KEGG   Vulpes vulpes (red fox): 112913983
Entry
112913983         CDS       T05911                                 

Gene name
CCND3
Definition
(RefSeq) G1/S-specific cyclin-D3 isoform X1
  KO
K10152  G1/S-specific cyclin-D3
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04110  Cell cycle
vvp04115  p53 signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04218  Cellular senescence
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04510  Focal adhesion
vvp04630  JAK-STAT signaling pathway
vvp05162  Measles
vvp05164  Influenza A
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112913983 (CCND3)
   04390 Hippo signaling pathway
    112913983 (CCND3)
   04630 JAK-STAT signaling pathway
    112913983 (CCND3)
   04151 PI3K-Akt signaling pathway
    112913983 (CCND3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112913983 (CCND3)
   04115 p53 signaling pathway
    112913983 (CCND3)
   04218 Cellular senescence
    112913983 (CCND3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112913983 (CCND3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112913983 (CCND3)
   05203 Viral carcinogenesis
    112913983 (CCND3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112913983 (CCND3)
   05164 Influenza A
    112913983 (CCND3)
   05162 Measles
    112913983 (CCND3)
   05169 Epstein-Barr virus infection
    112913983 (CCND3)
   05165 Human papillomavirus infection
    112913983 (CCND3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 112913983
NCBI-ProteinID: XP_025846682
UniProt: A0A3Q7RLH2
LinkDB
Position
Unknown
AA seq 237 aa
MRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRE
TTPLTIEKLCIYTDHSVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLALILHRLSLPQDRQ
ALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSTSGDELTELLAGITGT
EVDCLRACQEQIEAALRESLREAAQTSPSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
NT seq 714 nt   +upstreamnt  +downstreamnt
atgcggaagatgctggcgtactggatgctggaggtctgtgaggagcagcgctgcgaggag
gaagtcttccccctggccatgaactacctggatcgctacttgtcctgcgtccccacccga
aaggcgcagttgcagctcctgggtgcggtctgcatgctgctggcctccaagctgcgcgag
actacgcccctgaccatcgaaaaactgtgcatctacaccgaccactctgtctctccccgc
cagctgcgggactgggaggtgctggtcctggggaagctcaagtgggacctggcagctgtg
attgcccatgatttcctggctctgattctgcaccggctctctctgccccaggaccgacaa
gccctggtcaaaaaacatgcccagacctttttggccctctgtgccacagattacaccttt
gccatgtacccgccatccatgatcgccacaggcagcattggggctgcagtgcaaggcctg
ggtgcttgttccacatctggggatgagctgacggagctgctggcagggatcacaggcact
gaggtggactgcctgcgggcctgtcaggagcagattgaagctgcgctcagggagagcctc
agagaagccgcccagacctcacccagcccagcgcccaaagcccccaggggctccagtagc
caggggcccagccagaccagcactcccacagatgtcacagccatccacctgtag

KEGG   Vulpes vulpes (red fox): 112917379
Entry
112917379         CDS       T05911                                 

Gene name
CCND2
Definition
(RefSeq) G1/S-specific cyclin-D2
  KO
K10151  G1/S-specific cyclin-D2
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04068  FoxO signaling pathway
vvp04110  Cell cycle
vvp04115  p53 signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04218  Cellular senescence
vvp04310  Wnt signaling pathway
vvp04340  Hedgehog signaling pathway
vvp04390  Hippo signaling pathway
vvp04510  Focal adhesion
vvp04630  JAK-STAT signaling pathway
vvp04917  Prolactin signaling pathway
vvp05162  Measles
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05200  Pathways in cancer
vvp05202  Transcriptional misregulation in cancer
vvp05203  Viral carcinogenesis
vvp05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112917379 (CCND2)
   04340 Hedgehog signaling pathway
    112917379 (CCND2)
   04390 Hippo signaling pathway
    112917379 (CCND2)
   04630 JAK-STAT signaling pathway
    112917379 (CCND2)
   04068 FoxO signaling pathway
    112917379 (CCND2)
   04151 PI3K-Akt signaling pathway
    112917379 (CCND2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112917379 (CCND2)
   04115 p53 signaling pathway
    112917379 (CCND2)
   04218 Cellular senescence
    112917379 (CCND2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112917379 (CCND2)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    112917379 (CCND2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112917379 (CCND2)
   05202 Transcriptional misregulation in cancer
    112917379 (CCND2)
   05206 MicroRNAs in cancer
    112917379 (CCND2)
   05203 Viral carcinogenesis
    112917379 (CCND2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112917379 (CCND2)
   05162 Measles
    112917379 (CCND2)
   05169 Epstein-Barr virus infection
    112917379 (CCND2)
   05165 Human papillomavirus infection
    112917379 (CCND2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 112917379
NCBI-ProteinID: XP_025851173
UniProt: A0A3Q7S5M7
LinkDB
Position
Unknown
AA seq 289 aa
MELLCCEVDPVRRAVPDANLLYDDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKTHLQLLGAVCMFLASKLKETIPLTA
EKLCIYTDNSIKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQPSEKLSLIRKH
AQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEDVSSLTGDALVDLLAKITNTDV
DCLKACQEQIEVVLLNSLQQFRQDQGDGSKSEDELDQASTPTDVRDIDL
NT seq 870 nt   +upstreamnt  +downstreamnt
atggagctgctgtgctgcgaggtggacccggtccgcagggccgtgccggacgccaacctg
ctctacgacgaccgcgttttgcagaacttgctcaccatcgaggagcgctaccttccccag
tgctcctacttcaaatgcgtgcagaaggacatccagccctacatgcgcaggatggtggcc
acctggatgctggaggtctgtgaggaacagaagtgcgaagaggaggtcttccctttggcc
atgaattacctggatcgcttcttggcgggggtcccaactcctaagacccatctgcagctg
ctgggtgctgtctgcatgttcctggcctccaaacttaaagagactatccctctgaccgca
gagaagttgtgcatttacactgacaactccatcaagcctcaggagctgctggagtgggag
ctggtggtgttggggaaattgaagtggaacctggctgccgtgacccctcatgacttcatc
gagcacatccttcggaagctgccgcagccgagtgagaaattgtctctgatccgcaagcac
gcgcagaccttcattgctctgtgtgccaccgactttaagttcgccatgtatccaccatcg
atgattgcaactggaagcgtgggagccgccatctgtgggctgcagcaggatgaggacgtg
agctccctcaccggcgatgccctggtggatctgctggccaagatcaccaacacggatgtg
gactgcctcaaagcctgccaggagcagattgaggtggtgctgctcaacagcctgcagcag
ttccgccaggaccagggggatgggtccaagtccgaggatgaactggaccaggccagcacc
cctacagacgtgcgggatattgacctgtga

KEGG   Vulpes vulpes (red fox): 112924157
Entry
112924157         CDS       T05911                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01522  Endocrine resistance
vvp04068  FoxO signaling pathway
vvp04110  Cell cycle
vvp04115  p53 signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04152  AMPK signaling pathway
vvp04218  Cellular senescence
vvp04310  Wnt signaling pathway
vvp04340  Hedgehog signaling pathway
vvp04371  Apelin signaling pathway
vvp04390  Hippo signaling pathway
vvp04510  Focal adhesion
vvp04530  Tight junction
vvp04630  JAK-STAT signaling pathway
vvp04917  Prolactin signaling pathway
vvp04919  Thyroid hormone signaling pathway
vvp04921  Oxytocin signaling pathway
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp04934  Cushing syndrome
vvp05160  Hepatitis C
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05165  Human papillomavirus infection
vvp05166  Human T-cell leukemia virus 1 infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05169  Epstein-Barr virus infection
vvp05200  Pathways in cancer
vvp05203  Viral carcinogenesis
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05210  Colorectal cancer
vvp05212  Pancreatic cancer
vvp05213  Endometrial cancer
vvp05214  Glioma
vvp05215  Prostate cancer
vvp05216  Thyroid cancer
vvp05218  Melanoma
vvp05219  Bladder cancer
vvp05220  Chronic myeloid leukemia
vvp05221  Acute myeloid leukemia
vvp05222  Small cell lung cancer
vvp05223  Non-small cell lung cancer
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112924157 (CCND1)
   04340 Hedgehog signaling pathway
    112924157 (CCND1)
   04390 Hippo signaling pathway
    112924157 (CCND1)
   04371 Apelin signaling pathway
    112924157 (CCND1)
   04630 JAK-STAT signaling pathway
    112924157 (CCND1)
   04068 FoxO signaling pathway
    112924157 (CCND1)
   04151 PI3K-Akt signaling pathway
    112924157 (CCND1)
   04152 AMPK signaling pathway
    112924157 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112924157 (CCND1)
   04115 p53 signaling pathway
    112924157 (CCND1)
   04218 Cellular senescence
    112924157 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112924157 (CCND1)
   04530 Tight junction
    112924157 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    112924157 (CCND1)
   04921 Oxytocin signaling pathway
    112924157 (CCND1)
   04919 Thyroid hormone signaling pathway
    112924157 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112924157 (CCND1)
   05206 MicroRNAs in cancer
    112924157 (CCND1)
   05205 Proteoglycans in cancer
    112924157 (CCND1)
   05203 Viral carcinogenesis
    112924157 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112924157 (CCND1)
   05212 Pancreatic cancer
    112924157 (CCND1)
   05225 Hepatocellular carcinoma
    112924157 (CCND1)
   05226 Gastric cancer
    112924157 (CCND1)
   05214 Glioma
    112924157 (CCND1)
   05216 Thyroid cancer
    112924157 (CCND1)
   05221 Acute myeloid leukemia
    112924157 (CCND1)
   05220 Chronic myeloid leukemia
    112924157 (CCND1)
   05218 Melanoma
    112924157 (CCND1)
   05219 Bladder cancer
    112924157 (CCND1)
   05215 Prostate cancer
    112924157 (CCND1)
   05213 Endometrial cancer
    112924157 (CCND1)
   05224 Breast cancer
    112924157 (CCND1)
   05222 Small cell lung cancer
    112924157 (CCND1)
   05223 Non-small cell lung cancer
    112924157 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112924157 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112924157 (CCND1)
   04934 Cushing syndrome
    112924157 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112924157 (CCND1)
   05160 Hepatitis C
    112924157 (CCND1)
   05162 Measles
    112924157 (CCND1)
   05163 Human cytomegalovirus infection
    112924157 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112924157 (CCND1)
   05169 Epstein-Barr virus infection
    112924157 (CCND1)
   05165 Human papillomavirus infection
    112924157 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    112924157 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 112924157
NCBI-ProteinID: XP_025860005
UniProt: A0A3Q7TXF0
LinkDB
Position
Unknown
AA seq 295 aa
MAHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEILPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPDELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPVAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLHLGSSNSFLSYHRLTRFLSKVIKCD
ADCLRACQEQIEALLESSLRQAQQQSLDPKAAEEEEEEEEADLACTPTDVRDVNI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggcacaccagctcctgtgctgcgaggtggagaccatccgccgggcgtaccccgatgcc
aacctgctcaacgaccgggtgctgcgggccatgcttaaggcggaggagacttgcgcgccg
tccgtgtcctacttcaagtgtgtgcagaaggagatcctgccgtccatgcggaagatcgtg
gccacctggatgctagaggtctgcgaggagcagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgcctgcag
ctgctgggggccacctgcatgttcgtggcctcgaagatgaaggagaccatcccgctgacg
gccgagaagctctgcatctacactgacaactccatccggcccgacgagctgctgcaaatg
gagctgctcctggtgaacaaactgaagtggaacctggcagccatgaccccacacgacttc
atcgagcacttcctctccaagatgccagtggcagaggagaacaaacagatcatccgcaag
cacgcacagaccttcgtagcgctctgtgccacagatgtgaagttcatttccaacccaccc
tccatggtggcagctggcagtgtggtggccgccgtgcaaggtctacacctgggaagttcc
aacagcttcctgtcctaccaccgcctcactcggttcctctccaaagtgattaagtgtgat
gcggactgtctccgggcgtgccaggagcagatcgaagccctgctggagtccagcctgcgc
caggcccagcagcagagcctggaccccaaggcggcggaggaggaggaggaggaggaggag
gccgacctggcctgcacgcccaccgatgtgcgagacgtgaacatttga

DBGET integrated database retrieval system