KEGG   Vulpes vulpes (red fox): 112914029
Entry
112914029         CDS       T05911                                 

Gene name
VEGFA
Definition
(RefSeq) vascular endothelial growth factor A
  KO
K05448  vascular endothelial growth factor A
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01521  EGFR tyrosine kinase inhibitor resistance
vvp04010  MAPK signaling pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04020  Calcium signaling pathway
vvp04066  HIF-1 signaling pathway
vvp04151  PI3K-Akt signaling pathway
vvp04370  VEGF signaling pathway
vvp04510  Focal adhesion
vvp04926  Relaxin signaling pathway
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp05163  Human cytomegalovirus infection
vvp05165  Human papillomavirus infection
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05211  Renal cell carcinoma
vvp05212  Pancreatic cancer
vvp05219  Bladder cancer
vvp05323  Rheumatoid arthritis
vvp05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112914029 (VEGFA)
   04014 Ras signaling pathway
    112914029 (VEGFA)
   04015 Rap1 signaling pathway
    112914029 (VEGFA)
   04370 VEGF signaling pathway
    112914029 (VEGFA)
   04066 HIF-1 signaling pathway
    112914029 (VEGFA)
   04020 Calcium signaling pathway
    112914029 (VEGFA)
   04151 PI3K-Akt signaling pathway
    112914029 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112914029 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112914029 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112914029 (VEGFA)
   05206 MicroRNAs in cancer
    112914029 (VEGFA)
   05205 Proteoglycans in cancer
    112914029 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    112914029 (VEGFA)
   05211 Renal cell carcinoma
    112914029 (VEGFA)
   05219 Bladder cancer
    112914029 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    112914029 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    112914029 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112914029 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    112914029 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    112914029 (VEGFA)
   05165 Human papillomavirus infection
    112914029 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    112914029 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:vvp04052]
    112914029 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:vvp00536]
    112914029 (VEGFA)
Cytokines and growth factors [BR:vvp04052]
 Growth factors
  Growth factors (RTK binding)
   112914029 (VEGFA)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   112914029 (VEGFA)
SSDB
Motif
Pfam: VEGF_C PDGF
Other DBs
NCBI-GeneID: 112914029
NCBI-ProteinID: XP_025846769
UniProt: A0A3Q7RME1
LinkDB
Position
Unknown
AA seq 490 aa
IGPTVWGRLLLYFPKSLRILETSREKKEVARAPERSRGRERERERGRERETGSESARASE
QRQDRGKVSDLLLGVTARARREPSPSGPRTGPAALTDRPTDTAPRPSAHLLPGRRPRVDA
AASRGQEPEPEPAPGGGVEGVGARGVAVKLFVQLLGCSRSGGAVVRAGAAEPSGTGRSAS
PGREEPQPEEGEEEEEKEEERGPRWRLGARKPGSWTGEAAVCADSAPAARAPQALARASA
PGGRGARLGAEESGPPRSPSGRGSASRAGSGRASETMNFLLSWVHWSLALLLYLHHAKWS
QAAPMAGGEHKPHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGG
CCNDEGLECVPTEEFNITMQIMRIKPHQGQHIGEMSFLQHSKCECRPKKDRARQEKKSIR
GKGKGQKRKRKKSRYKPWSVPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNE
RTCRCDKPRR
NT seq 1473 nt   +upstreamnt  +downstreamnt
atcgggccgaccgtttgggggagattgctcctttacttccccaaatcacttcggattttg
gaaaccagcagagagaagaaagaggtagcaagagctccagagagaagtcgaggaagagag
agagagagagagagggggagagagagagagacggggtcagagagcgcgcgggcgagcgag
caacggcaggacaggggcaaagtgagtgacctgcttttgggggtgaccgccagagcgcgg
cgtgagccctccccctcgggaccccgcaccggaccagccgcgctgacggacagaccgaca
gacaccgccccccgccccagcgcccacctcctccccggccggcggccgagggtggacgcg
gcggcgagccgcgggcaggagccggagcccgagcccgcgcctggaggcggggtggagggg
gtcggggctcgcggcgttgcagtgaaacttttcgtccaacttctgggctgttctcgctcc
ggaggagccgtggtccgcgccggggcagcagagccgagcggaaccgggagaagtgcgagc
ccgggccgggaggagccgcagccggaggagggggaggaggaagaagagaaggaagaggag
agggggccgcggtggcgactcggcgctcggaagccgggctcatggacgggtgaggcggct
gtgtgcgcagacagtgctccagccgcgcgcgcgccccaggccctggcccgggcctcggct
ccgggaggaagaggagcccgcctgggcgccgaggagagcgggccgccccgcagcccgagc
gggagagggagcgcgagccgcgccggctccggccgggcctccgaaaccatgaactttctg
ctctcctgggtgcattggagcctcgccttgctgctctacctccaccatgccaagtggtcc
caggctgcacctatggcaggaggagagcacaaaccccacgaagtggtgaagtttatggac
gtctaccagcgcagctactgccgtcccattgagaccctggtggacatcttccaggagtac
cccgacgagatcgagtacatcttcaagccatcctgcgtgcccctgatgcggtgtgggggc
tgctgtaatgatgagggcctagagtgcgtgcccactgaggagttcaacatcaccatgcag
attatgcggatcaaacctcatcaaggccagcacataggggagatgagtttcctgcagcat
agcaaatgtgaatgcagaccaaagaaagatagagcaaggcaagaaaaaaaatcaattcga
ggaaaggggaaggggcaaaaaagaaagcgcaagaaatcccggtataaaccctggagcgtt
ccctgtgggccttgctcagagcggagaaagcatttgtttgtacaagatccgcagacgtgt
aaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagcttgagttaaacgaa
cgtacttgcagatgtgacaagcccaggcggtga

DBGET integrated database retrieval system