KEGG   Vulpes vulpes (red fox): 112913510
Entry
112913510         CDS       T05911                                 

Gene name
ITGB5
Definition
(RefSeq) integrin beta-5
  KO
K06588  integrin beta 5
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04145  Phagosome
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04810  Regulation of actin cytoskeleton
vvp05165  Human papillomavirus infection
vvp05205  Proteoglycans in cancer
vvp05410  Hypertrophic cardiomyopathy
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112913510 (ITGB5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112913510 (ITGB5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112913510 (ITGB5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112913510 (ITGB5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112913510 (ITGB5)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    112913510 (ITGB5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112913510 (ITGB5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112913510 (ITGB5)
   05414 Dilated cardiomyopathy
    112913510 (ITGB5)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112913510 (ITGB5)
Membrane trafficking [BR:vvp04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    112913510 (ITGB5)
Cell adhesion molecules [BR:vvp04515]
 Integrins
  Integrin beta subunits
   112913510 (ITGB5)
SSDB
Motif
Pfam: Integrin_beta Integrin_B_tail Integrin_b_cyt EGF_2 I-EGF_1
Other DBs
NCBI-GeneID: 112913510
NCBI-ProteinID: XP_025845995
UniProt: A0A3Q7SUJ7
LinkDB
Position
Unknown
AA seq 692 aa
MTPQEIALNLRPGDKTTFQLQVRQVEDYPVDLYYLMDLSLSMKDDLDNIRNLGTKLAEEM
GKLTSNFRLGFGSFVDKNISPFSYTAPRYQTNPCIGYKLFPNCVPSFGFRHLLPLTDRVD
SFNEEVRKQRVSRNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDVPHIALDGK
LGGLVQPHDGQCHLNEANEYTVSNQMDYPSLALLGEKLAENNINLIFAVTKSHYMLYKNF
TALIPGTTVEILHGDSKNIIQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYP
GQRKCEGLKIGDTATFEVAAEARGCPGGPAAAAFTLRPVGFRDSLQVAVTYRCRCGCSAD
PEPDSARCGGKGTYVCGLCECQPGHLGSRCECQEGESQSGRQHLCREAEGRPLCSGRGEC
SCNQCSCFESEFGKIYGPFCQCDNFSCARNRGVLCSGHGECHCGECKCHAGYIGDNCNCS
TDISTCLAKDGQVCSDRGRCVCGQCQCTEPGAFGETCEKCPTCPDACSTKRDCVECLLLH
SGGPAENQTCHSLCKDEVVTRVDTIVKDDQEAVLCFYKTAKDCVMMFTYTELPSGKSNLT
VLKEPECGTAPDATTILLAVVGSILLIGIALLAIWKLLVTIHDRREFAKFQSERSRARYE
MASNPLYRKPISTHSVDFTFNKFNKSYNGTVD
NT seq 2079 nt   +upstreamnt  +downstreamnt
atgacgccacaggagatcgccctgaacctgcggccgggtgacaagactactttccagctg
caggttcgacaggtggaggattatcccgtggacttgtactacctgatggacctctccctg
tccatgaaggacgacttggacaacatccggaacctgggtaccaaactcgctgaggagatg
gggaagctcaccagcaactttcggttggggtttgggtcttttgtagacaagaacatctcc
cctttctcctacacagcgccaaggtaccagaccaatccgtgcatcgggtacaaattattc
ccaaactgcgtcccctcctttggcttccgccatctgctgcctcttactgacagagtggac
agcttcaatgaggaggttcgcaaacagagggtgtcccggaaccgcgacgcgcccgagggg
ggctttgacgccgtcctccaggcagctgtctgcaaggagaagatcggctggcgaaaggat
gcgctgcacttgctggtgttcactacggacgatgtgccccacattgcactagatggaaaa
ctggggggcctggtgcagccacatgatggccagtgtcacctgaacgaggccaacgagtac
actgtgtccaatcagatggactatccgtcccttgccttgcttggagagaaattggcagag
aacaacatcaacctcatctttgcagtgacaaaaagccattatatgctctacaagaatttc
acagccctgatacctgggacaacagtggagattttacacggagactccaaaaatatcatc
caactgattatcaatgcgtacaatagcatccggtctaaagtggagctgtctgtctgggat
cagcctgaggatcttaacctcttcttcactgctacctgccaggacggtgtgtcctaccct
ggccagaggaagtgcgaaggcctaaaaattggggacacggcgaccttcgaggtggcggcg
gaggcccggggctgcccgggcggcccggcggcggccgcgttcacactgcggcccgtgggc
ttccgggacagcctgcaggtggccgtcacctaccgctgccggtgcggctgcagtgcggac
cccgagcccgacagcgcccggtgcggcgggaagggcacctacgtgtgcggcctgtgcgag
tgccagcccggccacctgggcagcaggtgcgagtgccaggagggggagagccagagcggc
cgccagcacctgtgccgcgaagccgagggcaggccgctgtgcagcgggcgcggggagtgc
agctgcaaccagtgctcctgcttcgagagcgagttcgggaagatctacggccctttctgc
cagtgtgacaacttctcctgcgccaggaaccgaggggtcctctgctcaggccacggcgag
tgtcactgtggagaatgcaagtgccacgcaggttacattggggacaactgtaactgctcc
acagacatcagcacgtgcctggccaaggatggtcaggtctgcagcgaccgtgggcgctgt
gtgtgtggccagtgccagtgcacggagccgggagcctttggagagacgtgcgagaagtgc
ccgacctgcccagatgcttgcagcaccaagagggactgcgtcgagtgcttgctgcttcac
tcggggggcccggctgagaaccagacctgccacagcctgtgcaaggatgaggtggtcaca
cgggtggacaccatcgtgaaagatgaccaagaggccgtgctttgcttctacaaaaccgcc
aaggactgtgtcatgatgttcacctacacagagctcccgagcgggaagtccaacctgaca
gtcctcaaggagccagagtgtgggactgcccccgacgccacaaccatcctcctggccgtg
gttgggagcatcctcctgattgggattgcactcctggccatctggaagctgctggtcacc
atccatgaccggagagagtttgcaaagttccagagcgagcgatccagggcccgctatgaa
atggcttccaaccctctgtacagaaagcccatctctacacactccgtggacttcaccttc
aacaagttcaacaaatcctacaatggcacagtggactga

KEGG   Vulpes vulpes (red fox): 112915730
Entry
112915730         CDS       T05911                                 

Gene name
ITGB8
Definition
(RefSeq) integrin beta-8 isoform X1
  KO
K06591  integrin beta 8
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04514  Cell adhesion molecules
vvp04810  Regulation of actin cytoskeleton
vvp05165  Human papillomavirus infection
vvp05410  Hypertrophic cardiomyopathy
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112915730 (ITGB8)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112915730 (ITGB8)
   04514 Cell adhesion molecules
    112915730 (ITGB8)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112915730 (ITGB8)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112915730 (ITGB8)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112915730 (ITGB8)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112915730 (ITGB8)
   05414 Dilated cardiomyopathy
    112915730 (ITGB8)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112915730 (ITGB8)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   112915730 (ITGB8)
Cell adhesion molecules [BR:vvp04515]
 Integrins
  Integrin beta subunits
   112915730 (ITGB8)
SSDB
Motif
Pfam: Integrin_beta PSI_integrin EGF_2 Sigma_reg_N
Other DBs
NCBI-GeneID: 112915730
NCBI-ProteinID: XP_025848946
UniProt: A0A3Q7S2T2
LinkDB
Position
Unknown
AA seq 782 aa
MCRSALAFFTAAFVCLQNCRPGPAPFLRAAWVLLVVLGLGQSEDNRCTSSNAASCTKCLA
LGPECGWCAQEDFISGGLRSERCDIISNLISKGCSTDSIEYPSVHVIPSENEINTQVTPG
EVLIQLRPEAEANFMLKIHPLKKYPVDLYYLVDVSASMHNNIEKLNSVGNDLSRKMAYFS
RDFRLGFGSYVDKTVSPYISIHPERIHNQCSDYNLDCMPPHGYIHVLSLTENITEFEKAV
HRQKISGNIDTPEGGFDAMLQAAVCESHIGWRKEAKRLLLVMTDQTSHLALDSKLAGIVV
PNDGNCHLKNNIYVRSTSMEHPSLGQLSEKLIDNNINVIFAVQGKQFHWYKDLLPLLPGT
IAGEIESKAANLNNLVIDAYQKLISEVKVQVENQVKGVYFNITAICPDGTRKPGTDGCGN
VTSNDEVLFNVTVKMRKCDVTGGKSYAIIKPIGFNETTKIHIHRNCSCQCDDGRGSKRKC
VDEIFLDAKCFQCNENKCHFDEAQFPSETCKSHKDQPVCSGRGVCVCGKCLCHKVKFGKV
YGKYCEKDDFSCPYHHGNLCAGHGECEAGRCQCFSGWEGDRCQCPSASAQHCVNQKGQVC
SGRGTCVCGRCECTDPGSIGRFCEHCPTCHTACSENWNCVQCLHPHNLSQAILDRCKTSC
ALMEQHYMEQTSECFSSPSYLRIFFIIFIVTFLIGLLKVLIIRQVILQWNSNKIKSSADY
RVSASKKDKLILQSVCTRAVTYRREKPEEIKMDISKLNAHETFRSHRRRQTVLDHAGCWL
ST
NT seq 2349 nt   +upstreamnt  +downstreamnt
atgtgccgctccgctctggcttttttcactgccgcatttgtctgcctgcaaaactgccgg
ccgggtccagccccgttccttcgggcggcctgggtgcttttagttgttcttggactgggc
caaagtgaagacaatagatgtacatcttcaaatgcagcatcctgcaccaaatgccttgcg
ctgggtccggaatgtggatggtgtgctcaagaggatttcatttcaggtggattaaggagt
gaacgttgtgatattatttccaacttaataagcaaaggctgctcgactgattcaatagaa
tacccatctgtacatgtaataccaagtgaaaatgaaattaatacccaggtgacaccagga
gaagtgttgatccagctgcgtccagaagctgaagctaattttatgctgaaaattcatcct
ctgaagaaatatcctgtggatctttattacctggttgatgtctcagcatcaatgcacaat
aatattgaaaaattaaattccgttggaaatgatttatctagaaaaatggcatatttttcc
cgtgacttccgccttggatttggctcctatgttgataaaacagtttcaccatacattagc
atccacccagaaaggattcataatcaatgcagtgactacaatttagattgtatgcctcct
catggatacatccatgtgctatctttgacggagaacattactgagtttgaaaaagcagtt
cacagacaaaagatctctggaaacatagatacacctgaaggaggttttgatgccatgctt
caggcagctgtctgtgagagtcatattggatggcgaaaagaagctaaaagattgctgctg
gtgatgacagatcagacatctcatcttgctcttgatagcaaattggcaggaatagtggtg
ccaaatgatggaaactgccatctcaaaaacaacatctacgtcagatcaacaagcatggaa
catccctcactaggccaactttctgaaaagttaatagacaacaacattaatgtcatcttt
gcagttcaaggaaaacagtttcactggtataaggatcttctacccctcttgcctggcacc
atcgctggtgaaatagaatcaaaggctgcaaacttaaataatttggtaatagatgcctat
cagaaactcatttcagaagtgaaagttcaggtggaaaaccaggtaaaaggagtttatttt
aatattactgccatctgtccagatgggacccgaaaaccaggcacagacggatgtggaaat
gtgacaagcaatgacgaagttcttttcaatgtaacagttaaaatgagaaaatgtgatgtc
acaggaggaaagagctatgcaataatcaaacctattggtttcaatgaaaccactaaaatt
cacatacacagaaactgcagctgtcagtgtgatgatgggagaggatctaaacgaaagtgt
gtagatgaaatttttctagatgccaagtgtttccagtgtaatgagaataaatgtcatttt
gatgaggctcaatttccttctgagacttgcaaatcacacaaggatcaacctgtttgcagt
ggacgaggagtttgtgtttgtggaaaatgtttatgtcacaaagttaagtttggaaaagtg
tatggaaaatactgtgaaaaggatgatttctcttgtccatatcaccatggaaatctgtgt
gctgggcatggagagtgtgaagcgggcagatgccagtgcttcagtggctgggaaggggat
cggtgccagtgcccgtcagcatcagcccagcactgtgtcaatcaaaagggccaagtgtgt
agtggaagaggtacatgtgtatgtggcaggtgtgagtgcaccgatcctgggagcattggc
cgcttctgtgaacactgccccacgtgtcacacagcctgcagtgaaaactggaattgtgtg
caatgccttcaccctcacaacctgtctcaagctatacttgatcgttgcaaaacctcatgt
gctcttatggaacagcattatatggagcaaacatcagaatgtttctctagcccaagctat
ttaagaatatttttcatcatcttcatagttacattcttgattgggttgcttaaagtcctt
atcattagacaggtgatactacaatggaatagtaataaaattaagtcctcggcggattac
agggtgtcagcctcaaaaaaggacaagttgattctgcaaagcgtttgcacaagagcagta
acctaccgacgtgagaaacctgaagaaataaaaatggatatcagcaagttaaatgctcat
gaaactttcagaagtcacaggaggagacaaactgttctagatcatgctggttgctggttg
tccacttga

KEGG   Vulpes vulpes (red fox): 112916473
Entry
112916473         CDS       T05911                                 

Gene name
ITGB6
Definition
(RefSeq) integrin beta-6 isoform X1
  KO
K06589  integrin beta 6
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04810  Regulation of actin cytoskeleton
vvp05165  Human papillomavirus infection
vvp05410  Hypertrophic cardiomyopathy
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112916473 (ITGB6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112916473 (ITGB6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112916473 (ITGB6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112916473 (ITGB6)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112916473 (ITGB6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112916473 (ITGB6)
   05414 Dilated cardiomyopathy
    112916473 (ITGB6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112916473 (ITGB6)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   112916473 (ITGB6)
Cell adhesion molecules [BR:vvp04515]
 Integrins
  Integrin beta subunits
   112916473 (ITGB6)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 112916473
NCBI-ProteinID: XP_025849967
UniProt: A0A3Q7RUL1
LinkDB
Position
Unknown
AA seq 808 aa
MKTFKFTSQVSFQSSRELKRMGIELLCLFFLFLGRNDHVQGGCAMGGAETCEDCLLIGPQ
CAWCSQENFTHPSGVGERCDTPATLLAKGCQLTFIENPVSQVEILTNKPLSVGRQKNSSD
IVQIAPQKLTLKLRPGSEQTLQVQVRQTEDYPVDLYYLMDLSASMDDDLNTIKELGSLLS
KEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGFKHILPLTNDA
ERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDS
KLAGIVIPNDGLCHLDNKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYEN
YAKLIPGATVGLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNRALF
PHQKKCSHMKVGDTASFNVTVSIPNCERRNRHIIIKPVGLGDALEILVSPECNCDCQKEV
EVNSSKCHNGNGSFQCGVCACNPGHMGPRCECGEDTLSTDSCKEAPDHPSCSGRGDCYCG
QCVCHLSPYGNIYGPYCQCDDFSCLRHKGLLCGDNGVCDCGECVCRPGWAGEYCNCTTST
DSCGSEDGVLCSGRGDCVCGKCVCTNPGASGPTCERCPTCGDPCNSKRSCIECHLSAEGQ
AREECVDKCKLAGATISEAEDFSKDSSVPCSLQGENECLITFLITTDNEGKTIIHSINEK
DCPKPPNIPMIMLGVSLAILLIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNP
LYRGSTSTFKNVTYKHREKQKMDLSTDG
NT seq 2427 nt   +upstreamnt  +downstreamnt
atgaaaacttttaaatttacatctcaagtttcttttcaaagcagtcgagaactgaaacga
atggggattgaactgctttgcctgttctttctatttctaggaaggaatgatcacgtacaa
ggtggctgtgccatgggaggtgcagaaacctgtgaagactgcttactcattggacctcag
tgtgcctggtgttctcaggagaattttacccatccatctggagttggagaaagatgtgat
accccagcaactcttttagctaaaggatgtcaactaactttcatcgaaaaccccgtctcc
caagtagaaatacttacaaataagcctctcagtgtaggcagacagaaaaatagttctgac
attgttcagattgcgcctcaaaagttgactcttaaattgagaccaggcagtgaacagact
ctgcaagtgcaagtccgccagacggaggattacccagtggacttgtattacctcatggac
ctctcggcatccatggatgatgacctcaatacaatcaaagagctgggctccctgctttcc
aaggagatgtctaaattaaccagcaactttagactgggcttcggctcttttgtggaaaaa
cccgtctccccttttgtgaaaacaacaccagaagaaattgccaacccttgcagtagtatt
ccatacttctgcttacctacatttggattcaaacacattttgccattgacgaatgatgct
gaaagattcaatgaaattgtgaagaatcagaaaatttctgctaatattgacacaccagaa
ggaggatttgatgcaattatgcaagctgctgtgtgtaaggaaaaaattggctggcggaat
gactccctccatctcctggtctttgtgagcgatgctgattctcattttggaatggacagc
aaactggcaggcatcgtcattcctaacgatgggctctgtcacttggacaacaagaatgaa
tactccatgtcaactgtcttggaatatccaacaattggacaactcattgataaactggtg
caaaataacgtgttattaatctttgccgtcacccaagaacaagttcatttatatgagaat
tatgcaaaactcattcctggagctacagtagggctacttcagaaggactctgggaacatt
ctccagctgatcatctctgcttacgaagaactgcggtctgaggtggaactggaagtgtta
ggagacacggaaggactcaacctgtctttcacagctatctgtaacaacagggccctcttc
ccacaccaaaagaaatgctctcacatgaaggtgggagacacagcttcatttaacgtgact
gtgagtataccgaactgtgagagaagaaacaggcacattatcataaagcctgtggggttg
ggggacgccctggaaatacttgtcagtccggaatgcaactgtgactgtcagaaagaagtg
gaggtgaacagctccaaatgccacaacgggaacgggtccttccagtgtggggtgtgtgcc
tgcaaccctggccacatgggtcctcgctgcgagtgtggggaggacacgctgagtacagat
tcctgcaaggaggccccagatcacccctcgtgcagtggaagaggggactgctactgtggc
cagtgcgtctgccacttgtctccctatggaaacatttatgggccttactgccagtgtgac
gacttctcctgcctgaggcacaaagggctgctctgtggagataacggcgtgtgtgactgc
ggggaatgcgtgtgcaggcccggctgggcgggcgagtactgcaactgcaccaccagcacc
gactcctgcggctcggaggacggggtgctctgcagcgggcgaggggactgcgtctgtggc
aagtgtgtttgcacgaaccccggagcctccggcccgacctgtgaacgttgtcctacctgt
ggggatccctgtaactctaaacggagctgcattgaatgccacctgtctgcagaaggccag
gcccgagaagaatgtgttgacaaatgcaaactagctggtgcgaccatcagtgaagcagaa
gatttttcaaaggatagttctgttccctgttctctgcaaggagaaaatgaatgtcttatt
acattcctaataactacagataatgaagggaaaaccatcattcacagcatcaatgagaaa
gactgtccaaagcccccaaacattcccatgattatgttgggggtttcactggccattctt
ctcattggggttgtcctgctgtgcatttggaagctgttggtgtcatttcatgatcgtaaa
gaagttgccaaatttgaagcagaacggtcaaaggccaagtggcaaacgggaaccaatcca
ctatacagaggctccaccagtacctttaaaaatgtaacctataaacacagggaaaaacaa
aagatggacctttccacagatggatag

KEGG   Vulpes vulpes (red fox): 112920636
Entry
112920636         CDS       T05911                                 

Gene name
ITGB3
Definition
(RefSeq) integrin beta-3
  KO
K06493  integrin beta 3
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04015  Rap1 signaling pathway
vvp04145  Phagosome
vvp04151  PI3K-Akt signaling pathway
vvp04380  Osteoclast differentiation
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04611  Platelet activation
vvp04640  Hematopoietic cell lineage
vvp04810  Regulation of actin cytoskeleton
vvp04919  Thyroid hormone signaling pathway
vvp05163  Human cytomegalovirus infection
vvp05165  Human papillomavirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05410  Hypertrophic cardiomyopathy
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
vvp05414  Dilated cardiomyopathy
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    112920636 (ITGB3)
   04151 PI3K-Akt signaling pathway
    112920636 (ITGB3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112920636 (ITGB3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112920636 (ITGB3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112920636 (ITGB3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112920636 (ITGB3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112920636 (ITGB3)
   04611 Platelet activation
    112920636 (ITGB3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    112920636 (ITGB3)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112920636 (ITGB3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    112920636 (ITGB3)
   05205 Proteoglycans in cancer
    112920636 (ITGB3)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112920636 (ITGB3)
   05410 Hypertrophic cardiomyopathy
    112920636 (ITGB3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112920636 (ITGB3)
   05414 Dilated cardiomyopathy
    112920636 (ITGB3)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    112920636 (ITGB3)
   05163 Human cytomegalovirus infection
    112920636 (ITGB3)
   05165 Human papillomavirus infection
    112920636 (ITGB3)
Membrane trafficking [BR:vvp04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    112920636 (ITGB3)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112920636 (ITGB3)
Cell adhesion molecules [BR:vvp04515]
 Integrins
  Integrin beta subunits
   112920636 (ITGB3)
CD molecules [BR:vvp04090]
 Proteins
  112920636 (ITGB3)
SSDB
Motif
Pfam: Integrin_beta Integrin_B_tail Integrin_b_cyt PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 112920636
NCBI-ProteinID: XP_025855236
UniProt: A0A3Q7SIP3
LinkDB
Position
Unknown
AA seq 784 aa
MVVGGQLHCQARLGANAFVSVAVSNICTTRGVRSCQQCLAVSPVCAWCSDEALPLGSPRC
NLKENLLKDNCALESIEFPISEVRILEARPLSNKGSGDSSQITQVSPQRIALRLRPDDSK
NFSIQVRQVEDYPVDIYYLMDLSYSMKDDLSSIQNLGTKLASQMHKLTSNLRIGFGAFVD
KPVSPYMYISPPEALKNPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSRNRDA
PEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCHVGSD
NHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGILSTDSS
NVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCVGLKIGDTVSFS
IEAKVRGCPQEKEKSFTIKPVGFKDSLTVQVTFDCDCACQAQAEPSSHRCNNGNGTFECG
VCLCGPGWLGSQCECSEEDYHPSQQDECSPREGQPACSQRGECLCGQCVCHSSDFGKITG
KYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLLCGGR
GKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDDNTCNRYCRDE
IESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDILVVLL
SVMGAILLIGLATLLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTFTNIT
YRGT
NT seq 2355 nt   +upstreamnt  +downstreamnt
atggttgtaggaggtcagctacactgtcaggccaggttgggtgctaatgcctttgtctct
gttgcagtgtccaacatctgtaccacacgaggtgtccgctcctgccagcaatgtctagct
gtgagtcctgtgtgtgcctggtgctcagatgaggccctgcctctgggctctccccgctgt
aacctgaaggaaaatctgctgaaggataactgtgccctggaatccattgagttccccatc
agtgaggtccgcatcctggaggccaggccccttagcaacaagggttctggagacagttcc
cagattactcaagtcagccctcagaggattgcgctgcggctccggccagatgattcaaag
aatttctccatccaagttcggcaagtagaggattaccctgtggacatctactacttgatg
gacctgtcttattccatgaaggatgatctgtcgagcatccagaacctaggcaccaagctg
gcctcccagatgcacaagctcaccagtaacttgcggattggcttcggggcttttgtggac
aagcctgtgtctccatacatgtacatctccccaccagaggccctcaaaaacccctgctat
gatatgaagaccacctgtttgcctatgtttggctacaaacatgtgctgacgctaactgac
caggtgacccgcttcaatgaggaagtgaaaaagcagagtgtgtcacggaaccgagatgcc
ccagagggcggctttgatgctatcatgcaggctacagtctgtgatgagaagattggctgg
aggaatgatgcatcccacttgctggtatttaccactgatgccaagacccatatagcgctg
gatggaaggctggcaggcattgtccaacctaacgatgggcagtgtcacgttggcagtgac
aaccattattctgcctccactactatggattatccctctctgggactgatgacagagaag
ctatcccagaaaaacatcaatttgatctttgcagtaacggaaaatgtggtcaatctctac
cagaactacagtgagctcatcccagggaccacagtggggattctgtctacggattccagc
aatgtccttcagctcattgttgatgcttatggaaaaatccgctctaaagtggagctggaa
gtgcgtgacctccccgaggagttgtctctatccttcaacgccacctgtctcaacaatgag
gtcatcccgggcctcaagtcttgtgtcggcctcaagattggagacacggtgagctttagc
attgaggccaaggtgcgaggctgcccccaggagaaggagaagtccttcaccatcaagccc
gtgggcttcaaagacagcctcaccgtccaggtcacctttgactgtgactgtgcctgccag
gcccaggctgagccttccagtcaccgctgcaacaatggcaatgggacctttgagtgtgga
gtgtgcctctgtgggcctggctggctggggtcccagtgtgaatgctcagaagaggactat
catccctcccagcaggacgagtgcagcccccgggagggccagcccgcctgcagccagcgg
ggcgagtgcctgtgtggccaatgtgtctgccacagcagtgactttggcaagatcacgggc
aagtactgcgagtgtgatgacttctcctgtgtccgctacaagggggagatgtgctcaggc
catggccagtgcagctgtggggactgcctgtgtgactccgactggaccggctactactgc
aactgtaccacgcgcactgacacgtgcatgtccagcaacgggctgctgtgcggcggtcgg
ggcaagtgtgagtgtggcagctgcgtgtgcatccaacctggctcctacggggacacctgc
gagaagtgccccacctgccctgacgcctgcacctttaagaaggagtgtgtggagtgtaag
aaatttgaccgaggagctctccatgatgataatacctgcaaccgttactgtcgtgatgag
attgaatctgtgaaggagcttaaggatactggcaaggatgcagtgaattgtacatacaag
aatgaggatgactgtgtcgtcagatttcagtactatgaagactccagtggaaagtccatt
ctctatgtggtagaagagccagagtgtcccaagggtcctgacatcctggtggtcctgctt
tcagtgatgggggccattttgctcattggccttgctactctgctcatctggaagctcctc
atcaccatccatgatcggaaggagtttgctaaatttgaggaagaacgagccagagcaaaa
tgggacacagccaacaacccactgtataaagaggccacatccacttttaccaacatcacc
taccggggcacttaa

KEGG   Vulpes vulpes (red fox): 112920800
Entry
112920800         CDS       T05911                                 

Gene name
ITGB4
Definition
(RefSeq) integrin beta-4 isoform X1
  KO
K06525  integrin beta 4
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04810  Regulation of actin cytoskeleton
vvp05165  Human papillomavirus infection
vvp05410  Hypertrophic cardiomyopathy
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112920800 (ITGB4)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112920800 (ITGB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112920800 (ITGB4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112920800 (ITGB4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112920800 (ITGB4)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112920800 (ITGB4)
   05414 Dilated cardiomyopathy
    112920800 (ITGB4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112920800 (ITGB4)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   112920800 (ITGB4)
  Exosomal proteins of bladder cancer cells
   112920800 (ITGB4)
Cell adhesion molecules [BR:vvp04515]
 Integrins
  Integrin beta subunits
   112920800 (ITGB4)
CD molecules [BR:vvp04090]
 Proteins
  112920800 (ITGB4)
SSDB
Motif
Pfam: Integrin_beta fn3 Calx-beta Integrin_B_tail PSI_integrin I-EGF_1 Pur_ac_phosph_N EGF_2 SEA
Other DBs
NCBI-GeneID: 112920800
NCBI-ProteinID: XP_025855540
UniProt: A0A3Q7SJI3
LinkDB
Position
Unknown
AA seq 1751 aa
MAGPSPHPWTWLLLAVLMTVSFPGEMANRCKRAQVKSCTECIRVDQDCAYCVDEMFKERR
CNTQEELLAAGCRWESVVVMKSSFTITEEIEINKTLRRSQVSPQGLRARLRPGEEQHFEL
LVFEPRESPMDLYILMDFSNSMSDDLDNLKQMGERLAQVLSQLTNDYTIGFGKFVDKVSV
PQTDMRPEKLKEPWPNSDPPFSFKNVISLTENLEEFRNKLLGERISGNLDAPEGGFDAIL
QVAVCTRDIGWRPDSTHLLVFSTESAFHYEADGANVLAGIMSRNDEACHLDTSGTYTQYK
TQDYPSVPTLVRLLGKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQEDSSNIVELLE
EAINRIRSNLDIRALESPRGLRTEVTSRMFQKTNTGSFHIQRGEVGTYQVQLRALEFVDG
THVCQLGEEDQKGNIHLKPSFSDGLRMDVGIICDVCPCELQKEVLSARCSYHGDFMCGHC
VCNEGWSGKTCSCSTGSLSDIKPCLREGEDKPCSGRGECQCSHCVCYGEGRYEGPFCEYD
NFQCPRASGVLCNDRGRCSMGQCVCEAGWTGLSCDCPLSNATCIDSSGGICNGRGYCECG
RCHCNQHSLYTDTTCEINYSAIRLGLCEDLRSCVQCQAWGTGEKKGRTCEECSFKVKMVD
ELKKGEEVLEHCSFRDEEDDCTYSYTVEGDGTPGPNSTVLVHKKKECPPRSFWWLIPLLI
FLLLLLALLLLLCWKYCACCKACLALLPCCNRGHMVGFKEDHYMLRENLMSSDHLDTPML
RSGNLKGRDMVRWKITNNVQRPGFATHTSSINPTELVPYGLSLRLARLCTENLLKPGTRE
CDQLRQEVEENLNEVYRQITDTHKIQQTKFRQQPNSGKKQDHTIVDTVLTAPRSAKQALL
KLTEKHVEQGAFHELKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQ
LLVEAIDVPMGTATLGRRLVNITIIKEQASGIVSFEKPEFLVSGGEQVARIPVVRRILDS
GKSQVSYRTQDNTAQGNRDYIPAEGDLLFQPGETWKELQVKLLELQEMDALLRGGQTRRF
HIQLSNPKFGARLGQPHLATVIIGERDELDRNFTSQMLSSFPSHHGELGAPQNPNAKAAG
SRKIHFNWLPPPGKPAGYRVKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCAY
GAQGEGPYSSLVSCRTQQEVPSEPGRLAFNVVSSTVTQLSWGEPAETNGEITAYEVCYGL
VNEDNRPIGPMKKVLVDSPKKRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQ
PKRPMSIPIIPDIPIVDAQCGEDYESFLMYSDDVLRSPTGSQRPSVSDDTEHLVNGRMDF
AFPGSANSLHRMTVANTAYGTHLSPHVSHRVLSTSSTLTRDYHSLTRTEHSHSATLPRDY
STLTSLSSHNSRLAPSLPNTPTRLVFSALGPTSLKVSWQEPQCEQVLQGYSVEYQLLNGG
ELYRLNIPNPSQTSVVVEDLLPNHSYLFRVRAQSQEGWGPEREGVITIESQVHPQSPLCP
LPGSPFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPEGNILGYVVTCEMAHGGEPATFL
VDGDSPESRLTVPGLCENVPYKFKVQARTTEGCGPEREGIITIESQDGGPFPQLGSHLGL
VQHPLPGEYSSITTTHTSTTEPFLLDGLTLGSQRLEASGSLTRHVTQEFVSRTLTTSGTL
STQVDQQFFQT
NT seq 5256 nt   +upstreamnt  +downstreamnt
atggcaggaccgagtccccacccatggacctggctgctgctggcagtcctgatgactgtc
agcttccccggggaaatggcgaaccgctgcaagagggcccaggtgaagagctgcacggag
tgcatccgcgtggaccaagactgtgcctactgtgtggatgagatgttcaaggagcggcgc
tgcaacacccaggaagagctgctggctgcgggctgccggtgggagagcgtggtggtcatg
aagagcagcttcacgatcacagaggagatcgagatcaacaagaccctgcggcgcagccag
gtgtccccccaggggctgcgggcccggctgcggccaggcgaggagcagcactttgagctg
ttggtgtttgagcccagggagagccctatggacctgtacatcctcatggacttctccaac
tccatgtccgatgatctggacaacctcaagcagatgggggaaaggctggcccaggtcctg
agccagctcaccaatgactacaccattggatttggcaagtttgtggacaaagtcagcgtc
cctcagacagacatgaggcctgagaagctgaaggagccctggcccaacagcgaccccccc
ttctccttcaaaaatgttatcagcctgacggaaaacttggaggagtttcggaataaactg
ctgggagaacggatctcaggcaacctggacgctcccgaaggaggttttgatgccatcctg
caggtggccgtgtgcacgagggacattggctggcgccccgacagcacccacctgctggta
ttctccaccgagtcagctttccactatgaggccgatggtgccaacgtgctggctggcatc
atgagccgcaatgacgaggcatgccacctggacacctcgggcacctatacccagtacaag
acacaggactatccatcagtacccaccctggtgcgcctgcttggcaaacacaacattatc
cccatcttcgccgtcaccaactactcctacagctattacgagaagctgcacacctacttc
cccgtctcctcgcttggggtgctgcaagaggactcctccaacattgtggagctgctggag
gaagccatcaatcgcattcgttctaacctggacatccgggccctggaaagtccccgaggc
ctgcggacagaggtcacctccaggatgttccaaaagacaaataccggctcctttcatatc
cagcgtggggaagtgggcacataccaggtgcagctgagggccttggaatttgtggatggg
actcacgtgtgccagttgggagaggaggaccagaagggcaacatccacctgaagccctcc
ttctcagatggcctcaggatggatgtgggcatcatctgtgacgtatgcccctgtgagctg
caaaaagaggtgctttcagctcgctgcagctaccacggagacttcatgtgtggacactgt
gtgtgcaatgagggctggagtggcaagacctgcagctgctccactggttcactgagtgac
ataaagccctgcctgagggagggtgaagacaagccgtgctctgggcgtggcgagtgccaa
tgcagccactgtgtgtgctatggagaaggccgctatgagggtccattctgcgagtatgac
aacttccagtgtccccgtgcctcgggggtcctctgtaatgaccggggacggtgttccatg
ggccaatgtgtgtgtgaggctggctggacaggcttgagctgtgactgtcctctcagcaat
gccacctgcatcgacagcagtgggggcatctgtaatgggcgtggctactgtgagtgcggc
cgctgtcactgcaaccagcactcactctacacggacaccacctgtgagatcaactactct
gcgatccgcctgggcctctgcgaggacctgcgctcctgtgtgcagtgccaagcctggggc
accggtgagaagaagggccgcacgtgcgaggagtgcagcttcaaggtcaagatggtggac
gagcttaagaaaggagaggaggtgttggagcactgctccttccgggatgaggaggatgac
tgcacatacagctacaccgtggagggcgacggcaccccggggcccaatagcactgtcctg
gtgcacaagaagaaagagtgcccacccaggtccttctggtggctcatccctctgctcatc
ttcctcctgctgctcctggcactgctgttgctgctctgctggaagtactgtgcctgctgc
aaggcttgcctggcacttcttccttgctgcaaccgaggtcacatggtgggcttcaaagag
gaccactacatgctgcgggagaacctgatgtcctctgaccacctggacacgcccatgcta
cgcagcgggaacctcaagggacgtgatatggtcagatggaaaatcaccaacaacgtgcag
cggcctggctttgccacccacacctccagcatcaaccccacagagctggtgccctatggg
ctgtccctgcgcctcgcccgcctatgcaccgagaacctgctaaagccgggcacgcgagaa
tgtgaccaactgcgccaggaggtggaggagaacctgaatgaggtgtacagacagatcaca
gacacacacaagatccagcagaccaaattccggcagcagcccaactctgggaaaaagcag
gaccacaccattgtggacacggtgctgacggcgccgcgctcggccaagcaggccctgctc
aagctgacagagaagcacgtggagcagggggctttccacgagctcaaggtggcccccggc
tactacaccctcactgcagaccaggatgctcggggcatggtggagttccaggagggcgtg
gagctggtagacgtgcgggtacccctctttatccggccggaggatgacgatgagaagcag
ctgctggttgaggccatcgacgtacccatgggcacggccaccctcgggcgccgcttggta
aacatcaccatcatcaaggagcaagccagcgggatagtgtccttcgagaagcccgagttc
ttggtcagcggcggggagcaagtggcccgcattcctgtcgtccggcgcattctggacagt
ggcaagtcccaggtctcctaccgcacacaggataacactgcacagggcaaccgggactac
atccccgcagagggtgacctactgttccaacctggggagacctggaaggagctgcaggtg
aagctcctggagctgcaggagatggatgccctcctgcggggcggccagacccgccgcttc
cacattcaactcagcaaccccaagtttggagcccgcctgggccagccccacttagccacc
gtcatcattggggaacgagatgaactggacaggaacttcacaagccagatgctgtcatcc
ttcccatcccaccatggtgaactgggtgccccccagaaccctaatgccaaggctgccggg
tcccggaaaatccacttcaactggctgccccctcctggcaagccagcagggtacagggtg
aagtactggatccagggtgactctgagtccgaagcccacctgcttgacagcaaagtgccc
tcagtggagctcaccaacctgtacccatattgcgactatgagatgaaggtgtgcgcctat
ggggcccagggcgagggcccgtacagctccttggtgtcctgccgcacgcagcaggaagtg
cccagcgagccagggcggctggccttcaatgtcgtctcctctacggtgacccagctgagc
tggggtgagccggctgagaccaacggcgagatcacggcctatgaggtctgctacggcttg
gtcaacgaggacaaccgacccatcgggcccatgaagaaggtgttggtggacagtcccaag
aagcggatgctgctcattgagaacctgcgggagtcccagccataccgctacacggtcaag
gcgcgcaatggggcaggctgggggcccgagcgggaggccatcatcaacctggccacccag
cccaagaggcccatgtccatccccattatcccggacatccccattgtggacgcccagtgt
ggggaagactatgagagcttcctcatgtacagtgatgacgttctacgctcccctactggc
agccagaggcctagcgtctccgatgacactgagcatctggtgaacggacggatggacttt
gccttcccgggcagcgccaactccctgcacaggatgacggtggccaacactgcctatggg
acccacctgagcccacacgtgtcccaccgggtgctgagtacatcctccaccctcacgcgg
gactaccactcgctgacccgcacagaacactcccactctgccacgctgcccagagactac
tccaccctcacctccctctcctcccacaactcccgcttggccccgagtttgcccaacaca
cccacccgcctggtgttctcagcactgggacccacatctctgaaagtgagctggcaggag
ccacagtgtgagcaggtgctgcagggctacagcgtggagtaccagctgctgaacggcggg
gagctgtatcggctcaacatccctaaccccagccagacttcagtggtggtggaagacctt
ctgcccaaccattcctacctgttccgcgtacgggcccagagccaggaaggctggggccca
gaacgcgagggcgtcatcaccattgagtcccaggtgcacccccagagtccgctctgcccc
ctgccaggctcccccttcactttgagcacacccagtgccccaggcccactggtgtttact
gccctgagcccagactccctgcagttgagctgggagcggccacgcaggcctgaagggaac
atccttggctacgtggtgacctgtgagatggcccatggaggagaaccagccacgttcctg
gtggatggggacagccccgagagccggctgaccgtgccaggcctctgtgagaacgtgccc
tacaaattcaaggtacaggccaggaccaccgagggctgtgggccagagcgtgagggcatc
atcaccattgagtcccaggatggaggccctttcccacaactgggcagccaccttggactc
gtccagcacccactgccaggcgagtacagcagcatcaccaccacccacaccagtacaact
gaacccttcctactggatggactgaccctggggtcccagcgcctggaagcaagtggctcc
ctcacccgccacgtgactcaggagtttgtgagccggacactaaccaccagtggcaccctc
agtacccaggtggaccagcagttcttccagacctga

KEGG   Vulpes vulpes (red fox): 112921264
Entry
112921264         CDS       T05911                                 

Gene name
ITGB7
Definition
(RefSeq) integrin beta-7
  KO
K06590  integrin beta 7
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04151  PI3K-Akt signaling pathway
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04514  Cell adhesion molecules
vvp04672  Intestinal immune network for IgA production
vvp04810  Regulation of actin cytoskeleton
vvp05165  Human papillomavirus infection
vvp05202  Transcriptional misregulation in cancer
vvp05410  Hypertrophic cardiomyopathy
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    112921264 (ITGB7)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112921264 (ITGB7)
   04514 Cell adhesion molecules
    112921264 (ITGB7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112921264 (ITGB7)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112921264 (ITGB7)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    112921264 (ITGB7)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    112921264 (ITGB7)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112921264 (ITGB7)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112921264 (ITGB7)
   05414 Dilated cardiomyopathy
    112921264 (ITGB7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112921264 (ITGB7)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112921264 (ITGB7)
Cell adhesion molecules [BR:vvp04515]
 Integrins
  Integrin beta subunits
   112921264 (ITGB7)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt PSI_integrin I-EGF_1 EGF_2
Other DBs
NCBI-GeneID: 112921264
NCBI-ProteinID: XP_025856292
UniProt: A0A3Q7T783
LinkDB
Position
Unknown
AA seq 845 aa
MVALLTVLVLLLALRRGESELDAKISSAEKATEWRDPDLSLLGSCQPAPSCRECILSHPS
CAWCKQLNFTASGEAEERRCGPAQELLARGCAPTALEEPRGRQEVLQERDPGAEPPPAAG
EPQRLAVRFRRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHDVGEEDAPPRDPGAEPPPA
AGEPQRLAVRFRRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHDLLVRLREVTQSVRIGF
GSFVDKTVLPFVSTVPAKLRHPCPTRLERCQPPFSFRHVLSLTGDATAFEREVGRQSVSG
NLDSPEGGFDAILQAALCQEKIGWRNVSRLLVFTSDDTFHTAGDGKLGGIFMPSDGHCHL
DSNGLYSRSPEFDYPSVGQVAQALSAANIQPIFAVTSATLPVYQELSKLIPKSAVGELSE
DSSNVVQLIMDAYNSLSSTVTLEHSALPPGVHISYESLCGDPEKREAEAGDRGQCSHVPI
NHTVNFLVTLQATRCLPEPHLLRLRALGFSEELTVELHTLCDCNCSDTQPQAPHCSDGQG
HLQCGVCSCAPGRLGRLCECSEAELSSPDLESGCRAPNGTGPLCSGKGRCQCGRCSCSGQ
SSGPLCECDDASCERHEGILCGGFGHCQCGRCHCHANRTGSACECSMDTDSCLGPEGEVC
SGRGDCKCNRCQCRDGYFGALCEQCSGCKTSCERHRDCAECGAFGTGPLATNCSVACAHY
NVTLALVPVLDDGWCKERTLDNQLLFFLVEEEAGGMVVLTVRPQERGADHTQAIVLGCVG
GIVAVGLGLVLAYRLSVEIYDRREFSRFEKEQKHLNWKQENNPLYRSAITTTVNPHFQET
GSLLS
NT seq 2538 nt   +upstreamnt  +downstreamnt
atggtggctttgttaacggtccttgttctcctgttggccctgaggagaggggagagtgaa
ttggatgccaagatctcctccgcagagaaggccacagaatggagggatcctgacctgtcc
ctgctggggtcctgccagcctgccccctcctgccgggaatgcatcctctcacacccgagt
tgtgcgtggtgcaagcaactgaacttcacggcgtcgggggaagcggaggagcggcgctgc
ggccccgcccaggagctgctggcccgcggctgcgccccgacggcgctggaggagccccgc
gggcggcaggaggtgctgcaggagcgggatcccggcgctgagcccccgcccgccgcaggg
gagccgcagcggctggccgtgcgcttccgccgggccgagggctacccggtggacctgtac
tacctcatggacctgagctactccatgaaggacgacctggagcgcgtgcgccagctcggc
cacgacgtgggggaggaggatgccccccccagggatcccggcgctgagcccccgcccgcc
gcaggggagccgcagcggctggccgtgcgcttccgccgggccgagggctacccggtggac
ctgtactacctcatggacctgagctactccatgaaggacgacctggagcgcgtgcgccag
ctcggccacgacctgctggtgcggctgcgggaggtcacccagtcggtgcgcatcggcttc
ggctccttcgtggacaagacggtgctgcccttcgtgagcacggtgcccgccaagctgcgc
cacccctgccccacccggctggagcgctgccagccgcccttcagcttccgccacgtgctg
tccctgaccggcgacgccacagccttcgagcgagaggtgggccgccagagcgtgtcgggc
aacctggactcgcccgaaggcggcttcgatgccattctgcaggctgcgctctgccaggag
aagatcggctggagaaacgtgtcccggctgctggtgttcacttcagacgacacgttccac
acagctggggatgggaagttgggtggcattttcatgcccagcgatgggcactgccacttg
gacagcaacggcctctacagccgcagcccagagtttgactacccctctgtgggccaggta
gcccaggccctgtccgcagcaaacatccagcccatctttgccgtcaccagtgccacgctg
cctgtctaccaggagctgagcaagctgattcctaagtccgcagtgggggagctgagtgag
gactccagcaacgtggtacagctcatcatggacgcgtacaatagcctgtcatccactgtg
accctcgaacactccgcgctccctcctggggtccacatctcctacgagtctctgtgtggg
gatcctgagaagagggaggctgaggctggggaccgcggccagtgcagccacgtccccatc
aaccacacggtgaactttctggttactctccaagctacccgctgcctcccagagccccat
cttctgaggctccgagcgcttggcttctccgaggagctgactgtggagctgcacacactg
tgtgactgtaactgcagcgacacccagccccaggcgccccactgcagtgacggccagggg
cacctgcagtgtggggtatgcagctgtgcccccggccgcctgggtaggctctgtgaatgc
tcggaggctgagttgtcctccccagacctggagtctgggtgccgggcccccaacgggaca
gggcccttgtgcagcgggaagggacggtgccagtgtggacgctgcagctgcagtggacag
agctccgggcctctgtgcgagtgtgatgatgccagctgtgagcgacacgagggcatcctc
tgtggaggctttggccactgccagtgtggaaggtgtcactgccacgccaaccgcaccggc
tcagcgtgcgagtgcagcatggacacagacagctgtctcggtccagagggggaggtctgc
agcgggcgcggggactgcaagtgcaaccgctgccagtgccgggacggctacttcggtgcc
ctctgtgagcagtgctcaggctgcaagacatcatgtgagagacacagggactgtgctgag
tgtggggcctttgggactggtcccctggccaccaattgcagcgtggcttgtgcccattac
aatgtgactctggctttggtccctgtcctggatgacggctggtgcaaagagaggacccta
gacaaccagctgctgttcttcctggtggaggaggaagccggaggcatggttgtgttgaca
gtgagaccccaagagagaggcgcggatcacacccaggccatcgtgttgggctgtgtaggg
ggcatcgtggcagtggggctggggctggtcctggcttaccggctttccgtggaaatctac
gaccgccgagaattcagccgctttgagaaggagcagaagcacctcaactggaagcaggaa
aacaatcctctctacagaagcgccatcacgaccacggtcaacccccactttcaggagaca
gggagtctcctttcctga

KEGG   Vulpes vulpes (red fox): 112921568
Entry
112921568         CDS       T05911                                 

Gene name
ITGB1
Definition
(RefSeq) integrin beta-1
  KO
K05719  integrin beta 1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04015  Rap1 signaling pathway
vvp04145  Phagosome
vvp04151  PI3K-Akt signaling pathway
vvp04360  Axon guidance
vvp04510  Focal adhesion
vvp04512  ECM-receptor interaction
vvp04514  Cell adhesion molecules
vvp04530  Tight junction
vvp04611  Platelet activation
vvp04670  Leukocyte transendothelial migration
vvp04810  Regulation of actin cytoskeleton
vvp05100  Bacterial invasion of epithelial cells
vvp05133  Pertussis
vvp05135  Yersinia infection
vvp05140  Leishmaniasis
vvp05145  Toxoplasmosis
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05222  Small cell lung cancer
vvp05410  Hypertrophic cardiomyopathy
vvp05412  Arrhythmogenic right ventricular cardiomyopathy
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    112921568 (ITGB1)
   04151 PI3K-Akt signaling pathway
    112921568 (ITGB1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    112921568 (ITGB1)
   04514 Cell adhesion molecules
    112921568 (ITGB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    112921568 (ITGB1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112921568 (ITGB1)
   04530 Tight junction
    112921568 (ITGB1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112921568 (ITGB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    112921568 (ITGB1)
   04670 Leukocyte transendothelial migration
    112921568 (ITGB1)
  09158 Development and regeneration
   04360 Axon guidance
    112921568 (ITGB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112921568 (ITGB1)
   05205 Proteoglycans in cancer
    112921568 (ITGB1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    112921568 (ITGB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112921568 (ITGB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    112921568 (ITGB1)
   05414 Dilated cardiomyopathy
    112921568 (ITGB1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    112921568 (ITGB1)
   05133 Pertussis
    112921568 (ITGB1)
   05100 Bacterial invasion of epithelial cells
    112921568 (ITGB1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112921568 (ITGB1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112921568 (ITGB1)
   05140 Leishmaniasis
    112921568 (ITGB1)
Membrane trafficking [BR:vvp04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    112921568 (ITGB1)
Exosome [BR:vvp04147]
 Exosomal proteins
  Proteins found in most exosomes
   112921568 (ITGB1)
Cell adhesion molecules [BR:vvp04515]
 Integrins
  Integrin beta subunits
   112921568 (ITGB1)
CD molecules [BR:vvp04090]
 Proteins
  112921568 (ITGB1)
SSDB
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Other DBs
NCBI-GeneID: 112921568
NCBI-ProteinID: XP_025856628
UniProt: A0A3Q7SJQ2
LinkDB
Position
Unknown
AA seq 798 aa
MNLQLIFWIGLIGSICCVFGQADENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCHPDDIENPRGSKDIKKNKNVTNRSKGTAEKLQPEDITQIQPQQLV
LQLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENDVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENSKLPEGVTINYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITSNKCPNKNSETIKIKPLGFTEEVEVILQFICECECQSEGIPSSPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTTSCL
ATNGQICNGRGVCECGACKCTDPKFQGPTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT
CAQECSHFNITKVENRDKLPQPGQVDPLSHCKEKDVDDCWFYFTYSVNGNNEAIVHVVET
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
NT seq 2397 nt   +upstreamnt  +downstreamnt
atgaatttacaactgattttctggattggactgatcggttcaatttgctgtgtgtttggc
caagcagatgaaaatagatgtttaaaagcaaatgccaaatcatgtggagaatgtatacag
gcggggccaaattgtggatggtgtactaattcaacgtttttacaagaaggaatgcccact
tctgcacggtgtgatgacttagaagctttaaaaaagaagggatgccatccagatgacata
gaaaatcccagaggctccaaagatataaagaaaaataaaaatgtaaccaaccgtagcaaa
ggaacagcagagaagctccagccagaagatattactcagatccaacctcagcagttggtt
ttgcaattacgatcaggagagccacagacgtttacattaaaattcaagagagctgaagac
tatcctattgatctctactaccttatggacctctcctactctatgaaagatgatttggag
aatgttaaaagtcttggaacggatctgatgaatgaaatgaggaggattacttcagacttc
cgaattgggtttggttcatttgtggagaaaactgtgatgccttacattagtacgacgcca
gctaagctcaggaacccttgcaccagtgaacagaactgcaccagtccttttagctacaaa
aatgtgctcagtcttactgataaaggggaagtatttaatgaacttgttgggaaacagcgc
atatctggaaatttggattctccagaaggtggctttgatgcaatcatgcaagttgcggtt
tgtggatcattgattggctggaggaatgtcacacggctgctggtgttttccacagacgct
ggatttcactttgctggagatggcaaacttggtggcattgttttaccaaatgatggacag
tgtcacctggaaaatgatgtgtacacaatgagccattattatgattatccttctattgct
caccttgtccagaaactaagtgaaaataacattcagacaatttttgcagttacagaagaa
tttcagcccgtttacaaggaactgaaaaatttgatccctaagtcagcagtaggaacatta
tctgcaaattctagcaacgtaattcagttgattattgatgcctacaactccctttcctca
gaagtcattttggaaaacagtaaactgccagaaggagttacaataaattacaaatcttac
tgtaagaatggggtgaatggaacaggggaaaatggaagaaaatgttccaatatttccatt
ggagatgaggttcaatttgaaattagtataacttcaaataaatgtccaaataagaattct
gaaaccattaaaattaagcctttgggctttactgaagaagtagaagttattcttcagttc
atctgtgaatgtgaatgccagagtgaaggcatccctagtagtccaaaatgtcatgaagga
aatgggacgtttgagtgtggagcttgcaggtgcaacgagggacgtgttggtagacattgt
gaatgtagcacagatgaagttaacagtgaagatatggatgcttactgcaggaaagaaaac
agttcagaaatctgtagtaacaatggagagtgtgtctgtggacaatgtgtttgtaggaag
agggataatacaaatgaaatttattctggcaaattttgcgagtgtgataatttcaactgc
gataggtccaatggcttaatttgtggaggaaatggtgtttgcaagtgtcgtgtgtgcgag
tgcaaccccaactacactggcagtgcctgtgactgttctctggacacgacttcatgcctg
gccacgaacgggcagatctgcaatggcaggggcgtctgtgagtgtggtgcctgtaagtgc
acagaccccaagtttcaagggccaacctgtgagatgtgtcagacctgccttggtgtctgt
gctgaacataaagaatgtgttcagtgcagagccttcaataaaggagaaaagaaagacact
tgcgcacaggaatgttcacatttcaacattaccaaggttgaaaatcgggacaaattacca
caaccaggccaggttgatcccctatcccattgtaaagagaaggatgttgacgactgctgg
ttctatttcacatattcagtgaatgggaataatgaggccattgttcatgttgtagagaca
ccagagtgccccactggaccagacatcattccaattgtagctggtgtggttgctggaatt
gttcttattgggcttgcgttgctgctgatttggaagcttttaatgataattcatgacaga
agggaatttgccaaatttgaaaaggaaaaaatgaatgccaaatgggacacgggtgaaaat
cctatttataagagtgctgtgacaactgttgtcaatccgaagtatgagggaaaatga

DBGET integrated database retrieval system