KEGG   Vulpes vulpes (red fox): 112914392
Entry
112914392         CDS       T05911                                 

Gene name
MDM4
Definition
(RefSeq) protein Mdm4
  KO
K10127  protein Mdm4
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04115  p53 signaling pathway
vvp05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112914392 (MDM4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    112914392 (MDM4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:vvp04121]
    112914392 (MDM4)
Ubiquitin system [BR:vvp04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    112914392 (MDM4)
SSDB
Motif
Pfam: zf-C3HC4_3 zf-RanBP SWIB Prok-RING_4 Cript
Other DBs
NCBI-GeneID: 112914392
NCBI-ProteinID: XP_025847204
UniProt: A0A3Q7RNS4
LinkDB
Position
Unknown
AA seq 490 aa
MTSFATSAQCSTSDSACRISPEQTNQVRPKLPLLKILQAAGAQGEMFTVKEVMHYLGQYI
MVKQLYDQQEQHMVYCGGDLLGELLGRQSFSVKDPSPLYDMLRRNLVTLATATTDAAQTL
ALAQDHSMDIPSQDQLKQSAEESSSSRKRMEEGNIPTLPTSQHKCRNSREDEDFIKNLTQ
DETSKLDLGFEEWDVAGLPWWFLGNLRSNYTPRSNGSTDLQTNQDIGTAIVSDTTDDLWF
LNESVSEQFGVGIKVEAADTEQTSEEVGKVRDKKVIEVGKNDDLEDSKSISDDTDVEVTS
EDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSLSTSDITAIPEKKENEGIDV
PDCRRTISAPVVRPKDVCTKEEKNPKLFDPSVEFLDLAHSSESQETISSMGEPSDNLFEQ
RTDTENMEDCQNLLKPCSLCEKRPRDGNIIHGRTGHLVTCFHCARRLKKAGASCPICKKE
IQLVIKVFIA
NT seq 1473 nt   +upstreamnt  +downstreamnt
atgacatcatttgccacctctgcccagtgttcaacttctgacagtgcttgcaggatctcc
ccagaacaaaccaatcaggtacgaccaaaacttccacttttgaagattttgcaggcagca
ggtgcacaaggtgaaatgttcactgttaaagaggtcatgcactatctaggccagtatata
atggtgaagcagctttatgatcagcaggaacagcatatggtgtattgtggtggagatctt
ttgggagaactgctaggacgtcagagtttctccgtgaaagatccaagccctctctatgat
atgctaagaaggaatcttgtcactttagccactgctactacagatgctgctcagactctc
gctctcgcacaggatcacagtatggatattccaagtcaagaccaactgaagcaaagtgca
gaagaaagctccagttccaggaaaagaatggaagaaggcaatattcctacactgcctacc
tcacaacataaatgcagaaattctagagaagatgaagacttcataaaaaacttaacccaa
gatgagacatctaagctggaccttgggtttgaggagtgggatgtagctgggctgccttgg
tggtttttaggaaacctgaggagcaactatacacctagaagtaatggctcgactgattta
cagacaaatcaggatataggtactgctattgtttcagacaccacagatgacttgtggttt
ttgaatgaatctgtatcagagcagtttggtgtgggaataaaagttgaagctgcagacact
gaacaaacaagtgaagaagtaggaaaagtaagagacaaaaaggtgattgaagtgggaaaa
aatgatgaccttgaggactctaagtccataagtgacgatactgatgtagaagttacctct
gaggatgagtggcagtgtactgagtgcaagaaatttaactctccaagcaagaggtactgt
tttcgttgctgggcattgaggaaggattggtattcagattgctctaagttaacccattct
ctctccacgtctgatatcactgccatacccgagaagaaggaaaatgaaggcattgatgtc
cctgattgccgaagaaccatatcagctccagttgttaggcctaaagatgtatgtacaaag
gaagaaaaaaaccccaagctttttgatccctcagtggaattcttggatttggcccacagt
tctgaaagccaagaaaccatatcaagcatgggagaaccatcagataacctttttgaacag
agaacagatacagaaaacatggaggattgccagaatctcttgaagccgtgtagtctgtgt
gagaaaagaccacgagacgggaacattattcatgggaggacaggccatcttgtcacttgt
tttcactgtgccagaagattgaagaaggctggggcttcttgccctatatgcaagaaagag
attcagttggtgattaaggtttttatagcatag

DBGET integrated database retrieval system