctgtgctcgtggcctgagctgcccgtcctgagcgccctg
gagctgctggacttcagcttcccggaccgccacgtgggctccttcgccatcaagtctctg
cggaagctgacggacgatgagcttttccagtacctgctgcagctggtgcaggtgctcaaa
tacgaatcctacctcgactgcgaactgaccaagttcctgctggaccgggccctggccaac
cgcaagattggccacttcctcttctggcaccttcgctccgagatgcacgtgccgtccgtg
gctctgcgcttcggcctcatcatggaggcctactgcaggggcagcacccaccacatgaag
gtgctcatgaagcagggggaggcactgagcaaactgaaggctctaaacgactttgtcaaa
gtgagctcccagaagaccaccaagccccagaccaaggagctgatgcacctgtgcatgcgc
caggaggcctacctggaggccctctccaacctgcagtccccactggaccccagtaccctg
ctggctgaagtctgcgtggagcagtgcaccttcatggactctaagatgaagcccctgtgg
gtcatgtacagcaacgaggaggcaggcagtgatggcagcgtgggcatcatcttcaagaat
ggggatgacctccgccaggatatgctgactttacagatgatccagctcatggacgtcctg
tggaagcaggagggattggacctgaggatgaccccctatggctgcctctccaccggggac
cgcacaggcctcatcgaggtggtgcttcactcggacaccatcgccaacatccagctaaac
aaaagcaacatggcggccacagctgccttcaacaaggatgccctgctcaactggctcaag
tccaagaacccaggggaggccttggatcgagccattgaggagttcaccctctcctgtgcc
ggctactgtgtggccacttacgtgctgggcatcggtgatcggcacagcgacaacatcatg
atccgcgagaatgggcagctgttccacatcgattttggccactttctggggaatttcaag
accaagtttggaatcaaccgtgagcgagtcccgttcatcctcacatatgactttgtgcac
gtgatccagcaagggaaaacgaataacagtgagaaatttgaaagattccgaggttactgt
gagcgagcctacaccatcctgcggcgccatgggctgctcttcctccacctctttgccctg
atgcgggctgccggcctgcctgagctcagctgctccaaagacatccagtatctcaaggac
tctctggcgttgggaaagacagaggaggaggctctaaagcacttccgagtgaagtttaac
gaagccctccgggagagctggaagaccaaagtgaactggctggcccacaatgtgtccaaa
gataacaggcaatag

KEGG   Vulpes vulpes (red fox): 112926217
Entry
112926217         CDS       T05911                                 

Gene name
PIK3CA
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp00562  Inositol phosphate metabolism
vvp01100  Metabolic pathways
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp01524  Platinum drug resistance
vvp04012  ErbB signaling pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04024  cAMP signaling pathway
vvp04062  Chemokine signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04068  FoxO signaling pathway
vvp04070  Phosphatidylinositol signaling system
vvp04071  Sphingolipid signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04140  Autophagy - animal
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04210  Apoptosis
vvp04211  Longevity regulating pathway
vvp04213  Longevity regulating pathway - multiple species
vvp04218  Cellular senescence
vvp04360  Axon guidance
vvp04370  VEGF signaling pathway
vvp04380  Osteoclast differentiation
vvp04510  Focal adhesion
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04611  Platelet activation
vvp04613  Neutrophil extracellular trap formation
vvp04620  Toll-like receptor signaling pathway
vvp04625  C-type lectin receptor signaling pathway
vvp04630  JAK-STAT signaling pathway
vvp04650  Natural killer cell mediated cytotoxicity
vvp04660  T cell receptor signaling pathway
vvp04662  B cell receptor signaling pathway
vvp04664  Fc epsilon RI signaling pathway
vvp04666  Fc gamma R-mediated phagocytosis
vvp04668  TNF signaling pathway
vvp04670  Leukocyte transendothelial migration
vvp04722  Neurotrophin signaling pathway
vvp04725  Cholinergic synapse
vvp04750  Inflammatory mediator regulation of TRP channels
vvp04810  Regulation of actin cytoskeleton
vvp04910  Insulin signaling pathway
vvp04914  Progesterone-mediated oocyte maturation
vvp04915  Estrogen signaling pathway
vvp04917  Prolactin signaling pathway
vvp04919  Thyroid hormone signaling pathway
vvp04923  Regulation of lipolysis in adipocytes
vvp04926  Relaxin signaling pathway
vvp04929  GnRH secretion
vvp04930  Type II diabetes mellitus
vvp04931  Insulin resistance
vvp04932  Non-alcoholic fatty liver disease
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04935  Growth hormone synthesis, secretion and action
vvp04960  Aldosterone-regulated sodium reabsorption
vvp04973  Carbohydrate digestion and absorption
vvp05010  Alzheimer disease
vvp05017  Spinocerebellar ataxia
vvp05020  Prion disease
vvp05100  Bacterial invasion of epithelial cells
vvp05132  Salmonella infection
vvp05135  Yersinia infection
vvp05142  Chagas disease
vvp05146  Amoebiasis
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05171  Coronavirus disease - COVID-19
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05210  Colorectal cancer
vvp05211  Renal cell carcinoma
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05218  Melanoma
vvp05220  Chronic myeloid leukemia
vvp05221  Acute myeloid leukemia
vvp05222  Small cell lung cancer
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05230  Central carbon metabolism in cancer
vvp05231  Choline metabolism in cancer
vvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112926217 (PIK3CA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112926217 (PIK3CA)
   04014 Ras signaling pathway
    112926217 (PIK3CA)
   04015 Rap1 signaling pathway
    112926217 (PIK3CA)
   04370 VEGF signaling pathway
    112926217 (PIK3CA)
   04630 JAK-STAT signaling pathway
    112926217 (PIK3CA)
   04668 TNF signaling pathway
    112926217 (PIK3CA)
   04066 HIF-1 signaling pathway
    112926217 (PIK3CA)
   04068 FoxO signaling pathway
    112926217 (PIK3CA)
   04070 Phosphatidylinositol signaling system
    112926217 (PIK3CA)
   04072 Phospholipase D signaling pathway
    112926217 (PIK3CA)
   04071 Sphingolipid signaling pathway
    112926217 (PIK3CA)
   04024 cAMP signaling pathway
    112926217 (PIK3CA)
   04151 PI3K-Akt signaling pathway
    112926217 (PIK3CA)
   04152 AMPK signaling pathway
    112926217 (PIK3CA)
   04150 mTOR signaling pathway
    112926217 (PIK3CA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112926217 (PIK3CA)
  09143 Cell growth and death
   04210 Apoptosis
    112926217 (PIK3CA)
   04218 Cellular senescence
    112926217 (PIK3CA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112926217 (PIK3CA)
   04550 Signaling pathways regulating pluripotency of stem cells
    112926217 (PIK3CA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112926217 (PIK3CA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112926217 (PIK3CA)
   04613 Neutrophil extracellular trap formation
    112926217 (PIK3CA)
   04620 Toll-like receptor signaling pathway
    112926217 (PIK3CA)
   04625 C-type lectin receptor signaling pathway
    112926217 (PIK3CA)
   04650 Natural killer cell mediated cytotoxicity
    112926217 (PIK3CA)
   04660 T cell receptor signaling pathway
    112926217 (PIK3CA)
   04662 B cell receptor signaling pathway
    112926217 (PIK3CA)
   04664 Fc epsilon RI signaling pathway
    112926217 (PIK3CA)
   04666 Fc gamma R-mediated phagocytosis
    112926217 (PIK3CA)
   04670 Leukocyte transendothelial migration
    112926217 (PIK3CA)
   04062 Chemokine signaling pathway
    112926217 (PIK3CA)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112926217 (PIK3CA)
   04923 Regulation of lipolysis in adipocytes
    112926217 (PIK3CA)
   04929 GnRH secretion
    112926217 (PIK3CA)
   04915 Estrogen signaling pathway
    112926217 (PIK3CA)
   04914 Progesterone-mediated oocyte maturation
    112926217 (PIK3CA)
   04917 Prolactin signaling pathway
    112926217 (PIK3CA)
   04926 Relaxin signaling pathway
    112926217 (PIK3CA)
   04935 Growth hormone synthesis, secretion and action
    112926217 (PIK3CA)
   04919 Thyroid hormone signaling pathway
    112926217 (PIK3CA)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    112926217 (PIK3CA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112926217 (PIK3CA)
  09156 Nervous system
   04725 Cholinergic synapse
    112926217 (PIK3CA)
   04722 Neurotrophin signaling pathway
    112926217 (PIK3CA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112926217 (PIK3CA)
  09158 Development and regeneration
   04360 Axon guidance
    112926217 (PIK3CA)
   04380 Osteoclast differentiation
    112926217 (PIK3CA)
  09149 Aging
   04211 Longevity regulating pathway
    112926217 (PIK3CA)
   04213 Longevity regulating pathway - multiple species
    112926217 (PIK3CA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112926217 (PIK3CA)
   05206 MicroRNAs in cancer
    112926217 (PIK3CA)
   05205 Proteoglycans in cancer
    112926217 (PIK3CA)
   05203 Viral carcinogenesis
    112926217 (PIK3CA)
   05230 Central carbon metabolism in cancer
    112926217 (PIK3CA)
   05231 Choline metabolism in cancer
    112926217 (PIK3CA)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112926217 (PIK3CA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112926217 (PIK3CA)
   05212 Pancreatic cancer
    112926217 (PIK3CA)
   05225 Hepatocellular carcinoma
    112926217 (PIK3CA)
   05226 Gastric cancer
    112926217 (PIK3CA)
   05214 Glioma
    112926217 (PIK3CA)
   05221 Acute myeloid leukemia
    112926217 (PIK3CA)
   05220 Chronic myeloid leukemia
    112926217 (PIK3CA)
   05218 Melanoma
    112926217 (PIK3CA)
   05211 Renal cell carcinoma
    112926217 (PIK3CA)
   05215 Prostate cancer
    112926217 (PIK3CA)
   05213 Endometrial cancer
    112926217 (PIK3CA)
   05224 Breast cancer
    112926217 (PIK3CA)
   05222 Small cell lung cancer
    112926217 (PIK3CA)
   05223 Non-small cell lung cancer
    112926217 (PIK3CA)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112926217 (PIK3CA)
   05017 Spinocerebellar ataxia
    112926217 (PIK3CA)
   05020 Prion disease
    112926217 (PIK3CA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112926217 (PIK3CA)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112926217 (PIK3CA)
   04932 Non-alcoholic fatty liver disease
    112926217 (PIK3CA)
   04931 Insulin resistance
    112926217 (PIK3CA)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112926217 (PIK3CA)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112926217 (PIK3CA)
   05135 Yersinia infection
    112926217 (PIK3CA)
   05100 Bacterial invasion of epithelial cells
    112926217 (PIK3CA)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112926217 (PIK3CA)
   05170 Human immunodeficiency virus 1 infection
    112926217 (PIK3CA)
   05161 Hepatitis B
    112926217 (PIK3CA)
   05160 Hepatitis C
    112926217 (PIK3CA)
   05171 Coronavirus disease - COVID-19
    112926217 (PIK3CA)
   05164 Influenza A
    112926217 (PIK3CA)
   05162 Measles
    112926217 (PIK3CA)
   05168 Herpes simplex virus 1 infection
    112926217 (PIK3CA)
   05163 Human cytomegalovirus infection
    112926217 (PIK3CA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112926217 (PIK3CA)
   05169 Epstein-Barr virus infection
    112926217 (PIK3CA)
   05165 Human papillomavirus infection
    112926217 (PIK3CA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112926217 (PIK3CA)
   05142 Chagas disease
    112926217 (PIK3CA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112926217 (PIK3CA)
   01524 Platinum drug resistance
    112926217 (PIK3CA)
   01522 Endocrine resistance
    112926217 (PIK3CA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvp04131]
    112926217 (PIK3CA)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     112926217 (PIK3CA)
Membrane trafficking [BR:vvp04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112926217 (PIK3CA)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 ASC Ribosomal_S15
Other DBs
NCBI-GeneID: 112926217
NCBI-ProteinID: XP_025862981
UniProt: A0A3Q7T430
LinkDB
Position
Unknown
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQ
LLQDESSYIFVSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDMVKDPEVQDFRRNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKH
IYNKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSSEQLK
LCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLGRMPNLMLMAKESLYSQLPMD
CFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWF
SSVVKFPDMSVIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLRAICTRDPL
SEITEQEKDFLWSHRQYCVTIPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAME
LLDCNYPDPMVRGFAVRCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNLLVRFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLNRQVEAMEKLINLTDILK
QEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctccaagaccatcatcaggtgaactgtggggcatccacttgatgcccccaagaatc
ctagtagaatgtttactaccaaatggaatgatagtgacgttagaatgcctccgtgaggct
acattaataactataaagcatgaattatttaaagaagcaagaaagtaccctctccatcaa
cttcttcaagatgaatcttcttacattttcgtaagtgttacccaagaagcagaaagggaa
gaattttttgatgaaacaagacgactttgtgaccttcggctttttcaaccctttttaaaa
gtaattgagccagtaggcaaccgagaagaaaagatcctcaatcgagaaattggttttgct
attggcatgccagtgtgtgaatttgatatggttaaagatccagaagtacaggacttccga
agaaatattctgaatgtttgtaaagaagctgtggatcttcgggatcttaattcacctcat
agtagagcaatgtatgtctatcctccaaatgtagaatcttcaccagaactgccaaagcac
atatataataaattagataaagggcaaataatagtggtgatttgggtaatagtttctcca
aataatgacaagcagaagtatactctgaaaatcaaccatgactgtgttccagaacaagta
attgctgaagcaatcagaaaaaaaactagaagtatgttgctatcatctgaacaactaaaa
ctctgtgttttagaatatcagggcaagtatattttaaaagtatgtggatgtgatgaatac
ttccttgaaaaatatcctctaagtcagtataagtacataagaagctgtataatgcttgga
aggatgcccaatttgatgttgatggctaaagaaagcctttactcccaattgccaatggac
tgtttcacaatgccatcttattccagacgcatctccacagctacaccatatatgaatgga
gaaacatctacaaaatctctctgggttataaatagcgcactcagaataaaaatcctttgt
gcaacctatgtaaatgtaaatattcgagacattgacaagatttatgttcgaacaggtatc
tatcatggaggagaacccttatgtgataatgttaacactcaaagagtaccttgttctaat
cccaggtggaatgaatggctaaattacgatatatacattcctgatcttcctcgtgctgct
cgactttgcctttccatttgttctgttaaaggccgaaagggtgctaaagaggaacactgt
ccattggcctggggaaatataaacttgtttgattacacagatactctagtatctggaaaa
atggctctgaatctttggccagtacctcatggattagaagatttgctgaaccctattggt
gttactgggtcaaatccaaataaagaaactccatgcttagagttggagtttgactggttc
agcagtgtggtaaagttcccagatatgtcagtgattgaagagcatgccaactggtcagtg
tctcgggaagcaggatttagttattcccatgcaggactgagtaacagactggctagagac
aacgaattaagagaaaatgataaagaacagctccgagcaatttgtacccgagatcctctc
tctgaaatcactgagcaagagaaagattttctgtggagccacagacaatattgtgtaact
atccctgaaattctacccaaactgcttctgtccgttaaatggaattctagagatgaagta
gctcagatgtactgcttagtaaaagattggcctccaatcaaacctgaacaggctatggag
cttctggactgtaattacccagatcctatggttcgaggttttgctgttcggtgcttggaa
aaatacttaacagatgacaagctttctcagtacctaattcagctagtacaggtcctaaaa
tacgaacaatatttggataacctgcttgtgagatttttactcaagaaagcattgactaat
caaaggattgggcattttttcttttggcacttaaaatctgagatgcacaataaaacggtt
agtcagaggtttggcctgcttttggagtcctattgccgtgcttgtgggatgtatttgaag
cacctaaataggcaagttgaggctatggaaaagctcattaacttaactgacattctcaaa
caagagaagaaggatgaaacacaaaaggtacagatgaagtttttagttgagcaaatgcgg
cgaccagatttcatggatgctctacaaggttttctatctcctctaaatcctgctcatcaa
ctaggaaatctcaggcttgaagagtgtcgaattatgtcctctgcaaaaaggccactgtgg
ttgaattgggagaacccagacatcatgtcagagttactctttcagaacaatgagatcatc
tttaaaaatggggatgatttacgacaagatatgctaacacttcaaataattcgcattatg
gaaaatatctggcaaaatcaaggtcttgatcttcgaatgttaccttatggttgtctgtca
atcggtgactgtgtgggacttattgaggtggtgcgaaattctcacactattatgcagatt
cagtgcaaaggtggcctgaaaggtgcactgcagttcaacagccacacactacaccagtgg
ctcaaagacaagaacaaaggagaaatatatgatgcagccattgacctgttcacacgttca
tgtgctggatattgtgttgctaccttcattttgggaattggagatcgtcacaatagtaac
atcatggttaaagatgatggacaactgtttcatatagattttggacactttttggaccat
aagaagaaaaaatttggttataaacgggaacgtgtgccatttgttttgacacaagatttc
ttaatagtgattagtaaaggagcccaggaatgcacaaaaacaagagaatttgagaggttt
caggagatgtgttacaaggcttatctagctattcggcagcatgccaatctcttcataaat
cttttctcaatgatgcttggctctggaatgccagaactacaatcttttgatgatattgca
tacattcgaaagaccctagctttagataaaactgaacaagaggctttggaatatttcatg
aaacagatgaatgatgcacatcatggtggctggacaacaaaaatggattggatcttccac
accattaagcagcatgctttgaactga

KEGG   Vulpes vulpes (red fox): 112934961
Entry
112934961         CDS       T05911                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp00562  Inositol phosphate metabolism
vvp01100  Metabolic pathways
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp01524  Platinum drug resistance
vvp04012  ErbB signaling pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04024  cAMP signaling pathway
vvp04062  Chemokine signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04068  FoxO signaling pathway
vvp04070  Phosphatidylinositol signaling system
vvp04071  Sphingolipid signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04140  Autophagy - animal
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04210  Apoptosis
vvp04211  Longevity regulating pathway
vvp04213  Longevity regulating pathway - multiple species
vvp04218  Cellular senescence
vvp04360  Axon guidance
vvp04370  VEGF signaling pathway
vvp04380  Osteoclast differentiation
vvp04510  Focal adhesion
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04611  Platelet activation
vvp04613  Neutrophil extracellular trap formation
vvp04620  Toll-like receptor signaling pathway
vvp04625  C-type lectin receptor signaling pathway
vvp04630  JAK-STAT signaling pathway
vvp04650  Natural killer cell mediated cytotoxicity
vvp04660  T cell receptor signaling pathway
vvp04662  B cell receptor signaling pathway
vvp04664  Fc epsilon RI signaling pathway
vvp04666  Fc gamma R-mediated phagocytosis
vvp04668  TNF signaling pathway
vvp04670  Leukocyte transendothelial migration
vvp04722  Neurotrophin signaling pathway
vvp04725  Cholinergic synapse
vvp04750  Inflammatory mediator regulation of TRP channels
vvp04810  Regulation of actin cytoskeleton
vvp04910  Insulin signaling pathway
vvp04914  Progesterone-mediated oocyte maturation
vvp04915  Estrogen signaling pathway
vvp04917  Prolactin signaling pathway
vvp04919  Thyroid hormone signaling pathway
vvp04923  Regulation of lipolysis in adipocytes
vvp04926  Relaxin signaling pathway
vvp04929  GnRH secretion
vvp04930  Type II diabetes mellitus
vvp04931  Insulin resistance
vvp04932  Non-alcoholic fatty liver disease
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04935  Growth hormone synthesis, secretion and action
vvp04960  Aldosterone-regulated sodium reabsorption
vvp04973  Carbohydrate digestion and absorption
vvp05010  Alzheimer disease
vvp05017  Spinocerebellar ataxia
vvp05020  Prion disease
vvp05100  Bacterial invasion of epithelial cells
vvp05132  Salmonella infection
vvp05135  Yersinia infection
vvp05142  Chagas disease
vvp05146  Amoebiasis
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05171  Coronavirus disease - COVID-19
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05210  Colorectal cancer
vvp05211  Renal cell carcinoma
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05218  Melanoma
vvp05220  Chronic myeloid leukemia
vvp05221  Acute myeloid leukemia
vvp05222  Small cell lung cancer
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05230  Central carbon metabolism in cancer
vvp05231  Choline metabolism in cancer
vvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    112934961 (PIK3CB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112934961 (PIK3CB)
   04014 Ras signaling pathway
    112934961 (PIK3CB)
   04015 Rap1 signaling pathway
    112934961 (PIK3CB)
   04370 VEGF signaling pathway
    112934961 (PIK3CB)
   04630 JAK-STAT signaling pathway
    112934961 (PIK3CB)
   04668 TNF signaling pathway
    112934961 (PIK3CB)
   04066 HIF-1 signaling pathway
    112934961 (PIK3CB)
   04068 FoxO signaling pathway
    112934961 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    112934961 (PIK3CB)
   04072 Phospholipase D signaling pathway
    112934961 (PIK3CB)
   04071 Sphingolipid signaling pathway
    112934961 (PIK3CB)
   04024 cAMP signaling pathway
    112934961 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    112934961 (PIK3CB)
   04152 AMPK signaling pathway
    112934961 (PIK3CB)
   04150 mTOR signaling pathway
    112934961 (PIK3CB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112934961 (PIK3CB)
  09143 Cell growth and death
   04210 Apoptosis
    112934961 (PIK3CB)
   04218 Cellular senescence
    112934961 (PIK3CB)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112934961 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    112934961 (PIK3CB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112934961 (PIK3CB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112934961 (PIK3CB)
   04613 Neutrophil extracellular trap formation
    112934961 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    112934961 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    112934961 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    112934961 (PIK3CB)
   04660 T cell receptor signaling pathway
    112934961 (PIK3CB)
   04662 B cell receptor signaling pathway
    112934961 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    112934961 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    112934961 (PIK3CB)
   04670 Leukocyte transendothelial migration
    112934961 (PIK3CB)
   04062 Chemokine signaling pathway
    112934961 (PIK3CB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112934961 (PIK3CB)
   04923 Regulation of lipolysis in adipocytes
    112934961 (PIK3CB)
   04929 GnRH secretion
    112934961 (PIK3CB)
   04915 Estrogen signaling pathway
    112934961 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    112934961 (PIK3CB)
   04917 Prolactin signaling pathway
    112934961 (PIK3CB)
   04926 Relaxin signaling pathway
    112934961 (PIK3CB)
   04935 Growth hormone synthesis, secretion and action
    112934961 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    112934961 (PIK3CB)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    112934961 (PIK3CB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112934961 (PIK3CB)
  09156 Nervous system
   04725 Cholinergic synapse
    112934961 (PIK3CB)
   04722 Neurotrophin signaling pathway
    112934961 (PIK3CB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112934961 (PIK3CB)
  09158 Development and regeneration
   04360 Axon guidance
    112934961 (PIK3CB)
   04380 Osteoclast differentiation
    112934961 (PIK3CB)
  09149 Aging
   04211 Longevity regulating pathway
    112934961 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    112934961 (PIK3CB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112934961 (PIK3CB)
   05206 MicroRNAs in cancer
    112934961 (PIK3CB)
   05205 Proteoglycans in cancer
    112934961 (PIK3CB)
   05203 Viral carcinogenesis
    112934961 (PIK3CB)
   05230 Central carbon metabolism in cancer
    112934961 (PIK3CB)
   05231 Choline metabolism in cancer
    112934961 (PIK3CB)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112934961 (PIK3CB)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112934961 (PIK3CB)
   05212 Pancreatic cancer
    112934961 (PIK3CB)
   05225 Hepatocellular carcinoma
    112934961 (PIK3CB)
   05226 Gastric cancer
    112934961 (PIK3CB)
   05214 Glioma
    112934961 (PIK3CB)
   05221 Acute myeloid leukemia
    112934961 (PIK3CB)
   05220 Chronic myeloid leukemia
    112934961 (PIK3CB)
   05218 Melanoma
    112934961 (PIK3CB)
   05211 Renal cell carcinoma
    112934961 (PIK3CB)
   05215 Prostate cancer
    112934961 (PIK3CB)
   05213 Endometrial cancer
    112934961 (PIK3CB)
   05224 Breast cancer
    112934961 (PIK3CB)
   05222 Small cell lung cancer
    112934961 (PIK3CB)
   05223 Non-small cell lung cancer
    112934961 (PIK3CB)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112934961 (PIK3CB)
   05017 Spinocerebellar ataxia
    112934961 (PIK3CB)
   05020 Prion disease
    112934961 (PIK3CB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112934961 (PIK3CB)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112934961 (PIK3CB)
   04932 Non-alcoholic fatty liver disease
    112934961 (PIK3CB)
   04931 Insulin resistance
    112934961 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112934961 (PIK3CB)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112934961 (PIK3CB)
   05135 Yersinia infection
    112934961 (PIK3CB)
   05100 Bacterial invasion of epithelial cells
    112934961 (PIK3CB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112934961 (PIK3CB)
   05170 Human immunodeficiency virus 1 infection
    112934961 (PIK3CB)
   05161 Hepatitis B
    112934961 (PIK3CB)
   05160 Hepatitis C
    112934961 (PIK3CB)
   05171 Coronavirus disease - COVID-19
    112934961 (PIK3CB)
   05164 Influenza A
    112934961 (PIK3CB)
   05162 Measles
    112934961 (PIK3CB)
   05168 Herpes simplex virus 1 infection
    112934961 (PIK3CB)
   05163 Human cytomegalovirus infection
    112934961 (PIK3CB)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112934961 (PIK3CB)
   05169 Epstein-Barr virus infection
    112934961 (PIK3CB)
   05165 Human papillomavirus infection
    112934961 (PIK3CB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112934961 (PIK3CB)
   05142 Chagas disease
    112934961 (PIK3CB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112934961 (PIK3CB)
   01524 Platinum drug resistance
    112934961 (PIK3CB)
   01522 Endocrine resistance
    112934961 (PIK3CB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvp04131]
    112934961 (PIK3CB)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     112934961 (PIK3CB)
Membrane trafficking [BR:vvp04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112934961 (PIK3CB)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C DUF4381
Other DBs
NCBI-GeneID: 112934961
NCBI-ProteinID: XP_025874299
UniProt: A0A3Q7TAY4
LinkDB
Position
Unknown
AA seq 1070 aa
MCFNFIMPPAMADILDIWAVDSQLASDGSIPVDFLLPTGIYIQLEVPREATISYIKQILW
KQVHNYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKLVTRSCDPGE
KLDSKIGVLIGKGLHEFDALKDPEVNDFRIKMRKFSEEKIQSLVGLSWMDWLKQTYPPEH
EPSILENLEDKLYGGKLIVAVHFENCQDVFSFQISPNMNPIKINELAIQKRLTIHGKEDE
VSPNDYVLQVSGRVEYVFGDHPLIQFQYIRNCVMNRTLPHFMLVECCKIKKMYEQEMIAI
EAAINRNASNLPLPLPPKKMRIISHVWENNNPFQIVLVKGNKLNTEESVKVHVRAGLFHG
TELLCKTIVSSEISGKNDHIWNEPLEFDINTCDLPRMARLCFAVYAVLDKVKTKKSTKNI
NPCKYQTIRKSGKVHYPVAWVNTMVFDFKGQLRSGDIILHSWSSFPDELEEMLNPMGTVQ
TNPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSANVSSRGGKKFLAVLKE
ILDRDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSIKWNKLEDVAQLQALLQIWPK
LPPREALELLDFNYPDQYVREYAVGCLRQMSDEELSQYLLQLVQVLKYEPFLDCALSRFL
LERALANRRIGQFLFWHLRSEVHIPAVSVQFGVILEAYCRGSVGHMKVLSKQVEALNKLK
TLNSLIKLNAVKLNKAKGKEAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKYMD
SKMKPLWLVYNNKVFGEDSVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYG
CLATGDRSGLIEVVSTSETIADIQLNSSNVAAAAAFNKDALLNWLKEYNSGDDLDRAIEE
FTLSCAGYCVASYVLGIGDRHSDNIMVKKTGQLFHIDFGHILGNFKSKFGIKRERVPFIL
TYDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKD
IQYLKDSLALGKSEEEALKQFKQKFDEALRESWTTKVNWMAHTVRKDYRS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgtgcttcaatttcataatgcctcctgctatggcagacatccttgacatctgggcagtg
gattcacagttagcatctgatggctccatacctgtggatttccttttgcccactgggatt
tatattcagttggaggttcctcgggaagctaccatttcctatattaagcagattttatgg
aaacaagttcacaattatccaatgtttaacctccttatggaaattgactcctatatgttt
gcatgtgtgaatcaaactgctgtatatgaggagcttgaagatgaaacaagaagactctgt
gatgtcagaccttttcttccagttctcaaattagtgacaagaagttgtgacccaggggaa
aaattagactcaaaaattggagtccttataggaaaaggtctacatgaatttgatgcactg
aaggatcctgaagtgaatgatttccgaataaaaatgcgcaaattcagtgaggaaaagatt
cagtcacttgtgggattgtcttggatggattggctgaagcagacatatccaccagaacat
gaaccatcgatccttgaaaacttagaagataaactttatggaggaaagctcattgtggct
gttcattttgaaaattgtcaggacgtgtttagctttcaaatatctcctaatatgaatcct
atcaaaataaatgaactggcaatccaaaaacgtttaactattcatgggaaagaagatgaa
gttagccccaatgattatgtgttgcaagtcagtgggagagtagaatatgtatttggtgat
cacccactaattcaattccagtatatccggaactgtgtaatgaacaggactttgccccat
tttatgcttgtggaatgttgcaagattaagaagatgtatgaacaggaaatgattgccata
gaggctgccataaatcgaaatgcatcaaaccttcctcttcctttacccccaaagaaaatg
cgaattatttctcatgtttgggaaaataacaatcctttccaaattgtcttggttaaggga
aataaacttaacacagaagaaagtgtaaaagttcatgtcagggctggcctttttcatggt
actgaactcctctgtaaaaccatcgtaagctcagagatatcagggaaaaatgatcacatt
tggaatgaaccactggaatttgatataaatacttgtgacctgccacgaatggctcgatta
tgttttgctgtttatgcagttttggataaagtgaaaacaaaaaagtcaactaaaaatatt
aatccctgtaaatatcagaccatccggaaatctgggaaagtgcattatcctgtggcatgg
gtaaatacgatggtttttgactttaaaggacagttgagatctggagacataatactgcac
agctggtcttcatttcctgatgaacttgaagaaatgttgaatccaatgggaactgttcaa
acaaatccatatactgaaaatgcaacagctttgcatatcaaattcccagagaataaaaaa
caaccttattattatcctccctttgataagataatcgagaaggcagctgagattgcaagc
agtgacagcgctaatgtatcaagtcgaggtggaaaaaagtttcttgctgtactgaaagaa
atcttggacagggatcctttgtctcaactttgtgagaatgaaatggatcttatatggact
ttgagacaagattgcagagagaattttccacagtcactgccaaaattactgctgtcgatc
aagtggaataagcttgaggatgttgctcagcttcaggcactacttcagatttggcctaaa
ctgcccccccgggaggccttagaacttctagatttcaactatccagatcagtacgtgcga
gaatacgctgtgggctgcctgcgacagatgagtgatgaagaactctctcagtatctttta
caactggtgcaagttttaaaatatgagccttttcttgattgtgccctgtctagattcctc
ttagaaagagcgcttgctaatcggaggatagggcagtttctattttggcaccttaggtca
gaagtgcatatccctgctgtctcagtacagtttggtgtcatccttgaagcatactgccgg
ggaagcgtagggcacatgaaagtgctttccaagcaggttgaagcactcaataagttaaaa
actttaaatagtttaatcaaactgaatgcagtgaagctaaacaaagccaaagggaaggag
gccatgcatacttgtttaaaacagaatgcttaccgggaagccctctctgacctgcagtcg
cctctgaatccatgtgttatactttcagaactctatgttgaaaagtgtaaatacatggat
tccaaaatgaagcctttgtggctcgtgtacaacaacaaagtgtttggtgaggattcagtt
ggagtgatttttaaaaatggtgatgatttacgacaagatatgttgacactccagatgctg
cgcttgatggatttactttggaaagaagctggtctggatcttcggatgctgccttatggc
tgtttagcgacaggagaccgctctggcctcattgaagttgtgagcacctctgaaacaatt
gctgacattcagctgaacagtagcaatgtggctgccgcagcagccttcaacaaagatgcc
cttctgaactggcttaaagaatacaattctggggatgacctagaccgagccattgaagag
tttaccttgtcctgtgccggctactgtgtagcttcttatgtccttgggattggtgataga
catagtgacaacatcatggtcaaaaaaactggccagctcttccacattgactttggacat
attcttggaaatttcaagtctaaatttggcattaaaagggaacgggtgccttttattctt
acctatgatttcattcatgtgattcaacaaggaaaaacaggaaacacagaaaagtttggc
cggttccgccagtgttgtgaggatgcatatctgatattacgacggcacgggaatctcttc
atcaccctttttgcactgatgttgactgcagggcttcctgagctcacatcagtcaaggat
atacagtatcttaaggactctcttgccttagggaagagtgaagaagaagcactcaagcaa
tttaagcaaaaatttgatgaggcactcagggaaagctggactactaaagtgaactggatg
gcgcacacagttcggaaagactacagatcttaa

KEGG   Vulpes vulpes (red fox): 112935820
Entry
112935820         CDS       T05911                                 

Gene name
PIK3R1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp01522  Endocrine resistance
vvp01524  Platinum drug resistance
vvp04012  ErbB signaling pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04024  cAMP signaling pathway
vvp04062  Chemokine signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04068  FoxO signaling pathway
vvp04070  Phosphatidylinositol signaling system
vvp04071  Sphingolipid signaling pathway
vvp04072  Phospholipase D signaling pathway
vvp04140  Autophagy - animal
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04210  Apoptosis
vvp04211  Longevity regulating pathway
vvp04213  Longevity regulating pathway - multiple species
vvp04218  Cellular senescence
vvp04360  Axon guidance
vvp04370  VEGF signaling pathway
vvp04380  Osteoclast differentiation
vvp04510  Focal adhesion
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04611  Platelet activation
vvp04613  Neutrophil extracellular trap formation
vvp04620  Toll-like receptor signaling pathway
vvp04625  C-type lectin receptor signaling pathway
vvp04630  JAK-STAT signaling pathway
vvp04650  Natural killer cell mediated cytotoxicity
vvp04660  T cell receptor signaling pathway
vvp04662  B cell receptor signaling pathway
vvp04664  Fc epsilon RI signaling pathway
vvp04666  Fc gamma R-mediated phagocytosis
vvp04668  TNF signaling pathway
vvp04670  Leukocyte transendothelial migration
vvp04722  Neurotrophin signaling pathway
vvp04725  Cholinergic synapse
vvp04750  Inflammatory mediator regulation of TRP channels
vvp04810  Regulation of actin cytoskeleton
vvp04910  Insulin signaling pathway
vvp04914  Progesterone-mediated oocyte maturation
vvp04915  Estrogen signaling pathway
vvp04917  Prolactin signaling pathway
vvp04919  Thyroid hormone signaling pathway
vvp04923  Regulation of lipolysis in adipocytes
vvp04926  Relaxin signaling pathway
vvp04929  GnRH secretion
vvp04930  Type II diabetes mellitus
vvp04931  Insulin resistance
vvp04932  Non-alcoholic fatty liver disease
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04935  Growth hormone synthesis, secretion and action
vvp04960  Aldosterone-regulated sodium reabsorption
vvp04973  Carbohydrate digestion and absorption
vvp05010  Alzheimer disease
vvp05017  Spinocerebellar ataxia
vvp05020  Prion disease
vvp05100  Bacterial invasion of epithelial cells
vvp05135  Yersinia infection
vvp05142  Chagas disease
vvp05146  Amoebiasis
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05171  Coronavirus disease - COVID-19
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05210  Colorectal cancer
vvp05211  Renal cell carcinoma
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05218  Melanoma
vvp05220  Chronic myeloid leukemia
vvp05221  Acute myeloid leukemia
vvp05222  Small cell lung cancer
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05230  Central carbon metabolism in cancer
vvp05231  Choline metabolism in cancer
vvp05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112935820 (PIK3R1)
   04014 Ras signaling pathway
    112935820 (PIK3R1)
   04015 Rap1 signaling pathway
    112935820 (PIK3R1)
   04370 VEGF signaling pathway
    112935820 (PIK3R1)
   04630 JAK-STAT signaling pathway
    112935820 (PIK3R1)
   04668 TNF signaling pathway
    112935820 (PIK3R1)
   04066 HIF-1 signaling pathway
    112935820 (PIK3R1)
   04068 FoxO signaling pathway
    112935820 (PIK3R1)
   04070 Phosphatidylinositol signaling system
    112935820 (PIK3R1)
   04072 Phospholipase D signaling pathway
    112935820 (PIK3R1)
   04071 Sphingolipid signaling pathway
    112935820 (PIK3R1)
   04024 cAMP signaling pathway
    112935820 (PIK3R1)
   04151 PI3K-Akt signaling pathway
    112935820 (PIK3R1)
   04152 AMPK signaling pathway
    112935820 (PIK3R1)
   04150 mTOR signaling pathway
    112935820 (PIK3R1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112935820 (PIK3R1)
  09143 Cell growth and death
   04210 Apoptosis
    112935820 (PIK3R1)
   04218 Cellular senescence
    112935820 (PIK3R1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112935820 (PIK3R1)
   04550 Signaling pathways regulating pluripotency of stem cells
    112935820 (PIK3R1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112935820 (PIK3R1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112935820 (PIK3R1)
   04613 Neutrophil extracellular trap formation
    112935820 (PIK3R1)
   04620 Toll-like receptor signaling pathway
    112935820 (PIK3R1)
   04625 C-type lectin receptor signaling pathway
    112935820 (PIK3R1)
   04650 Natural killer cell mediated cytotoxicity
    112935820 (PIK3R1)
   04660 T cell receptor signaling pathway
    112935820 (PIK3R1)
   04662 B cell receptor signaling pathway
    112935820 (PIK3R1)
   04664 Fc epsilon RI signaling pathway
    112935820 (PIK3R1)
   04666 Fc gamma R-mediated phagocytosis
    112935820 (PIK3R1)
   04670 Leukocyte transendothelial migration
    112935820 (PIK3R1)
   04062 Chemokine signaling pathway
    112935820 (PIK3R1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112935820 (PIK3R1)
   04923 Regulation of lipolysis in adipocytes
    112935820 (PIK3R1)
   04929 GnRH secretion
    112935820 (PIK3R1)
   04915 Estrogen signaling pathway
    112935820 (PIK3R1)
   04914 Progesterone-mediated oocyte maturation
    112935820 (PIK3R1)
   04917 Prolactin signaling pathway
    112935820 (PIK3R1)
   04926 Relaxin signaling pathway
    112935820 (PIK3R1)
   04935 Growth hormone synthesis, secretion and action
    112935820 (PIK3R1)
   04919 Thyroid hormone signaling pathway
    112935820 (PIK3R1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    112935820 (PIK3R1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112935820 (PIK3R1)
  09156 Nervous system
   04725 Cholinergic synapse
    112935820 (PIK3R1)
   04722 Neurotrophin signaling pathway
    112935820 (PIK3R1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    112935820 (PIK3R1)
  09158 Development and regeneration
   04360 Axon guidance
    112935820 (PIK3R1)
   04380 Osteoclast differentiation
    112935820 (PIK3R1)
  09149 Aging
   04211 Longevity regulating pathway
    112935820 (PIK3R1)
   04213 Longevity regulating pathway - multiple species
    112935820 (PIK3R1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112935820 (PIK3R1)
   05206 MicroRNAs in cancer
    112935820 (PIK3R1)
   05205 Proteoglycans in cancer
    112935820 (PIK3R1)
   05203 Viral carcinogenesis
    112935820 (PIK3R1)
   05230 Central carbon metabolism in cancer
    112935820 (PIK3R1)
   05231 Choline metabolism in cancer
    112935820 (PIK3R1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    112935820 (PIK3R1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112935820 (PIK3R1)
   05212 Pancreatic cancer
    112935820 (PIK3R1)
   05225 Hepatocellular carcinoma
    112935820 (PIK3R1)
   05226 Gastric cancer
    112935820 (PIK3R1)
   05214 Glioma
    112935820 (PIK3R1)
   05221 Acute myeloid leukemia
    112935820 (PIK3R1)
   05220 Chronic myeloid leukemia
    112935820 (PIK3R1)
   05218 Melanoma
    112935820 (PIK3R1)
   05211 Renal cell carcinoma
    112935820 (PIK3R1)
   05215 Prostate cancer
    112935820 (PIK3R1)
   05213 Endometrial cancer
    112935820 (PIK3R1)
   05224 Breast cancer
    112935820 (PIK3R1)
   05222 Small cell lung cancer
    112935820 (PIK3R1)
   05223 Non-small cell lung cancer
    112935820 (PIK3R1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112935820 (PIK3R1)
   05017 Spinocerebellar ataxia
    112935820 (PIK3R1)
   05020 Prion disease
    112935820 (PIK3R1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112935820 (PIK3R1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    112935820 (PIK3R1)
   04932 Non-alcoholic fatty liver disease
    112935820 (PIK3R1)
   04931 Insulin resistance
    112935820 (PIK3R1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112935820 (PIK3R1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112935820 (PIK3R1)
   05100 Bacterial invasion of epithelial cells
    112935820 (PIK3R1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112935820 (PIK3R1)
   05170 Human immunodeficiency virus 1 infection
    112935820 (PIK3R1)
   05161 Hepatitis B
    112935820 (PIK3R1)
   05160 Hepatitis C
    112935820 (PIK3R1)
   05171 Coronavirus disease - COVID-19
    112935820 (PIK3R1)
   05164 Influenza A
    112935820 (PIK3R1)
   05162 Measles
    112935820 (PIK3R1)
   05168 Herpes simplex virus 1 infection
    112935820 (PIK3R1)
   05163 Human cytomegalovirus infection
    112935820 (PIK3R1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112935820 (PIK3R1)
   05169 Epstein-Barr virus infection
    112935820 (PIK3R1)
   05165 Human papillomavirus infection
    112935820 (PIK3R1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112935820 (PIK3R1)
   05142 Chagas disease
    112935820 (PIK3R1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112935820 (PIK3R1)
   01524 Platinum drug resistance
    112935820 (PIK3R1)
   01522 Endocrine resistance
    112935820 (PIK3R1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:vvp04131]
    112935820 (PIK3R1)
Membrane trafficking [BR:vvp04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    112935820 (PIK3R1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_9 AAA_13 SH3_2 DUF4201 Laminin_I Mod_r Lant_dehydr_C PI_PP_I FNIP_M
Other DBs
NCBI-GeneID: 112935820
NCBI-ProteinID: XP_025875527
UniProt: A0A3Q7UQL5
LinkDB
Position
Unknown
AA seq 725 aa
MSAEGYQYRALYDYKKEREEDIDLHLGDVLTVNKGSLVALGFSDGQEARPEEIGWLNGYN
ETTGERGDFPGTYVEYIGRKKISPPTPKPRPPRPLPVAPGSSKAEADSEQQQALALPDLA
EQFAPPDIAPPLLVKLLEAIEKKGLECSTLYRTPSSSNPAELRQLLDCDAASTDLEMIDV
QVLGDAFKRYLMDLPNPVIPVAVYNEMIYLAQEVQSSEEYIQLLKKLIRAPNIPHQYWLT
LQYLLKHFFKLSQTSSKNLLSARVLSELFSPLLFRFPAASSENTEHLIKVIEILISTEWN
ERQPAPALPPKPPKPTTVANNGMNNNMSLQDAEWYWGDISREEVNEKLRDTADGTFLVRD
ASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFNSVVELINHYRNESLAQYNPK
LDVKLLYPVSKYQQDQVVKEDNIEAVGKKLHEYNTQFQEKSREYDRLYEDYTRTSQEIQM
KRTAIEAFNETIKIFEEQCQSQERYSKEYIEKFKREGNEKEIQRIMHNYEKLKSRISEIV
DSRRRLEEDLKKQAAEYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLG
NENTEDQYSLVEDDEDLPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYAC
SVVVDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPVY
AQQRR
NT seq 2178 nt   +upstreamnt  +downstreamnt
atgagtgccgagggctaccagtaccgggcgctgtatgattacaagaaggaacgagaggaa
gatattgacctgcacttgggtgacgtcttgactgtgaataaagggtccttagtagctctt
ggattcagtgacggacaggaagccaggcctgaggagattggctggttaaatggttataat
gaaacaacgggggaaagaggggactttccgggaacttatgttgaatatattggaaggaag
aaaatctcccctcccacaccaaagccccgaccccctcgaccccttcccgtggcaccaggt
tcttcgaaagctgaagcagacagtgagcaacagcaagccttggcccttccggatcttgca
gagcagtttgcccctcccgacatcgctccgcctctgctggtgaagctcctggaagccatt
gaaaagaaaggtctggaatgttcaactctatacaggacaccgagctccagcaacccggct
gagttacgacagctccttgattgtgatgccgcctccacggacttggagatgatcgatgtg
caagtcttgggagacgctttcaaacgctatcttatggacttaccgaatcctgtcattcca
gtagccgtttacaatgagatgatttatttagcccaagaagtgcaaagctctgaagaatat
atccagttgttgaagaagctcattagggcacctaacatacctcatcagtattggcttacg
cttcagtatttgctcaaacatttcttcaagctctcgcaaacctccagcaagaatcttctg
agtgcaagagtactctctgaactcttcagccctctgcttttccgattcccagcagccagc
tctgagaatactgaacacctcataaaagttatagaaatcttaatctcaacggagtggaat
gaacgacagcctgcaccagcattgcctcctaaaccaccgaaacccaccactgtagccaac
aacggtatgaataacaatatgtccttacaagatgctgaatggtactggggagatatctca
agggaagaagtgaatgaaaaacttcgagatacagccgatgggacctttttggtacgagac
gcatctactaaaatgcatggtgattatactcttacactaaggaaaggaggaaataacaaa
ttaatcaaaatatttcaccgagatgggaaatatggcttctctgacccactgaccttcaac
tctgtggttgaactaataaaccactaccggaatgagtctctagctcagtataaccccaaa
ctggacgtgaaattactctatccagtatccaaataccaacaggatcaggttgtcaaagag
gataatattgaagctgtagggaaaaaattacacgaatataacactcaatttcaagaaaaa
agtcgggaatacgataggttatatgaagattatacccgtacttcccaggaaattcaaatg
aagagaacagctattgaagcatttaatgaaaccataaaaatatttgaagagcagtgccaa
agccaggaacggtacagcaaagaatacatagaaaaatttaagcgtgaaggcaacgaaaaa
gaaatacaaaggattatgcataattatgaaaagttaaagtcccgaattagtgagattgtg
gacagtagaaggcgcctggaggaagacctgaagaagcaagcagctgagtaccgggagatc
gacaagcgcatgaacagcattaagcccgacctcattcagctgaggaagacgagagaccag
tacttgatgtggttgactcagaaaggtgttcggcaaaagaagttgaatgagtggctgggc
aacgagaatacggaagaccaatactcgctggtggaagatgatgaggacctgcctcaccac
gacgagaagacctggaacgtgggcagtagcaacaggaacaaagccgagaaccttctacgg
gggaaacgggacggcaccttcctggtccgggagagcagtaaacagggctgctatgcttgc
tccgtggtggtggatggcgaggtcaagcattgcgtcatcaacaaaacggccactggctac
ggctttgccgagccctataacctgtacagctccctgaaagaactggtgctccattaccaa
cacacctccctggtgcagcacaacgactctctcaacgtcacactagcctacccggtatat
gcacagcagaggcgatga

DBGET integrated database retrieval system