KEGG   Vulpes vulpes (red fox): 112913526
Entry
112913526         CDS       T05911                                 

Gene name
TFRC
Definition
(RefSeq) transferrin receptor protein 1
  KO
K06503  transferrin receptor
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04066  HIF-1 signaling pathway
vvp04144  Endocytosis
vvp04145  Phagosome
vvp04216  Ferroptosis
vvp04640  Hematopoietic cell lineage
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    112913526 (TFRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    112913526 (TFRC)
   04145 Phagosome
    112913526 (TFRC)
  09143 Cell growth and death
   04216 Ferroptosis
    112913526 (TFRC)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    112913526 (TFRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:vvp01002]
    112913526 (TFRC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:vvp04147]
    112913526 (TFRC)
   04090 CD molecules [BR:vvp04090]
    112913526 (TFRC)
Peptidases and inhibitors [BR:vvp01002]
 Metallo peptidases
  Family M28: aminopeptidase Y family
   112913526 (TFRC)
Exosome [BR:vvp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   112913526 (TFRC)
  Exosomal proteins of colorectal cancer cells
   112913526 (TFRC)
CD molecules [BR:vvp04090]
 Proteins
  112913526 (TFRC)
SSDB
Motif
Pfam: Peptidase_M28 TFR_dimer PA
Other DBs
NCBI-GeneID: 112913526
NCBI-ProteinID: XP_025846044
UniProt: A0A3Q7RK73
LinkDB
Position
Unknown
AA seq 770 aa
MMDQARSAFSTLFGGEPLSYTRFSLARQVDGDNSHVEMKLAADEEENVDNNVRGNHASVQ
KPKRCNGFICYGTIAVVLFFLIGFMIGYLGYCKRIEPKAECERPAGTEALGTEGTEPSET
EEYFPETPSRLFWTDLKTMLSERLSNTDFTNTMRWLNENSYVPREAGSQKDESLALLIEN
RFRELQLTKSWRDEHFVKIQVKSSNAQNTVTIVGTESGLVYLVESPEGYVAYSKATTVTG
RLVHVNFGTKKDFENLKSPVNGSLVIARAGKITFAEKVANAQSYNALGVLIYMDQARFPI
VNAQIPFFGHAHLGTGDPYTPGFPSFNHTQFPPSQSSGLPSIPVQTISRAAAEKLFENME
GDCPSAWEIDPSCRLETSPNKNVKLTVNNVLKELRIFNVFGVIKGFEEPDRYVVIGAQRD
AWGPGAAKSSVGTALLLELARIFSDMVLKGGFKPSRSIVFASWSAGDFGAIGATEWLEGY
LSSLHLKAFTYINLDKAILGTSNFKVSASPLLYSLLEKTMKDVKHPITGQSLYRDSNWIN
KVEKLSLDNAAFPFLAYSGIPAVSFCFCEDTDYPYLGTTMDLYENLNQKIPQLNKMARGA
AEVAGQLIMKLTYDLELNLNYEMYNEKILSFVRDMNQFRTDLREMGLNLQWLYSARGDFF
RATSRLTTDYKNAERTNRFVMREINDRIMKVEHNFLSPYVSPRDSPFRHIFWGSGSHTLP
ALVEHLKLHQKNNSAFNETLLRNQLALATWTIQGAANALSGDIWDIDNEL
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgatggatcaagccagatcagcattctctaccttgtttggtggagaaccattgtcctat
acccggtttagtctggcacggcaagtagacggtgataacagccatgtggagatgaaacta
gctgcagatgaagaagaaaatgttgacaataacgtgaggggtaatcatgccagtgtccaa
aaaccaaaaaggtgtaatggatttatctgctatgggactattgctgtagtcctctttttc
ctgattggatttatgattggctacttgggctactgtaaacgtatagaaccaaaagctgaa
tgtgaaagaccagcaggaacagaggccctggggacagagggaacagaaccctcagaaaca
gaagagtacttccctgaaacaccttctcgcttattttggacggacctcaaaacaatgttg
tcagagagactgagtaacacagatttcaccaacaccatgaggtggctgaatgaaaattcg
tatgtgcctcgtgaggctggatctcaaaaagatgaaagccttgctttattaattgagaat
cgattccgtgaacttcaacttaccaaatcctggcgtgatgaacattttgttaagatccag
gtcaaaagcagcaatgctcaaaacacggtgaccatagtgggtacggagagtggcttggta
tacctggtggagagtcctgagggttacgtggcatacagtaaggcaacgacagttaccggt
agactggtccatgttaattttggcaccaaaaaagacttcgagaatttaaaatctcctgtg
aatggatctttagtgatcgctagagcagggaaaatcacttttgctgaaaaggttgcaaat
gctcaaagttataatgcacttggtgtcttgatatacatggaccaggctagatttccaatt
gttaatgcacagattccattctttggacatgctcacctgggaacgggtgacccgtacacg
cctggattcccgtcattcaatcacactcagtttccaccgtctcagtcgtcaggattgccc
agcatacctgtccaaacaatttccagagctgctgcagaaaagttgtttgaaaatatggaa
ggagactgtccttctgcctgggaaatagacccctcatgtaggctggaaacgtccccaaac
aagaatgtgaagctcactgtgaacaatgtgctgaaagagctaagaatttttaacgttttt
ggagttattaaaggttttgaagaacctgatcgctatgttgtaataggggctcagagggat
gcctggggtcctggagctgcaaagtctagcgtaggaacagctctcctattggaacttgcc
cggatattctctgatatggtcttaaaaggtggctttaaacccagcagaagcattgtcttt
gccagctggagtgctggagactttggagcaattggtgccactgaatggctagagggatac
ctttcttccttgcatttaaaggctttcacttacattaatctggataaagctattcttggt
accagcaacttcaaggtttctgcaagcccactgttatattcacttcttgagaaaacgatg
aaagatgtgaaacatccaattactgggcagtctctttatcgggacagcaactggatcaac
aaagtcgagaaattgtctttggataatgctgctttccctttccttgcgtattctggaatc
ccagcagtttctttctgtttttgtgaggacacagattatccttatttgggtactaccatg
gatctctatgagaacctgaatcagaaaattcctcagttgaacaaaatggcacgtggagca
gcagaagtagctggtcagcttataatgaaacttacctatgatcttgaattgaacctgaac
tatgagatgtataatgagaaaatactttcattcgtgagggatatgaaccaattcaggaca
gacctaagggagatgggtctgaacctacagtggctgtattctgctcgtggagactttttc
cgagccacctccagactaacaacagattataagaacgcagagagaacaaacagatttgtt
atgagggagatcaatgaccgtatcatgaaagtggaacataacttcctgtcaccctatgta
tctccaagagattctcctttccgtcatatcttctggggttctggctctcacactctgcca
gctttagtggagcatttgaagctgcatcagaaaaataacagtgcttttaatgaaacactg
ttgagaaatcagttggctctagcaacttggactattcaaggagctgcgaatgccctctct
ggtgacatatgggacattgacaatgagctttaa

DBGET integrated database retrieval system