KEGG   Vulpes vulpes (red fox): 112914338
Entry
112914338         CDS       T05911                                 

Gene name
TGFB2
Definition
(RefSeq) transforming growth factor beta-2 isoform X1
  KO
K13376  transforming growth factor beta-2
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04010  MAPK signaling pathway
vvp04060  Cytokine-cytokine receptor interaction
vvp04068  FoxO signaling pathway
vvp04110  Cell cycle
vvp04218  Cellular senescence
vvp04350  TGF-beta signaling pathway
vvp04380  Osteoclast differentiation
vvp04390  Hippo signaling pathway
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp05140  Leishmaniasis
vvp05142  Chagas disease
vvp05144  Malaria
vvp05145  Toxoplasmosis
vvp05146  Amoebiasis
vvp05152  Tuberculosis
vvp05161  Hepatitis B
vvp05166  Human T-cell leukemia virus 1 infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05206  MicroRNAs in cancer
vvp05210  Colorectal cancer
vvp05211  Renal cell carcinoma
vvp05212  Pancreatic cancer
vvp05220  Chronic myeloid leukemia
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05321  Inflammatory bowel disease
vvp05323  Rheumatoid arthritis
vvp05410  Hypertrophic cardiomyopathy
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112914338 (TGFB2)
   04350 TGF-beta signaling pathway
    112914338 (TGFB2)
   04390 Hippo signaling pathway
    112914338 (TGFB2)
   04068 FoxO signaling pathway
    112914338 (TGFB2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112914338 (TGFB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112914338 (TGFB2)
   04218 Cellular senescence
    112914338 (TGFB2)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112914338 (TGFB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112914338 (TGFB2)
   05206 MicroRNAs in cancer
    112914338 (TGFB2)
   05205 Proteoglycans in cancer
    112914338 (TGFB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112914338 (TGFB2)
   05212 Pancreatic cancer
    112914338 (TGFB2)
   05225 Hepatocellular carcinoma
    112914338 (TGFB2)
   05226 Gastric cancer
    112914338 (TGFB2)
   05220 Chronic myeloid leukemia
    112914338 (TGFB2)
   05211 Renal cell carcinoma
    112914338 (TGFB2)
  09163 Immune disease
   05323 Rheumatoid arthritis
    112914338 (TGFB2)
   05321 Inflammatory bowel disease
    112914338 (TGFB2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112914338 (TGFB2)
   05414 Dilated cardiomyopathy
    112914338 (TGFB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112914338 (TGFB2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112914338 (TGFB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112914338 (TGFB2)
   05161 Hepatitis B
    112914338 (TGFB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112914338 (TGFB2)
   05144 Malaria
    112914338 (TGFB2)
   05145 Toxoplasmosis
    112914338 (TGFB2)
   05140 Leishmaniasis
    112914338 (TGFB2)
   05142 Chagas disease
    112914338 (TGFB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:vvp04052]
    112914338 (TGFB2)
   00536 Glycosaminoglycan binding proteins [BR:vvp00536]
    112914338 (TGFB2)
Cytokines and growth factors [BR:vvp04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   112914338 (TGFB2)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   112914338 (TGFB2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 112914338
NCBI-ProteinID: XP_025847095
UniProt: A0A3Q7SXC4
LinkDB
Position
Unknown
AA seq 442 aa
MHYCVLSAFLILHLVTAALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKLTSPPEDYPEP
EEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYAKEVYKIDMPPFFPSETVCPV
VTTPSGSVGSFCSRQSQVLCGYLDAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFRVF
RLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLSFDVTDAVHEWLH
HKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARFAGIDGTSTYTSGDQKTIKSTRK
KNSGKTPHLLLMLLPSYRLESQQSNRRKKRALDAAYCFRNVQDNCCLRPLYIDFKRDLGW
KWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILY
YIGKTPKIEQLSNMIVKSCKCS
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgcactactgtgtgctgagcgcttttctgatcctgcatctggtcacggccgcgctcagc
ctgtctacctgcagcacgctcgatatggaccagttcatgcgcaagaggatcgaggcgatc
cgcgggcagatcctgagcaagctgaagctcaccagccccccggaagactaccccgaaccc
gaggaggtccccccggaggtgatctccatctacaacagcaccagggacttgctgcaggag
aaggcgagccggagggcggccgcctgcgagcgcgagaggagcgacgaggagtactacgcc
aaggaggtctacaagatagacatgccgcccttcttcccctcggaaactgtctgcccagtt
gttacaacaccctctggctcagtgggcagcttctgctccagacagtcccaggtgctctgt
gggtaccttgatgccatcccgcccactttctacagaccctacttcagaattgtccgattt
gacgtctcggcgatggagaagaatgcatccaacttggtgaaagcagagttcagagtcttt
cgtttacagaacccgaaagccagagtgcccgaacagcggatcgaactgtatcagattctc
aaatccaaagatttaacgtctccaacccagcgctacattgacagcaaagtcgtcaagacg
agagcagaaggcgaatggctttcctttgacgtgaccgacgccgtccatgaatggctccac
cataaagacagaaacctgggatttaaaataagtttacactgtccctgctgcacctttgta
ccatctaataattacatcattcccaataaaagtgaagagctagaagcaagatttgcaggt
attgatggcacctccacatataccagtggtgatcagaaaactataaagtccactaggaaa
aaaaacagtgggaagaccccacatctcctgctaatgttgttgccctcctacagacttgag
tcacaacagtccaaccggcggaagaagcgtgctttggatgcagcctattgttttagaaat
gtgcaggataattgctgtctacgtccactttacattgatttcaagagggatcttgggtgg
aaatggatacatgaacctaaagggtacaatgccaacttctgtgctggagcatgcccatat
ttatggagttcagacactcagcacagtagggttctcagcttatataataccataaatcca
gaagcatctgcctccccttgctgcgtgtcccaggatttagaaccgctaaccattctctac
tacatcggcaaaacacccaagattgaacagctctccaatatgatcgtaaagtcttgcaaa
tgcagctaa

KEGG   Vulpes vulpes (red fox): 112927298
Entry
112927298         CDS       T05911                                 

Gene name
TGFB3
Definition
(RefSeq) transforming growth factor beta-3
  KO
K13377  transforming growth factor beta-3
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04010  MAPK signaling pathway
vvp04060  Cytokine-cytokine receptor interaction
vvp04068  FoxO signaling pathway
vvp04110  Cell cycle
vvp04218  Cellular senescence
vvp04350  TGF-beta signaling pathway
vvp04390  Hippo signaling pathway
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp05140  Leishmaniasis
vvp05142  Chagas disease
vvp05144  Malaria
vvp05145  Toxoplasmosis
vvp05146  Amoebiasis
vvp05152  Tuberculosis
vvp05161  Hepatitis B
vvp05166  Human T-cell leukemia virus 1 infection
vvp05200  Pathways in cancer
vvp05210  Colorectal cancer
vvp05211  Renal cell carcinoma
vvp05212  Pancreatic cancer
vvp05220  Chronic myeloid leukemia
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05321  Inflammatory bowel disease
vvp05323  Rheumatoid arthritis
vvp05410  Hypertrophic cardiomyopathy
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112927298 (TGFB3)
   04350 TGF-beta signaling pathway
    112927298 (TGFB3)
   04390 Hippo signaling pathway
    112927298 (TGFB3)
   04068 FoxO signaling pathway
    112927298 (TGFB3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112927298 (TGFB3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112927298 (TGFB3)
   04218 Cellular senescence
    112927298 (TGFB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112927298 (TGFB3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112927298 (TGFB3)
   05212 Pancreatic cancer
    112927298 (TGFB3)
   05225 Hepatocellular carcinoma
    112927298 (TGFB3)
   05226 Gastric cancer
    112927298 (TGFB3)
   05220 Chronic myeloid leukemia
    112927298 (TGFB3)
   05211 Renal cell carcinoma
    112927298 (TGFB3)
  09163 Immune disease
   05323 Rheumatoid arthritis
    112927298 (TGFB3)
   05321 Inflammatory bowel disease
    112927298 (TGFB3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112927298 (TGFB3)
   05414 Dilated cardiomyopathy
    112927298 (TGFB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    112927298 (TGFB3)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112927298 (TGFB3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112927298 (TGFB3)
   05161 Hepatitis B
    112927298 (TGFB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112927298 (TGFB3)
   05144 Malaria
    112927298 (TGFB3)
   05145 Toxoplasmosis
    112927298 (TGFB3)
   05140 Leishmaniasis
    112927298 (TGFB3)
   05142 Chagas disease
    112927298 (TGFB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:vvp04052]
    112927298 (TGFB3)
Cytokines and growth factors [BR:vvp04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   112927298 (TGFB3)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 112927298
NCBI-ProteinID: XP_025864438
UniProt: A0A3Q7T503
LinkDB
Position
Unknown
AA seq 457 aa
MHLLAKPQSSGSREAARFSSLLLHDCWGLLLARPCSPPASLPSLRMKMHLQRALVVLALL
NFATVSLSLSTCTTLDFGHIKKKRVEAIRGQILSKLRLTSPPEPSVMTHVPYQVLALYNS
TRELLEEMQGEREDSCTQENTESEYYAKEIHKFDMIQGLAEHNELAVCPKGITSKVFRFN
VSSVEKNGTNLFRAEFRVLRVPNPSSKRSEQRIELFQILRPDEHIAKQRYIGGKNLPTRG
TAEWLSFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENIHEVMEIKFKGVDS
EDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKRALDTNYCFRNLEENC
CVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSADTTHSTVLGLYNTLNPEASAS
PCCVPQDLEPLTILYYVGRTPKVEQLSNMVVKSCKCS
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgcaccttcttgccaagcctcagtcttcgggatctagggaggccgcccggttttcctcc
ctccttctgcacgactgctggggtctcctcctcgccaggccttgcagccccccggcctct
ctccccagcttgcgcatgaagatgcacttgcaaagggctctggtggtcctggccctgctg
aactttgccacggtcagcctctctctgtccacttgcaccaccttggactttggccacatc
aagaagaagagggtggaagccattaggggacagatcttgagcaaactcagactcaccagt
ccccccgagccatcggtgatgacccacgtcccctaccaggtcctggccctttacaacagc
acccgggagctgctggaggagatgcagggagagagggaggacagctgtactcaggaaaac
accgagtcggagtactatgccaaagaaatccataaattcgacatgatccaggggctggcg
gagcacaatgagctggccgtctgccccaaaggaatcacctccaaggttttccgcttcaat
gtgtcctcagtggagaaaaatggaaccaacctattccgggcagaattccgggtcctgcgg
gtgcccaaccccagctccaagcgcagcgagcagaggatcgagctcttccagatactccgg
cccgacgagcacatcgccaaacagcgctatatcggcggcaagaatctgcccacccggggc
accgccgagtggctgtcttttgacgtcactgacactgtgcgtgaatggctcttgagaaga
gagtccaacttaggtctggaaatcagcattcactgtccatgtcacacctttcagcccaat
ggagacatcctggaaaacatccatgaggtgatggaaatcaaattcaaaggtgtggacagc
gaggacgaccacggccgtggggacctagggcgcctcaagaagcagaaggaccaccacaac
cctcacctcatcctcatgatgattcccccgcaccggctggacaacccgggccagggcggc
cagcggaagaagcgggccttggacaccaattactgcttccgcaatttggaggagaactgc
tgtgtgcgccctctctacattgacttccgacaagatctgggctggaagtgggtccatgaa
cctaagggctactacgccaacttctgctcaggcccttgcccctacctccgcagtgcggac
acaacccacagcacggtgctgggactgtacaacactctgaatcccgaagcgtctgcctca
ccctgctgcgtgccccaggacttggagcctctgaccatcctgtactatgtcgggaggacc
cccaaggtggaacagctctctaacatggtggtcaagtcctgtaaatgtagctga

KEGG   Vulpes vulpes (red fox): 112928349
Entry
112928349         CDS       T05911                                 

Gene name
TGFB1
Definition
(RefSeq) transforming growth factor beta-1 isoform X1
  KO
K13375  transforming growth factor beta-1
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04010  MAPK signaling pathway
vvp04060  Cytokine-cytokine receptor interaction
vvp04068  FoxO signaling pathway
vvp04110  Cell cycle
vvp04218  Cellular senescence
vvp04350  TGF-beta signaling pathway
vvp04380  Osteoclast differentiation
vvp04390  Hippo signaling pathway
vvp04659  Th17 cell differentiation
vvp04672  Intestinal immune network for IgA production
vvp04926  Relaxin signaling pathway
vvp04932  Non-alcoholic fatty liver disease
vvp04933  AGE-RAGE signaling pathway in diabetic complications
vvp05140  Leishmaniasis
vvp05142  Chagas disease
vvp05144  Malaria
vvp05145  Toxoplasmosis
vvp05146  Amoebiasis
vvp05152  Tuberculosis
vvp05161  Hepatitis B
vvp05166  Human T-cell leukemia virus 1 infection
vvp05200  Pathways in cancer
vvp05205  Proteoglycans in cancer
vvp05210  Colorectal cancer
vvp05211  Renal cell carcinoma
vvp05212  Pancreatic cancer
vvp05220  Chronic myeloid leukemia
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
vvp05321  Inflammatory bowel disease
vvp05323  Rheumatoid arthritis
vvp05410  Hypertrophic cardiomyopathy
vvp05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    112928349 (TGFB1)
   04350 TGF-beta signaling pathway
    112928349 (TGFB1)
   04390 Hippo signaling pathway
    112928349 (TGFB1)
   04068 FoxO signaling pathway
    112928349 (TGFB1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    112928349 (TGFB1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    112928349 (TGFB1)
   04218 Cellular senescence
    112928349 (TGFB1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    112928349 (TGFB1)
   04672 Intestinal immune network for IgA production
    112928349 (TGFB1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    112928349 (TGFB1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    112928349 (TGFB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112928349 (TGFB1)
   05205 Proteoglycans in cancer
    112928349 (TGFB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112928349 (TGFB1)
   05212 Pancreatic cancer
    112928349 (TGFB1)
   05225 Hepatocellular carcinoma
    112928349 (TGFB1)
   05226 Gastric cancer
    112928349 (TGFB1)
   05220 Chronic myeloid leukemia
    112928349 (TGFB1)
   05211 Renal cell carcinoma
    112928349 (TGFB1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    112928349 (TGFB1)
   05321 Inflammatory bowel disease
    112928349 (TGFB1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    112928349 (TGFB1)
   05414 Dilated cardiomyopathy
    112928349 (TGFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112928349 (TGFB1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    112928349 (TGFB1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    112928349 (TGFB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    112928349 (TGFB1)
   05161 Hepatitis B
    112928349 (TGFB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    112928349 (TGFB1)
   05144 Malaria
    112928349 (TGFB1)
   05145 Toxoplasmosis
    112928349 (TGFB1)
   05140 Leishmaniasis
    112928349 (TGFB1)
   05142 Chagas disease
    112928349 (TGFB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:vvp03110]
    112928349 (TGFB1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:vvp04052]
    112928349 (TGFB1)
   00536 Glycosaminoglycan binding proteins [BR:vvp00536]
    112928349 (TGFB1)
Chaperones and folding catalysts [BR:vvp03110]
 Intramolecular chaperones
  Others
   112928349 (TGFB1)
Cytokines and growth factors [BR:vvp04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   112928349 (TGFB1)
Glycosaminoglycan binding proteins [BR:vvp00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   112928349 (TGFB1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 112928349
NCBI-ProteinID: XP_025865756
UniProt: A0A3Q7TKB6
LinkDB
Position
Unknown
AA seq 391 aa
MPPSGLRLLPLLLPLLRLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESAEPEPEPEADYYAKEVTRVLMVENTNKI
YEKVKKSPHSIYMLFNTSELREAVPEPVLLSRAELRLLRLKLKAEQHVELYQKYSNDSWR
YLSNRLLAPSDTPEWLSFDVTGVVRQWLSHGGEVEGFRLSAHCSCDSKDNTLQVDINAGF
SSSRRGDLATIHGMNRPFLLLMATPLERAQHLHSSRQRRALDTNYCFSSTEKNCCVRQLY
IDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQ
ALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgccgccctccgggctgcggctgctgccgctgctgctgccgctgctgcggctactagtg
ctgacgcccggccggccggccgccggactgtccacctgcaagaccatcgacatggaactg
gtgaagcggaagcgcatcgaggccatccgcggccagatcctgtccaagctgcggctcgcc
agccccccgagccagggggaggtgccgcccgggccgctgcccgaggccgtgctggccctc
tacaacagcacccgcgaccgggtggcgggggagagcgccgagccggagcccgagcccgag
gcggactactacgccaaggaggtcacccgcgtgctaatggtggaaaacaccaacaaaatc
tatgagaaagtcaagaaaagtccgcacagcatatatatgctcttcaacacatcagagctc
cgagaagcagtgcctgagcctgtcttgctctcccgggcagagttgcgcctgctgaggctc
aagttaaaagcagagcagcatgtggagctgtaccagaaatatagcaacgattcctggcgc
tacctcagcaaccggctgctggcgcccagcgacacgccagaatggctgtcttttgatgtc
actggagtcgtgaggcagtggctgagccatggaggggaagtcgaaggctttcgcctcagt
gcccactgttcctgtgacagcaaagataacacactgcaagtagacattaacgcagggttc
agttccagccgccgaggtgacctggccaccattcatggcatgaaccgacccttcctgctc
ctcatggccaccccactggagagggcccagcacctgcacagctcccggcagcgccgggcc
ctggacaccaactactgcttcagctccacggagaagaactgctgcgtccggcagctctac
attgacttccgcaaggatctgggctggaagtggatccatgagcccaagggttaccacgct
aacttctgcctggggccctgcccctacatttggagcctggacacgcagtacagcaaggtc
ctggccctgtacaaccagcacaacccgggcgcgtcggcggcgccgtgctgcgtgccgcag
gcgctggagccactgcccatcgtgtactacgtgggccgcaagcccaaggtggagcagctg
tcgaacatgatcgtgcgctcctgcaagtgcagctga

DBGET integrated database retrieval system