KEGG   Vulpes vulpes (red fox): 112913469
Entry
112913469         CDS       T05911                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp04012  ErbB signaling pathway
vvp04062  Chemokine signaling pathway
vvp04110  Cell cycle
vvp04150  mTOR signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04310  Wnt signaling pathway
vvp04340  Hedgehog signaling pathway
vvp04360  Axon guidance
vvp04390  Hippo signaling pathway
vvp04510  Focal adhesion
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04657  IL-17 signaling pathway
vvp04660  T cell receptor signaling pathway
vvp04662  B cell receptor signaling pathway
vvp04722  Neurotrophin signaling pathway
vvp04728  Dopaminergic synapse
vvp04910  Insulin signaling pathway
vvp04916  Melanogenesis
vvp04917  Prolactin signaling pathway
vvp04919  Thyroid hormone signaling pathway
vvp04931  Insulin resistance
vvp04932  Non-alcoholic fatty liver disease
vvp04934  Cushing syndrome
vvp04935  Growth hormone synthesis, secretion and action
vvp05010  Alzheimer disease
vvp05020  Prion disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05135  Yersinia infection
vvp05160  Hepatitis C
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05165  Human papillomavirus infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05200  Pathways in cancer
vvp05210  Colorectal cancer
vvp05213  Endometrial cancer
vvp05215  Prostate cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112913469 (GSK3B)
   04310 Wnt signaling pathway
    112913469 (GSK3B)
   04340 Hedgehog signaling pathway
    112913469 (GSK3B)
   04390 Hippo signaling pathway
    112913469 (GSK3B)
   04151 PI3K-Akt signaling pathway
    112913469 (GSK3B)
   04150 mTOR signaling pathway
    112913469 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112913469 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112913469 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    112913469 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    112913469 (GSK3B)
   04657 IL-17 signaling pathway
    112913469 (GSK3B)
   04662 B cell receptor signaling pathway
    112913469 (GSK3B)
   04062 Chemokine signaling pathway
    112913469 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    112913469 (GSK3B)
   04917 Prolactin signaling pathway
    112913469 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    112913469 (GSK3B)
   04919 Thyroid hormone signaling pathway
    112913469 (GSK3B)
   04916 Melanogenesis
    112913469 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    112913469 (GSK3B)
   04722 Neurotrophin signaling pathway
    112913469 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    112913469 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112913469 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112913469 (GSK3B)
   05225 Hepatocellular carcinoma
    112913469 (GSK3B)
   05226 Gastric cancer
    112913469 (GSK3B)
   05217 Basal cell carcinoma
    112913469 (GSK3B)
   05215 Prostate cancer
    112913469 (GSK3B)
   05213 Endometrial cancer
    112913469 (GSK3B)
   05224 Breast cancer
    112913469 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112913469 (GSK3B)
   05020 Prion disease
    112913469 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    112913469 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112913469 (GSK3B)
   04931 Insulin resistance
    112913469 (GSK3B)
   04934 Cushing syndrome
    112913469 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112913469 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    112913469 (GSK3B)
   05162 Measles
    112913469 (GSK3B)
   05163 Human cytomegalovirus infection
    112913469 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112913469 (GSK3B)
   05165 Human papillomavirus infection
    112913469 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112913469 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:vvp01001]
    112913469 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:vvp03036]
    112913469 (GSK3B)
Enzymes [BR:vvp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     112913469 (GSK3B)
Protein kinases [BR:vvp01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   112913469 (GSK3B)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112913469 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 112913469
NCBI-ProteinID: XP_025845912
UniProt: A0A3Q7RJF7
LinkDB
Position
Unknown
AA seq 433 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPN
VKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANAGDRGQ
TNNAASASASNST
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaggatggcagcaaggtgaccacagtg
gtggcaactcctgggcagggtccagataggccacaagaagtcagctatacagacactaaa
gtgattggaaatgggtcatttggtgtggtatatcaagccaaactttgtgattcaggagaa
ctggttgccatcaagaaagtattgcaggacaagagatttaagaaccgagagctccaaatc
atgagaaagctagaccactgtaacatagtccgattgcgttatttcttctactcaagtggt
gagaagaaagatgaggtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgctccctgtgatctatgtcaagttg
tatatgtatcagctgttccgaagtttagcctatatccattcctttggaatatgtcatcgg
gatattaaaccacagaacctcttgttggatcctgatacagctgtcttaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcatatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagacgtg
tggtctgcaggctgtgtgttggctgagctgttgctaggacaacctatatttccaggggac
agtggtgtggatcagttggtggaaataatcaaggtcctggggacaccgacaagggagcaa
attagagaaatgaacccaaactacacagaattcaaattccctcaaattaaggcacatcct
tggactaaggattcgtcaggaacaggacatttcacctcaggagtgcgggtcttccgaccc
cggactccaccagaggcaattgcactgtgtagccgtctgctggagtatacaccaactgcc
cgattgacaccactggaagcttgtgcacattcattttttgatgaattaagggacccaaat
gtcaaactaccaaatgggcgagacacacctgcactcttcaacttcaccactcaagaactg
tcaagtaatccacctctagctaccatccttattcctcctcatgctcggattcaagcagct
gcttcaacccctacaaatgccacagcagcctcagatgctaatgccggagaccgtggacag
acgaacaatgccgcttctgcatcagcttctaactccacctga

DBGET integrated database retrieval system