KEGG   Vulpes vulpes (red fox): 112914363Help
Entry
112914363         CDS       T05911                                 

Gene name
RASSF5
Definition
(RefSeq) ras association domain-containing protein 5
  KO
K08015  Ras association domain-containing protein 5
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04014  Ras signaling pathway
vvp04015  Rap1 signaling pathway
vvp04218  Cellular senescence
vvp04670  Leukocyte transendothelial migration
vvp05200  Pathways in cancer
vvp05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    112914363 (RASSF5)
   04015 Rap1 signaling pathway
    112914363 (RASSF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    112914363 (RASSF5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    112914363 (RASSF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112914363 (RASSF5)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    112914363 (RASSF5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nore1-SARAH RA Sdh5 Mst1_SARAH
Motif
Other DBs
NCBI-GeneID: 112914363
NCBI-ProteinID: XP_025847145
UniProt: A0A3Q7SXG5
LinkDB All DBs
Position
Unknown
AA seq 265 aa AA seqDB search
MTVDSSMSSGYCSLEEELEDCFFTAKTTFFRSVQSRPPSKNICKVAEEPQRPPTLQELRQ
RIDSYNSREANCLGMKLSEDGTYTGFIKVHLKLRRPVTVPAGIRPQSIYDAIKEVNLAAT
TDKRTSFYLPLDAIKQLHISSTTTVSEVIQGLLKKFMVVDNPQKFALFKQIHKDGQVLFQ
KLSVADCPLYLRLLAGPDNDVLSFVLKENETGEVEWDAFSIPELQNFLTILEKEEQDKIQ
QVQKKYDKFRQKLEEALRESQGKPG
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgacggtggacagcagcatgagtagtgggtactgcagcctggaggaggagctggaggac
tgcttcttcaccgccaagaccaccttcttcagaagcgtgcagagcagacccccctccaag
aacatctgtaaagtggcggaggagccgcagcgcccgcccacactgcaggagctcaggcag
aggatcgacagctacaacagccgcgaggccaactgcctgggcatgaagctgagtgaagac
ggcacctacacaggtttcatcaaagtgcatttgaaacttcggcggccggtgaccgtgccc
gcagggatccggcctcagtccatctatgatgccatcaaggaagtgaacctggcggccacc
accgacaagcggacgtccttctaccttccgctcgatgccatcaagcagctgcacatcagc
agcaccaccacagtcagcgaggtcatccaggggctgctcaagaagttcatggttgtggac
aatccccagaagtttgcactttttaagcagatacacaaggacgggcaagtgctcttccag
aaactttctgtagctgattgccctctctacctgcgcttgcttgctgggcctgacaatgac
gtcctcagcttcgtgctcaaggagaacgaaactggagaggtggagtgggatgccttctcc
atccccgagctccagaacttcctaacaatcctggaaaaggaggagcaggacaaaatccag
caagtgcagaagaagtatgacaagtttaggcagaaactggaggaggccttaagagagtcc
cagggcaaacctggctaa

DBGET integrated database retrieval system