KEGG   Vulpes vulpes (red fox): 112913942
Entry
112913942         CDS       T05911                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01522  Endocrine resistance
vvp01524  Platinum drug resistance
vvp04012  ErbB signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04068  FoxO signaling pathway
vvp04110  Cell cycle
vvp04115  p53 signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04218  Cellular senescence
vvp04630  JAK-STAT signaling pathway
vvp04921  Oxytocin signaling pathway
vvp04928  Parathyroid hormone synthesis, secretion and action
vvp04934  Cushing syndrome
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05163  Human cytomegalovirus infection
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05169  Epstein-Barr virus infection
vvp05200  Pathways in cancer
vvp05202  Transcriptional misregulation in cancer
vvp05203  Viral carcinogenesis
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05210  Colorectal cancer
vvp05211  Renal cell carcinoma
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05216  Thyroid cancer
vvp05217  Basal cell carcinoma
vvp05218  Melanoma
vvp05219  Bladder cancer
vvp05220  Chronic myeloid leukemia
vvp05222  Small cell lung cancer
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    112913942 (CDKN1A)
   04630 JAK-STAT signaling pathway
    112913942 (CDKN1A)
   04066 HIF-1 signaling pathway
    112913942 (CDKN1A)
   04068 FoxO signaling pathway
    112913942 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    112913942 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112913942 (CDKN1A)
   04115 p53 signaling pathway
    112913942 (CDKN1A)
   04218 Cellular senescence
    112913942 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    112913942 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    112913942 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112913942 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    112913942 (CDKN1A)
   05206 MicroRNAs in cancer
    112913942 (CDKN1A)
   05205 Proteoglycans in cancer
    112913942 (CDKN1A)
   05203 Viral carcinogenesis
    112913942 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112913942 (CDKN1A)
   05212 Pancreatic cancer
    112913942 (CDKN1A)
   05225 Hepatocellular carcinoma
    112913942 (CDKN1A)
   05226 Gastric cancer
    112913942 (CDKN1A)
   05214 Glioma
    112913942 (CDKN1A)
   05216 Thyroid cancer
    112913942 (CDKN1A)
   05220 Chronic myeloid leukemia
    112913942 (CDKN1A)
   05217 Basal cell carcinoma
    112913942 (CDKN1A)
   05218 Melanoma
    112913942 (CDKN1A)
   05211 Renal cell carcinoma
    112913942 (CDKN1A)
   05219 Bladder cancer
    112913942 (CDKN1A)
   05215 Prostate cancer
    112913942 (CDKN1A)
   05213 Endometrial cancer
    112913942 (CDKN1A)
   05224 Breast cancer
    112913942 (CDKN1A)
   05222 Small cell lung cancer
    112913942 (CDKN1A)
   05223 Non-small cell lung cancer
    112913942 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112913942 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112913942 (CDKN1A)
   05161 Hepatitis B
    112913942 (CDKN1A)
   05160 Hepatitis C
    112913942 (CDKN1A)
   05163 Human cytomegalovirus infection
    112913942 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112913942 (CDKN1A)
   05169 Epstein-Barr virus infection
    112913942 (CDKN1A)
   05165 Human papillomavirus infection
    112913942 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112913942 (CDKN1A)
   01522 Endocrine resistance
    112913942 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 112913942
NCBI-ProteinID: XP_025846615
UniProt: A0A3Q7RWZ2
LinkDB
Position
Unknown
AA seq 164 aa
MSEPSRDALPIPHGSKACRRLFGPVDSEQLRRDCDALMASCVQEARERWNFDFVTETPLE
GDFAWERVRGLGLSKVSLPAGPRGGRDDLGGGKRPGTSPALLQGTAQEDHLDLSLTCTLL
PHSPERPEASPGVPGTSQGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcggagccgtccagggacgccctgcccatccctcatggcagcaaggcttgccgccgc
ctcttcggccccgtggacagcgagcagctgcgccgagactgtgacgcgctgatggccagc
tgtgtgcaggaggcccgggagcgatggaactttgacttcgtcaccgagacgccgctggaa
ggcgactttgcctgggagcgtgtgcggggcctgggcctgtccaaggtctccctgcctgcg
gggccccgggggggccgggatgacctgggagggggcaagcggcccggcacctcgcctgcc
ctgctgcaggggacagctcaggaggaccacctggacctgtcgctgacctgcaccctcctg
cctcactcccctgagcggcctgaggcatccccgggtgtgcctggcacctctcagggccga
aaacggcggcagaccagcatgacagatttctatcactccaaacgccggctgatcttctcc
aagaggaagccctaa

DBGET integrated database retrieval system