KEGG   Vulpes vulpes (red fox): 112913633
Entry
112913633         CDS       T05911                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X1
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04022  cGMP-PKG signaling pathway
vvp04141  Protein processing in endoplasmic reticulum
vvp04151  PI3K-Akt signaling pathway
vvp04211  Longevity regulating pathway
vvp04261  Adrenergic signaling in cardiomyocytes
vvp04668  TNF signaling pathway
vvp04728  Dopaminergic synapse
vvp04911  Insulin secretion
vvp04915  Estrogen signaling pathway
vvp04918  Thyroid hormone synthesis
vvp04925  Aldosterone synthesis and secretion
vvp04926  Relaxin signaling pathway
vvp04927  Cortisol synthesis and secretion
vvp04928  Parathyroid hormone synthesis, secretion and action
vvp04934  Cushing syndrome
vvp04935  Growth hormone synthesis, secretion and action
vvp05020  Prion disease
vvp05030  Cocaine addiction
vvp05031  Amphetamine addiction
vvp05034  Alcoholism
vvp05161  Hepatitis B
vvp05163  Human cytomegalovirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112913633 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    112913633 (ATF6B)
   04022 cGMP-PKG signaling pathway
    112913633 (ATF6B)
   04151 PI3K-Akt signaling pathway
    112913633 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    112913633 (ATF6B)
   04915 Estrogen signaling pathway
    112913633 (ATF6B)
   04926 Relaxin signaling pathway
    112913633 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    112913633 (ATF6B)
   04918 Thyroid hormone synthesis
    112913633 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    112913633 (ATF6B)
   04925 Aldosterone synthesis and secretion
    112913633 (ATF6B)
   04927 Cortisol synthesis and secretion
    112913633 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    112913633 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    112913633 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    112913633 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    112913633 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    112913633 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    112913633 (ATF6B)
   05031 Amphetamine addiction
    112913633 (ATF6B)
   05034 Alcoholism
    112913633 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112913633 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112913633 (ATF6B)
   05161 Hepatitis B
    112913633 (ATF6B)
   05163 Human cytomegalovirus infection
    112913633 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vvp03000]
    112913633 (ATF6B)
Transcription factors [BR:vvp03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    112913633 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 ZapB GIT_CC YabA Docking
Other DBs
NCBI-GeneID: 112913633
NCBI-ProteinID: XP_025846291
UniProt: A0A3Q7RW43
LinkDB
Position
Unknown
AA seq 750 aa
MVGGREGKMAELMLLSEIADPTRFFTDNLLSPEDWGLRNSTLYTGLDDVAEEQTQLFRCP
EQDVPFGSSSLDVGMDVSPPEPPWDPLPIFPGPLYVFPFALMEGILTALSLDTFWTPQTL
LPVYSPTFLPDLQVKSEPSSPCSSSSLSSESSHLSTEPSSQALGVGEVLVVKTESLAPPL
CLLGDDPTSPFETVQINVGPTSDDPSDIQTKIEPVSPSSSINSEASLLSAESPNQAFIGE
EVLEVKTESLSPQGCLLRDVLGPPLGGVQISMGPSSDGSLGKALPTRKPPLQPKPVVITT
VPMPPRAVPPSTTILLQPLVQPPPVSPVVLIQGAIRVQPEGPAPPAPRPERKSIVPAPMP
GNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQGLEARLQAVLADNQQLRRENAA
LRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFGPVSISEPPPAPLSPRMSREEP
QPRRHLLEFSTQEPVEGVEPLRGSSLGPEELHPSPPGRPGFRNLTAFPGGAKELLLRDLD
QLFLSSDCRHVNRTESLRLADELSGWVQRHQRGRRKIPQRAQERQKSQLRKKSPPVKAVP
TQPLVPPERDFVGQLQLYRHPDRSQPEFLDAIDRREDTFYVVSFRRDHLLLPAISHNKTS
RPKMSLVMPAMAPNETLSGQGAPGDYEEMMQIECEVMDTRVIHIKTSTVPPSLRKQPSST
PGNATGGPLPASAAGQAHQASHQPFYLNHP
NT seq 2253 nt   +upstreamnt  +downstreamnt
atggtcggggggcgggagggaaagatggcggaactgatgctcctcagcgagatcgcggac
ccaacacgttttttcacggacaacttgctgagcccagaggactggggtctgcggaacagc
accttgtacaccggcctggatgatgtggcggaggagcagacgcagctcttccgttgccca
gagcaggatgtcccgtttggcagcagctccctggacgtggggatggatgtcagtccccct
gaaccgccctgggaccccctgcctatcttcccagggcccttatatgtgttcccctttgcc
ctgatggaggggatcctcaccgccttgtctttggacactttttggactcctcagactctg
cttcctgtttattccccaacttttcttccagatcttcaggtgaagtctgagccatcctcc
ccctgctcctcttcctccctcagctccgaatcatcccatctttccactgagccctccagc
caggcccttggtgtaggggaggtgctagttgtgaagacagaatccttggcacccccactc
tgcctcctaggagatgatccaacatccccatttgaaaccgtgcagatcaatgtgggtccc
acctctgatgacccctcagatatccagaccaagatagaacctgtctctccatcctcctcc
atcaactctgaggcttccctgctttcagcagagtcccccaatcaggcttttataggagag
gaggtactggaagtgaagacggagtcactgtcacctcaagggtgtctcctgcgggatgtc
ctaggccccccacttggaggtgtccagatcagcatgggcccatcctccgatggctcctta
ggcaaagccctgcctacccggaagccacccttgcagcccaaacctgtggtgataaccacc
gtcccaatgccacccagagctgtgccccccagcaccaccattctgttgcaaccccttgtc
cagccacccccagtgtccccagttgtcctcatccaaggtgctattcgggtccagcctgag
gggccagcccccccagctccaaggcctgagaggaagagcattgttccagctcctatgcct
gggaactcctgcccacctgaagtggatgcaaagctgctgaagcggcagcagcgaatgatc
aagaaccgggagtcagcctgccagtccaggaggaagaagaaagagtatttgcaggggctg
gaggcccggctgcaggcggtgttggcggacaaccagcagctccgccgggagaatgctgcc
ctccggcggcgactggaggccctgctggcagagaacagcgagctcaagttaggttctgga
aacaggaaggtggtctgcatcatggtcttccttctcttcattgccttcaactttggacct
gtcagcatcagtgagcctcctccagctcctctgtctcctcggatgagcagagaggaacct
cagccccggagacacttgctagagttctcaacacaagagccagttgagggagtggaaccc
cttaggggttcttccctgggccctgaggaactccatcccagcccaccaggccgaccaggt
ttcaggaacctgacagccttccccgggggtgccaaggagctgctcctgagagacctggac
cagctcttcctctcctctgactgtcggcacgtcaaccggaccgagtctctgaggcttgct
gatgagctgagtggctgggtccagcgccaccagagaggacggcggaagatcccccagagg
gcccaggagagacagaagtctcagctacggaagaagtcccctccagttaaggcagtcccc
acccagcccctggtgcccccagagagggactttgtgggccaactgcagctgtatcgccac
ccagaccgttcacagccagagttcctggatgcaattgaccgacgagaggacaccttttat
gttgtctctttccgaagggaccacttgctgcttcctgccatcagccacaataagacgtct
cggcccaagatgtccctggtgatgcctgccatggctcccaatgagaccctgtcaggccag
ggggccccaggggactatgaggagatgatgcagatcgaatgtgaggtcatggacaccagg
gtgattcacatcaagacctccacagtgcccccctcgctccgaaaacagccgtcctcgacc
ccgggcaatgctacaggtggccccttgccagcttctgcagctggccaggcccaccaggcc
tcccaccagcccttctacctcaatcacccctga

DBGET integrated database retrieval system