KEGG   Vulpes vulpes (red fox): 112913897
Entry
112913897         CDS       T05911                                 

Gene name
BAK1
Definition
(RefSeq) bcl-2 homologous antagonist/killer isoform X1
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01524  Platinum drug resistance
vvp04141  Protein processing in endoplasmic reticulum
vvp04210  Apoptosis
vvp04215  Apoptosis - multiple species
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05132  Salmonella infection
vvp05160  Hepatitis C
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05165  Human papillomavirus infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05200  Pathways in cancer
vvp05202  Transcriptional misregulation in cancer
vvp05203  Viral carcinogenesis
vvp05206  MicroRNAs in cancer
vvp05210  Colorectal cancer
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05216  Thyroid cancer
vvp05217  Basal cell carcinoma
vvp05218  Melanoma
vvp05220  Chronic myeloid leukemia
vvp05222  Small cell lung cancer
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112913897 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112913897 (BAK1)
   04215 Apoptosis - multiple species
    112913897 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112913897 (BAK1)
   05202 Transcriptional misregulation in cancer
    112913897 (BAK1)
   05206 MicroRNAs in cancer
    112913897 (BAK1)
   05203 Viral carcinogenesis
    112913897 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112913897 (BAK1)
   05212 Pancreatic cancer
    112913897 (BAK1)
   05225 Hepatocellular carcinoma
    112913897 (BAK1)
   05226 Gastric cancer
    112913897 (BAK1)
   05214 Glioma
    112913897 (BAK1)
   05216 Thyroid cancer
    112913897 (BAK1)
   05220 Chronic myeloid leukemia
    112913897 (BAK1)
   05217 Basal cell carcinoma
    112913897 (BAK1)
   05218 Melanoma
    112913897 (BAK1)
   05213 Endometrial cancer
    112913897 (BAK1)
   05224 Breast cancer
    112913897 (BAK1)
   05222 Small cell lung cancer
    112913897 (BAK1)
   05223 Non-small cell lung cancer
    112913897 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    112913897 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112913897 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112913897 (BAK1)
   05160 Hepatitis C
    112913897 (BAK1)
   05164 Influenza A
    112913897 (BAK1)
   05162 Measles
    112913897 (BAK1)
   05168 Herpes simplex virus 1 infection
    112913897 (BAK1)
   05163 Human cytomegalovirus infection
    112913897 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112913897 (BAK1)
   05169 Epstein-Barr virus infection
    112913897 (BAK1)
   05165 Human papillomavirus infection
    112913897 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112913897 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:vvp03029]
    112913897 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:vvp02000]
    112913897 (BAK1)
Mitochondrial biogenesis [BR:vvp03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    112913897 (BAK1)
Transporters [BR:vvp02000]
 Other transporters
  Pores ion channels [TC:1]
   112913897 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3 DUF5700
Other DBs
NCBI-GeneID: 112913897
NCBI-ProteinID: XP_025846530
UniProt: A0A3Q7RWR7
LinkDB
Position
Unknown
AA seq 243 aa
MASGQGPGPPRRECGEAAPSSTSEEQVARDTEEVFRSYVFYRHRQEQEAEGAAVPADPEM
VTLPLEPSSTMGQVGRQLAIIGDDINQRYDSEFQAMLQHLQPTAENAYEYFTKIASSLFE
SGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLHHCIARWIAQRGGWVAA
LNLGNGPILNVLIVLSVVLLGQFVPTGLGERREKFMIKPNAGSGCRWSPLTSPHPLSVSE
NKL
NT seq 732 nt   +upstreamnt  +downstreamnt
atggcatccgggcaaggcccagggcctcccaggcgggagtgtggagaggctgccccgtct
tctacttctgaggagcaggtagcccgggacaccgaggaggttttccgcagctatgttttt
taccgccatcggcaggagcaggaggctgagggggcggctgtgccagctgacccagaaatg
gtcaccttgcccttagaacctagcagcaccatggggcaggtgggtcggcagctcgctatc
attggggacgacatcaaccagcgctatgactcggagttccaggccatgctgcagcaccta
cagccgacagcagagaatgcctatgagtacttcaccaagattgcctcgagcctatttgag
agcggcatcaactggggccgagtggtggctctcctgggctttggctaccgcctggccctg
catgtctaccaacgtggcctgactggcttcctgggccaggtgacccgcttcgtggccgac
ttcatgctgcatcattgcattgcccggtggatcgcgcagaggggtggctgggtggcagcc
ctgaacttgggaaacggccccatcctgaacgtgctgatagtgctgtctgtggttctgttg
ggccagtttgtgcctacaggtctgggggaaaggagagagaagttcatgattaagccaaat
gcagggagcggatgcagatggagcccgctgaccagcccccaccctctgagtgtgtctgaa
aataaactgtaa

DBGET integrated database retrieval system