KEGG   Vulpes vulpes (red fox): 112913316
Entry
112913316         CDS       T05911                                 

Gene name
NCOA4
Definition
(RefSeq) nuclear receptor coactivator 4 isoform X1
  KO
K09289  nuclear receptor coactivator 4
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04216  Ferroptosis
vvp05200  Pathways in cancer
vvp05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    112913316 (NCOA4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112913316 (NCOA4)
  09162 Cancer: specific types
   05216 Thyroid cancer
    112913316 (NCOA4)
SSDB
Motif
Pfam: ARA70
Other DBs
NCBI-GeneID: 112913316
NCBI-ProteinID: XP_025845673
UniProt: A0A3Q7RKE2
LinkDB
Position
Unknown
AA seq 625 aa
MSTSQDQSGRSSNREPLLRCCDARRDLELAIGGVLRAEQQIKDNLQEVKAQIHSCISRHL
ECLRSREVWLYEQVDLIYQLKEETLQQQAQQLYWLLGQFNCLIHQLECTQNKDLANQVSV
CLERLGNLTLKPEDSTVLLFEADTTALRQAITTFGSLKTIQIPEHLIAHANSSNIGSFLE
KRGYIPLPEQKSASSTTAVSLSEWLLGSKPASVRQAPYIPSTNLQDWLTQKQTLENSQTS
ARACNFFGKVWGNLKGLENWLHQSQQQEVPEKPTYQKCNSHSTTSSYSVEIEKIGDLDLL
EQDEMDLSDWLVTPQESHKLEKPGNGSFETSGKFKLLLQVFQEPYSVNDWLVKPDSCTNC
RGNQPKGVEIENLGNLKCLNDHLEAKKPLSIPSMINEDWLVQNHQDPYKVEEVCKANEPC
TSFAECVCDENCEKEALCKWLLKKEGKDKNGMPVEPNPESEKCIDSLSVWLCPSRKEAAQ
QAKMSKAVAPSRIADSFQVIRNSPLSEWLITPSCKEGCPKEMPGTEDRASKQKPMNPVAT
FCHPFNTADWVLPGKQMGNLSQLSSGEDKWLLRKKAKEVLLNSPLQEECNFPQDRYGLPA
VCDLFACMQLKVDKEKWLYRTPLQM
NT seq 1878 nt   +upstreamnt  +downstreamnt
atgagtacctcacaggaccagagtggccgctccagtaatagagaaccccttttgaggtgt
tgtgatgcacggagggacttggagcttgctattggtggagttctccgggctgaacagcaa
attaaagataacttgcaagaggtcaaagcccagattcacagctgcataagccgtcatctg
gaatgcctccgaagccgtgaggtgtggctgtatgaacaggtagatctcatctatcagctt
aaagaggagacacttcagcagcaggcccaacagctctactggttactgggccagttcaat
tgtcttattcatcaactggagtgcacccaaaacaaagatctagctaatcaagtgtctgtg
tgcctggagagactgggcaatttgaccctcaaacctgaagattcgactgtcctactgttt
gaagcagacacaactgctctgcgccaggccatcaccacgtttggatcccttaagaccatc
caaattcctgagcatcttattgctcatgctaattcatcaaatattgggtctttcctggag
aaaagaggttatatcccattgccagaacagaagtcagcatccagcactaccgctgtctct
ctcagcgaatggctccttggaagcaaacctgccagtgttcgacaggctccttacataccc
agcaccaacctccaggactggctcacccaaaagcagaccttggagaatagtcagacttct
gccagagcctgcaatttcttcggtaaagtctggggcaacctaaagggcttagaaaactgg
ctccaccagagtcagcaacaagaggttcctgaaaaaccaacttaccagaagtgtaatagc
cattctactaccagttcgtactctgttgaaattgaaaagattggagatctggaccttctt
gagcaggacgagatggacctttctgattggctggtgactcctcaggaatcccataagctg
gagaagcctgggaatggcagctttgaaaccagtgggaagtttaagctcctgttgcaggtg
ttccaggagccatacagtgtgaatgattggcttgtcaagcccgattcctgtaccaattgt
cggggcaaccagcccaagggtgtggagattgaaaacctgggcaatctgaagtgcctgaac
gaccacttagaggccaagaaacccttgtccattcccagcatgattaatgaggattggctt
gtccagaatcatcaggacccatataaagtggaggaggtgtgcaaagccaatgagccctgt
acgagctttgcagagtgtgtgtgtgatgagaactgtgagaaggaagctctgtgtaaatgg
cttctgaagaaagaaggaaaagacaaaaatggtatgcctgtggaaccaaatcctgagtct
gagaagtgtatagattccctgagtgtgtggctctgtccttctagaaaagaggcagcacaa
caagctaagatgtcaaaggcagtggctccttctagaattgctgattccttccaagtcata
aggaacagccctttgtcagagtggctcatcacaccctcatgcaaagaaggttgtcccaag
gaaatgcctggtactgaagacagagctagcaagcaaaagcctatgaacccagtggccact
ttctgccatccttttaatacagctgactgggtcttgccaggaaagcagatgggaaacctc
agccagttatcctcaggagaagacaagtggctccttcgaaagaaggccaaggaagtatta
cttaactcaccgctacaggaggaatgtaactttccccaagatcgttatggcctcccagca
gtttgtgacctctttgcctgtatgcagcttaaagtagacaaagaaaagtggttgtatcga
actcctctacagatgtga

KEGG   Vulpes vulpes (red fox): 112913604
Entry
112913604         CDS       T05911                                 

Gene name
RET
Definition
(RefSeq) proto-oncogene tyrosine-protein kinase receptor Ret
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04020  Calcium signaling pathway
vvp05200  Pathways in cancer
vvp05216  Thyroid cancer
vvp05223  Non-small cell lung cancer
vvp05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    112913604 (RET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112913604 (RET)
   05230 Central carbon metabolism in cancer
    112913604 (RET)
  09162 Cancer: specific types
   05216 Thyroid cancer
    112913604 (RET)
   05223 Non-small cell lung cancer
    112913604 (RET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112913604 (RET)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     112913604 (RET)
Protein kinases [BR:vvp01001]
 Receptor tyrosine kinases (RTK)
  RET family
   112913604 (RET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr RET_CLD4 RET_CLD3 Pkinase RET_CLD1 Cadherin RIO1 Pkinase_fungal
Other DBs
NCBI-GeneID: 112913604
NCBI-ProteinID: XP_025846234
UniProt: A0A3Q7RKR3
LinkDB
Position
Unknown
AA seq 1070 aa
MPLLYVHALRDIPEEVPSFRLGQHLYGIAYRARLHENDWIRIEEDTGLLYLNRSLDHSTW
EKLSIRNGGFPVLTIYVQVFLSSASLREGECQWPGCARVYFSFINTSFPACGSLKPRELC
FPETGVSFRIRENRPPGTFHQFRLLPVQFLCPNISVSYKLLEGENLPFRCAPDSLEVSTR
WALDRELREKYELVAACTVRLGARKEEVVMVPFPVTVYDEDDSAPTFLGGFDAASAVVEF
KRKEGTVVATIHVFDADVVPASGELLRRYTSTLLPGDAWALQTFRVEHSPNETLVQANGS
FVRATVHDYRLVLNRSLPISESRSLQLAVLVNDSDFQGPGEGILLLHFNVTVLPVSLHLP
SAYTFTVSRRARRFAQIGKVCVENCQEFSGIHVQYKLQLSSTNCSVLGVVTSAEDTTGTL
YVNDTEALQRLDCSQLQYTVVAADRPTRRQTQAPLVVTVEGTYVAEEPGCPLSCAVSKRR
PECEECGGLGSLTGRCEWRQGDGKGITRNFSTCSPNVKTCPDGHCDAVESRNVNICPQDC
LRGGSIIGGHEPGDRWGIKAGFGICNCFPEEKKCFCEPEDSQDPLCDELCRTVIAAAVLF
SFIVSMLLSTFCIHRYHKNAHKPPIASAEMTFRRPAQAFPVSYSSSGARRPSLDSMENQV
SVDAFKIPEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFRLKGKAGYTTVAVKMLKENA
SPSELRDLLSEFNLLKQVNHPHVIKLYGACSQDGPLFLIVEYAKYGSLRGFLRESRKAGP
GYVGSGGSRSSSYLDNPEERALTMGDLISFAWQISRGMRYLAEMKLVHRDLAARNVLVAE
GRKMKISDFGLSRDVYEEDSYVKRSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEI
VTLGGNPYPGIPPERLFNLLKTGYRMERPDNCSEEMYGLMLQCWKQEPDKRPVFADISKD
LEKMMVKNRDYLDLAASTPSDSLLYDDGLSEEETPLVDCNNAPLPRTLPSTWIENKLYGM
SDPNWPEESPVPLTRADGTNSVCPRYANDSVYANWMVSPSAAQLMDAFDS
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgcccctgctctatgtccatgccctgcgggacatccctgaggaggtgcctagcttccgc
ctaggccagcacctttacggcatcgcctaccgtgcaaggctgcatgagaatgactggatc
cgcatcgaggaggacacaggccttctctaccttaaccggagcctggatcacagcacctgg
gagaagctcagcatccgcaatggcggcttccctgtgctcaccatctacgtccaggtcttc
ctgtcatctgcatccttgcgtgagggcgagtgccagtggccaggctgtgcccgtgtgtac
ttctccttcattaacacctccttcccagcttgtggttccctcaaaccccgggagctctgc
ttccccgagactggtgtctccttccgcattcgagagaacaggcctcccggcaccttccac
caattccgtttgctgcccgtgcagttcctctgccccaacatcagcgtgtcctacaagctc
ctagaaggtgagaatctgcccttccgttgcgccccggacagcctggaggtgagcacacgc
tgggccctggaccgtgagctgcgggagaagtatgagctggtggccgcgtgcaccgtgcgc
ctcggtgcgcgtaaggaggaggtggtgatggtgcccttccccgtgaccgtgtatgacgag
gacgactcggcgcccaccttcctcgggggcttcgacgctgccagcgctgtggtggagttc
aagaggaaggagggcactgtggtggccacaatacatgtctttgacgcggacgtggtacca
gcatctggggagctcctgaggcgatacacaagtacactactccctggggatgcctgggcc
ctccagacatttcgtgtggaacactcacccaacgagaccttggtccaggccaacggcagc
tttgtgcgggcaactgtgcatgactacaggctggttctcaaccggagcctccccatctcg
gagagccgctccctgcagctggctgttctggtcaatgactcggacttccagggtcccggg
gagggcatcctcttgctccacttcaacgtgacggttctgcctgtcagcctgcacttaccc
agcgcctacaccttcactgtgagcagacgggcccgccgctttgcccagattgggaaagtc
tgtgtggaaaactgccaggagttcagtggcatccacgtgcaatacaagctgcagctctcc
agcaccaactgcagcgtcctgggggtggtcacgtcagccgaggacaccacagggaccctg
tacgtgaatgacacggaagccctgcagcggctcgattgttctcaactccagtacacagtg
gtggctgccgaccggccaacccgcaggcagacccaggccccgctggtcgtcaccgtggag
gggacatatgtggctgaggagccaggctgccccctgtcctgtgcagtcagcaagagacgg
cctgagtgtgaagagtgcggcggcctgggctctctgacgggcaggtgcgagtggagacag
ggagatggcaaagggatcaccagaaacttctccacctgctcccccaatgtcaagacctgc
cctgatggccactgtgatgctgtagagagcaggaatgtcaacatctgcccccaggactgc
ctccggggtggcagcatcatcggtgggcatgagccaggggaccgctgggggataaaagct
ggcttcggaatctgcaactgttttcctgaagagaagaagtgcttctgcgagcctgaagac
agccaggacccactgtgtgatgagctctgccgcacggtgattgcggcggctgtgctcttc
tccttcatcgtctccatgctgctctccaccttctgcatccaccgctaccacaagaatgcc
cacaagccgcccatcgcctccgccgaaatgaccttccgccggcccgcccaggccttccca
gtcagctactcctcatcaggcgcccgccggccctcactggactccatggagaaccaggtc
tctgtggatgccttcaagatcccggaggatcctaagtgggaattccctcggaagaactta
gttcttggaaaaactctgggagaaggtgaatttggaaaagtggtcaaggcaacagctttc
cggctaaaaggcaaagcaggatacacgaccgttgccgtgaagatgctgaaagagaatgct
tccccaagcgagctgcgggatctactatcagaattcaatctcctgaagcaggtcaaccac
ccacatgtcatcaagctgtatggagcctgcagccaggatgggccactcttcctcattgtg
gagtatgccaagtatggctcactgcggggcttcctccgagaaagccgcaaggcgggtcca
ggctatgtgggcagtggaggcagccgaagctccagctacctggacaaccccgaggagcgg
gcgctgaccatgggcgacctcatctcctttgcctggcagatctctcgggggatgcggtac
ctggcagagatgaagcttgtccatcgggacttggccgccagaaacgtcctggtggctgag
gggcggaagatgaagatttcagattttggcctctcccgagatgtttatgaggaagattcc
tacgtgaagaggagcaagggtcggattccagtcaagtggatggcaattgagtctcttttc
gatcatatctataccacccaaagtgatgtgtggtccttcggtgtcctgctgtgggagatt
gtgactctggggggcaacccctaccctgggattcctccagagcggctcttcaaccttctg
aagacaggctaccggatggagaggcctgacaactgcagcgaggagatgtatggtctaatg
ctgcagtgttggaagcaggaaccagacaagaggccagtgtttgctgacatcagcaaagac
ctagagaagatgatggttaagaacagagactacttggacctggcggcgtccaccccatct
gactccctgctttatgacgatggcctctcggaggaggagacacctctggtggactgtaat
aatgctcccctccctcgaacccttccctccacgtggattgaaaacaaactctatggcatg
tcagacccgaactggcctgaagagagtcctgtaccactcacgagagctgatggcactaac
tctgtgtgtccaagatatgcaaatgatagtgtatatgctaactggatggtttcaccctca
gcggcacaattaatggacgcatttgatagttaa

KEGG   Vulpes vulpes (red fox): 112931065
Entry
112931065         CDS       T05911                                 

Gene name
CCDC6
Definition
(RefSeq) coiled-coil domain-containing protein 6
  KO
K09288  coiled-coil domain-containing protein 6
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp05200  Pathways in cancer
vvp05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112931065 (CCDC6)
  09162 Cancer: specific types
   05216 Thyroid cancer
    112931065 (CCDC6)
SSDB
Motif
Pfam: DUF2046
Other DBs
NCBI-GeneID: 112931065
NCBI-ProteinID: XP_025869364
UniProt: A0A3Q7SYM9
LinkDB
Position
Unknown
AA seq 620 aa
MADSASESDTDGAGGNSSSSAAMQSSCSSTSGGGGGGGGGGGGKSGGIVISPFRLEELTN
RLASLQQENKVLKIELETYKLKCKALQEENRDLRKASVTIQARAEQEEEFISNTLFKKIQ
ALQKEKETLAVNYEKEEEFLTNELSRKLMQLQHEKAELEQHLEQEQEFQVNKLMKKIKKL
ENDTISKQLTLEQLRREKIDLENTLEQEQEALVNRLWKRMDKLEAEKRILQEKLDQPVSA
PPSPRDISMEIDSPENMMRHIRFLKNEVERLKKQLRAAQLQHSEKMAQYLEEERHMREEN
LRLQRKLQREMERREALCRQLSESESSLEMDDERYFNEMSAQGLRPRTVSSPIPYTPSPS
SSRPISPGLSYASHTVGFTPPTSLTRAGMSYYNSPGLHVQHMGASHGITRPSPRRSNSPD
KFKRPTPPPSPNTQSPVQPPPCWILRPSPPSERGAAVPGPEQTPAPHSLLHPPPNFPDVP
RNGNWATRCCKGQGPWAKLLMAVTSSPRPPTVPRRTCGQLRVASYLHPHEASCKRPLPQR
GPLCVLLHEDTSAAPGVGNLQPEEHPLPGLRTPPPPGPGACGEGRAGSRKEANLLAAVTS
PESQPITPVANSPKQPRLSN
NT seq 1863 nt   +upstreamnt  +downstreamnt
atggcggacagcgccagcgagagcgacacggacggggcggggggcaacagcagcagctcg
gccgccatgcagtcgtcctgctcgtcgacctcgggcggcggcggcggcgggggaggcggc
ggcggggggaagtcggggggcattgtcatctcgccgttccgcctggaggagctcaccaac
cgcctggcctcgctgcagcaggagaacaaggtgctgaagatcgagctggagacctacaaa
ctcaagtgcaaggcgctgcaggaggagaaccgcgacctgcgcaaagccagcgtgaccatc
caagccagggctgagcaagaggaagaattcatcagtaatactttattcaagaaaatccag
gctttgcagaaggagaaagaaacccttgctgtaaattatgagaaggaagaagagttcctc
actaatgagctctccagaaaattgatgcagttgcagcatgagaaagctgagctagaacag
catctggaacaggagcaggaattccaggtcaacaaactgatgaagaaaataaaaaaactg
gagaatgataccatttctaagcagcttacattagaacagttgagacgagagaagatcgac
cttgaaaatactttggaacaagaacaagaagcactagttaatcgtctctggaaaaggatg
gacaaacttgaagctgagaagcgaatcctgcaggagaagttagaccagccggtctctgct
cctccgtcgcctagagacatctccatggagatagactctccagaaaacatgatgcgccac
atcaggttcttaaagaatgaagtggagaggctgaagaagcagctgagagccgctcagcta
cagcattctgagaaaatggcacagtatctggaggaggagcgtcacatgcgggaggagaac
ctgcggctgcagaggaagctgcagagagagatggagagaagggaagcactctgtcgacag
ctgtccgagagcgagtccagcctggaaatggatgatgaaaggtattttaacgagatgtct
gcacaaggattaagacctcgcactgtgtccagcccgatcccttacacaccttcgccaagt
tcaagcaggcctatatcacccggtctatcatatgcaagtcacacagttggcttcacgcca
ccgacttcactgacaagagccggaatgtcttactacaattccccggggcttcatgtgcag
catatgggagcctcccatggtatcacaaggccttcaccgcggagaagcaacagccctgac
aaattcaaacggcccacgccgcctccgtctcccaacacacagagccccgtgcagccgccg
ccgtgctggattcttaggccctcaccgccttcagaacgtggtgcagcagttccaggcccg
gagcagacccccgccccccactcgctgctgcacccgccacctaacttccccgacgtgccc
agaaacggaaactgggccacgcggtgctgcaaagggcagggaccatgggcaaagcttttg
atggctgtcacttcctccccgcggccccccaccgtgcccaggcggacgtgcgggcagttg
cgtgttgccagttacctgcacccacatgaagcttcctgcaagaggcccctccctcagcgc
gggcccctgtgcgtcctgctgcatgaggacaccagcgcggccccgggggttgggaacctg
cagcctgaggagcacccccttccggggctccgaacccccccacccccggggccaggggct
tgtggggagggtcgtgctggttctcgaaaggaagccaacctgctcgcagcagtaaccagt
ccagaaagccaacccataacccctgtggcaaacagccccaaacagccaagactcagtaac
tga

DBGET integrated database retrieval system