KEGG   Vulpes vulpes (red fox): 112915436
Entry
112915436         CDS       T05911                                 

Gene name
APC
Definition
(RefSeq) adenomatous polyposis coli protein isoform X1
  KO
K02085  adenomatosis polyposis coli protein
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04810  Regulation of actin cytoskeleton
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05206  MicroRNAs in cancer
vvp05210  Colorectal cancer
vvp05213  Endometrial cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112915436 (APC)
   04390 Hippo signaling pathway
    112915436 (APC)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112915436 (APC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112915436 (APC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112915436 (APC)
   05206 MicroRNAs in cancer
    112915436 (APC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112915436 (APC)
   05225 Hepatocellular carcinoma
    112915436 (APC)
   05226 Gastric cancer
    112915436 (APC)
   05217 Basal cell carcinoma
    112915436 (APC)
   05213 Endometrial cancer
    112915436 (APC)
   05224 Breast cancer
    112915436 (APC)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112915436 (APC)
   05022 Pathways of neurodegeneration - multiple diseases
    112915436 (APC)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112915436 (APC)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112915436 (APC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112915436 (APC)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:vvp03036]
    112915436 (APC)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:vvp04812]
    112915436 (APC)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112915436 (APC)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    112915436 (APC)
Cytoskeleton proteins [BR:vvp04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     112915436 (APC)
SSDB
Motif
Pfam: Arm_APC_u3 APC_basic EB1_binding APC_r APC_u5 APC_u14 APC_rep APC_u15 APC_u9 SAMP APC_N_CC Arm APC_u13 APC_15aa Suppressor_APC JIP_LZII
Other DBs
NCBI-GeneID: 112915436
NCBI-ProteinID: XP_025848574
UniProt: A0A3Q7RST7
LinkDB
Position
Unknown
AA seq 2862 aa
MAAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSIEDEAM
ASSGQIDLLERLKELNLDSSNFPGVKLRSKMSLRSYGSREGSVSSRSGECSPVPMGSFPR
RGFVNGSRENTGYLEELEKERSLLLADLDKEEKEKDWYYAQLQNLTKRIDSLPLTENFSL
QTDMTRRQLEYEARQIRVAMEEQLGTCQDMEKRAQRRVTRIQQIEKDILRIRQLLQSQAT
EAERSSQSKHEAGSHEAERQNEGQGVGEINMATSGSAQGSAARMDHETASVLSSSSTHSA
PRRLTSHLGTKVEMVYSLLSMLGTHDKDDMSRTLLAMSSSQDSCISMRQSGCLPLLIQLL
HGNDKDSVLLGNSRGSKEARARASAALHNIIHSQPDDKRGRREIRVLHLLEQIRAYCETC
WEWQEAHEQGMDQDKNPMPAPVEHQICPAVCVLMKLSFDEEHRHAMNELGRKATRGISSQ
ELGQGLSGGLQAIAELLQVDCEMYGLTNDHYSITLRRYAGMALTNLTFGDVANKATLCSM
KGCMRALVAQLKSESEDLQQVIASVLRNLSWRADVNSKKTLREVGSVKALMECALEVKKE
STLKSVLSALWNLSAHCTENKADICAVDGALAFLVGTLTYRSQTNTLAIIESGGGILRNV
SSLIATNEDHRQILRENNCLQTLLQHLKSHSLTIVSNACGTLWNLSARNPKDQEALWDMG
AVSMLKNLIHSKHKMIAMGSAAALRNLMANRPAKYKDANIMSPGSSLPSLHVRKQKALEA
ELDAQHLSETFDNIDNLSPKASHRNKQRHKPNLYGDYVFDTNRHDDNRSDNFNAGNMTVL
SPYLNTTVLPSSSSSRGSLDSSRSEKDRSLERERGISLGNYHPATENPGTSSKRGLQIST
TAAQIAKVMEEVSAIHTSQEDRSSGSTTELHCGTDERNTLRRSSTAHTHANTYSFTKSEN
SNRTCPVPYAKLEYKRSSNDSLNSVSSSDGYGKRGQMKPSIESYSEDDESKFCSYGQYPA
DLAHKIHSANHMDDNDGELDTPINYSLKYSDEQLNSGRQSPSQNERWARPKHIIEDEIKQ
SEQRQSRSQSTTYPVYTESTDDKHLKFQPHFGQQECVSPYRSRGASGSETNRVGSNHGIN
QNVNQSLCQEDDYEDDKPTNYSERYSEEEQHEEEERPTNYSIKYNEEKHHVDQPIDYSLK
YATDIPSSQKPPFSFSKNSSGQSAKTEHLSASSENTSTPSSSAKRQTQHHPSSAQSRNGQ
TPKANSCKVPSINQETIQTYCVEDTPICFSRCSSLSSLSSAEDEIGCDPAPQEAESANTL
QRAEIKENSGTRTTEDAVSEVPAASPHIRTKSSRLQASGLSAESTRHKAVEFSSGAKSPS
KSGAQTPKSPPEHYVQETPLMFSRCTSVSSLDSFESRSIASSVQSEPCSGMVSGIISPSD
LPDSPGQTMPPSRSKTPPPPPQTVQTKREVPKNKASAAEKRESGPKQAAVNAAVQRVQVL
PDADTLLHFATESTPDGFSCSSSLSALSLDEPFIQKDVELRIMPPVQENDNGNETESEQP
EEANENQEKEPKKPTDSEKDLLDDSDDDDIEILEECIISAMPTKSSRKAKKPAQTAPKLP
PPVARKPSQLPVYKLLPSQNRLQAQKHVSFTPGEDMPRVYCVEGTPINFSTATSLSDLTI
ESPPNELAAGEGVRAGAQPSEFEKRDTIPTEGRSTDEAQRGKAPAVTIPELDDSKTEEGD
ILAECINSAMPKGKSHKPFRVKKIMDQVQQASVSSSGTNKNQLDGKKKKPTSPVKPIPQS
AEYRTRVRKHTDSKNNVNAERTFSDNKDSKKQNLKNNSKDFNDKLPNNEDRVRGSFTFDS
PHHYTPIEGTPYCFSRNDSLSSLDFEDDDVDLSREKAELRKGKENKDSEAKVPSHTEPTS
NQQSANKTQAVTKHPVNRGQSKPVLQKQPTFPQSSKDLPDRGAATDEKLQNFAIENTPVC
FSRNSSLSSLSDIDQENNNNKENEPLKEAEPPDSQGEPSKPQASGYAPKSFHVEDTPVCF
SRNSSLSSLSIDSEDDLLQECISSAMPKKKKPSRLKGDTEKHSPRNMSGILAEDLTLDLK
DIQRPDSEHGLSPDSENFDWKAIQEGANSIVSSLHQAAAAACLSRQASSDSDSILSLKSG
ISLGSPFHLTPDQEEKPFTSNKGPRILKPGEKSTLETKKIESENKGIKGGKKVYKSLITG
KIRSNSEVLSQMKQPLQANMPSLSRGRTMIHIPGVRNSSSSTSPVSKKGPPLKTPASKSP
SEGQTATTSPRGTKPSVKSELSPVTRPAPQPAGANKGPSRSGSRDSTPSRPAQQPLSRPM
QSPGRNSISPGRNGISPPNKLSQLPRTSSPSTASTKSSGSGKMSYTSPGRQMSQQNLSKQ
TGLSKNGSSIPRSESASKGLNQMSNSNGSNKKVELSRMSSTKSSGSESDRSERPVLVRQS
TFIKEAPSPTLRRKLEESASFESLSPSSRPDSPTRSQAQTPVLSPSLPDMSLSAHPSIQS
GGWRKLPPNLSPTIEYNDGRPAKRHDIARSHSESPSRLPINRSGTWKREHSKHSSSLPRV
STWRRTGSSSSILSASSESSEKAKSEDEKHVNSISGTKQTKENQVSTKGTWRKIKENDIS
PTNSTSQTTSSGAANGAESKTLIYQMAPAVSKTEDVWVRIEDCPINNPRSGRSPTGNTPP
VIDTVLEKGNPNAKDAKDNQGKPSVGNGSGPVRAVGLENRLNSFIQVEAPDQKGTEAKPG
LSNPVAAPEVNESCAAERTPFSSSSSSKHSSPSGTVAARVTPFNYNPSPRKSSADGTSAR
PSQIPTPVATATKKRDSKTDGAESGGTQSPKRHSGSYLVTSV
NT seq 8589 nt   +upstreamnt  +downstreamnt
atggctgcagcttcatatgatcagttgttaaagcaagttgaggcactgaagatggagaac
tcaaatcttcgacaagagctagaagataattccaatcatcttacaaaactggaaactgag
gcatctaatatgaaggaagtacttaaacaactacaaggaagtattgaagatgaagctatg
gcttcttctggacagattgacttattagagcgtctcaaagaacttaacttagatagcagt
aatttccctggagtgaaactacggtcaaaaatgtccctccgttcttatggaagccgcgaa
ggatctgtatctagtcgttcgggagagtgcagtcctgttcctatgggttcatttccaaga
agagggtttgtaaacggaagcagagagaatactggttatttagaggaacttgagaaagag
agatcattacttcttgctgatcttgacaaagaagaaaaggaaaaagattggtattatgct
caacttcagaatctcactaaaagaatagatagtctccctttaactgaaaatttttccttg
caaacagatatgaccagaagacaattagaatatgaagcaaggcaaatcagagttgcaatg
gaagaacaactaggtacttgccaggatatggaaaaaagagcgcagcgaagagtaaccaga
attcaacaaatagagaaggacatacttcgtatacgacagcttttacagtcccaagcaaca
gaagcagagagatcatctcagagcaagcatgaagccggctcacatgaagctgagcggcag
aatgaaggtcaaggagtgggagaaatcaacatggcaacttctggtagtgctcagggttca
gctgcacgaatggatcatgaaacagcaagcgttttgagttctagtagcacacactctgct
cctcgaaggttgacaagtcatctgggcaccaaggtggaaatggtgtattcattgttgtca
atgcttggtactcatgataaggatgatatgtcgcgaactttgctagctatgtctagctcc
caagacagctgtatatccatgcgacagtctggatgtcttcctctcctcatccagctttta
catggcaatgacaaagactctgtgttgttgggaaattcccggggcagtaaagaggctcgg
gccagggccagtgcagcacttcacaacatcattcactcacagcctgatgacaagagaggc
aggcgtgaaatccgagtccttcatcttttggaacagatacgagcttactgtgaaacctgt
tgggagtggcaggaagcccatgaacaaggcatggaccaggacaaaaatccaatgccagct
cctgttgaacatcagatctgtcctgctgtgtgtgttctaatgaaactttcatttgatgaa
gagcatagacatgcaatgaatgaacttggtaggaaggctacccggggcatttcatcacag
gagctagggcaggggctttcagggggactacaggccattgcagaattattgcaagtggac
tgtgaaatgtatgggctaactaatgaccactacagtattacattaagacgatatgctgga
atggctctgacaaacttgacttttggagatgtagccaacaaggctacactctgctctatg
aaaggctgcatgagagcacttgtggcccaactaaaatctgaaagtgaggacttacagcag
gttattgcaagtgttttgaggaatttgtcttggcgagcagatgtaaatagtaaaaagaca
ttgcgtgaagttggaagtgtgaaagcattgatggaatgtgctttggaagttaaaaaggaa
tcaaccctcaaaagcgtattgagtgccttatggaatttgtcagcacactgcactgagaat
aaagctgatatatgtgctgtggatggtgcacttgcgttcctggttggcactctcacttac
cgaagccagacaaatactttagccattatcgaaagtggaggtgggatattacggaatgtg
tccagcttgatagctacaaacgaggaccacaggcaaatcctaagagagaacaactgcctg
caaaccttattgcaacacttgaaatctcacagtttgacaatagttagtaatgcatgtgga
accttgtggaatctctcagcaagaaatccaaaagaccaagaagcattatgggacatgggg
gcagtcagcatgctcaagaacctcattcattcaaagcacaaaatgattgctatgggaagt
gccgcagctttaaggaatctcatggctaatagacctgcaaagtataaggatgccaatatt
atgtctcctggttcaagcttgccatctcttcatgtcaggaaacaaaaagccctagaagca
gaattagatgctcagcatttatcagaaacttttgacaatattgacaatttaagtcccaag
gcatctcatcgtaataagcaacgacacaagccaaatctgtatggtgactatgtttttgac
accaatcgacatgatgataataggtcagacaattttaatgctggaaatatgactgtcctt
tcaccatatttaaatactacagtgttgcccagctcttcttcatcaagaggaagtttagac
agttctcgttctgaaaaagatagaagtttggagagagaacgaggaattagcttaggcaac
taccacccagcaacggaaaatccaggcacgtcttcaaagcgaggtttgcagatttccacc
acggccgcccagattgccaaagtcatggaagaagtatcagccattcacacctcccaggaa
gacagaagttctgggtctaccactgagttacactgtgggacagatgagaggaacacacta
agaagaagctcgactgcccacacacatgcaaacacatacagcttcacgaagtcagaaaat
tcaaacaggacgtgtcctgtgccttatgctaaattggaatacaagagatcttcaaatgat
agtttaaacagtgtcagtagtagtgatggttatggcaaaagaggtcagatgaagccttcc
attgaatcctattctgaagatgacgaaagtaaattttgcagctatggtcaatacccagct
gacctagcccataaaatacatagtgcaaatcatatggatgacaacgatggagagctagat
acacccataaattatagtcttaagtattcagacgagcagttgaactctggaaggcaaagc
ccctcacagaatgaaagatgggcaagacccaagcatataatagaagacgaaataaaacaa
agtgagcaaagacaatcaagaagtcaaagcacaacttaccccgtatacactgagagcact
gatgataaacacctcaagttccagccacattttggacagcaggaatgtgtttccccatat
aggtcaagaggagccagtggttcagaaacaaatcgagtaggttctaatcatggaattaat
caaaacgtaaaccagtctttgtgtcaggaagatgactatgaagacgataagccaaccaac
tatagtgaacgttactctgaggaagagcaacacgaggaagaagaaagaccaacaaattat
agcataaagtacaatgaagaaaaacatcacgtggatcagcctattgattatagtttaaaa
tatgccacagacattccttcctcacagaaaccaccattttcattctcaaagaattcctct
gggcaaagcgctaaaactgaacacctctctgcaagcagtgagaatacatccacgccttca
tccagtgccaagaggcagactcagcaccatcccagctcagcacaaagtagaaatggccag
accccaaaagccaactcctgcaaagttccctctatcaaccaggaaacgatacagacatac
tgtgtagaggacaccccaatttgtttctcgcgttgcagttcactatcctctctgtcctca
gctgaagatgagatcggatgtgacccagcaccgcaggaggcagagtcagctaatacccta
caaagagcagaaatcaaagaaaacagtgggacaaggacaacagaagatgctgtgagtgag
gttccagcagcgtcaccgcacatcagaaccaaatccagcagacttcaggcttctggttta
tcggcagagtcaaccaggcacaaagctgttgaattttcttcaggggccaaatctccatca
aaaagtggtgctcagactcctaaaagtccaccagagcactatgttcaggagactccgctc
atgtttagcaggtgtacgtcagtcagttcgctcgacagttttgagagtcgttcaattgcc
agctctgttcagagcgaaccctgcagtggcatggtgagtggcattataagccccagtgac
cttccagatagcccaggacaaaccatgccgccaagcaggagtaaaacccctcctcctccc
cctcagacagttcagactaagcgagaggtccctaaaaacaaagcctctgctgccgagaag
agagagagcggccctaagcaagctgctgtgaatgctgcagttcagagagtccaggttctt
ccagatgctgacaccctattgcattttgccacagaaagtactccggatggattttcttgt
tcatccagcctgagtgctctgagccttgatgagccatttatacagaaagacgtggaatta
agaataatgcctccagttcaggaaaacgacaatgggaatgaaactgagtctgagcagcct
gaagaagcaaatgagaaccaggaaaaagagcccaaaaagcctactgattctgaaaaagac
ctgttagacgactcagatgatgatgatattgaaatacttgaagagtgtattatttctgcc
atgccaacaaaatcttcacgcaaagccaaaaaaccagcccagactgctccaaaattacct
ccccctgtggcaaggaagccaagtcaactccccgtctacaaactccttccctcgcaaaac
aggttacaggcgcaaaagcatgttagcttcaccccaggagaggatatgccacgggtgtac
tgtgtcgaagggacgcctatcaacttctccacagctacgtctctaagcgatctgacaata
gaatctcctccaaatgagttagctgctggagaaggggttagagccggggcacagccaagt
gaatttgagaaacgagataccattcctacagaaggcagaagtacagacgaggctcaaaga
ggaaaagccccggcggtgactatacctgagctggatgacagtaaaacagaagagggggat
attcttgcagagtgcattaattctgctatgcccaaaggaaaaagtcacaagcctttccgt
gtgaagaagataatggaccaggtccagcaggcgtctgtgtcttcatctggaactaacaaa
aatcagttagatggcaagaaaaagaaacctacttcaccagtaaaacctataccacagagc
gccgaatacaggacacgtgtaagaaaacacacagactcgaaaaataatgtaaatgctgaa
agaactttctcagacaataaagattcaaagaaacagaacttgaaaaataattccaaggac
ttcaatgataagctaccaaataacgaagatcgagtcagaggaagttttactttcgattca
cctcatcactacacgcccattgaaggaactccgtactgtttttcacgaaatgattctttg
agttctctagattttgaggatgatgatgttgacctttccagggaaaaggctgaattaaga
aaagggaaagaaaataaagactcagaagctaaagtccccagccacacagaaccaacctct
aaccaacaatccgctaataaaacccaggctgttacaaaacaccccgtaaatcgaggtcag
tctaaacccgtgctgcagaagcagcccacgtttccacagtcctccaaagacctaccagac
agaggggcagcaactgatgagaaattgcagaattttgctatcgaaaatactccagtgtgc
ttttctcggaactcctctctaagttctcttagtgacattgaccaagaaaacaacaataac
aaagaaaatgaacctcttaaagaggccgagccccctgactcccagggagaacccagtaaa
cctcaggcatcgggttacgcacctaaatcctttcacgttgaagacactcccgtttgtttc
tcgagaaacagttctctcagttctctaagcattgattctgaagacgacctgttgcaggag
tgtataagttctgcaatgccaaaaaagaaaaagccttcaagactcaagggtgatactgaa
aagcatagtcccagaaacatgagcggcatattagcagaagacttgacacttgatttgaaa
gatatacagagaccagattcagaacatggtttatccccagattcagaaaattttgattgg
aaagctattcaggaaggtgcaaattccatagtaagtagtttacatcaagctgccgctgct
gcctgtttgtctagacaagcttcatccgactcagattccatcctttcactgaaatcggga
atcagtctggggtcaccatttcatcttacacccgaccaagaggaaaaaccctttacaagt
aataagggcccacgaattctaaaacccggggagaagagtacattggaaactaaaaagata
gaatctgaaaataaaggaatcaaaggaggcaaaaaagtttataaaagtttaattactgga
aaaattcgatctaattcggaggttttaagccaaatgaaacagccccttcaagcaaacatg
ccttcgctctctcgaggcaggacaatgattcatattccaggagttcgaaacagctcttca
agtacaagtccggtttctaaaaaaggtccaccccttaagactccagcctccaaaagtccc
agtgagggtcagacagccaccacttctcctagaggaaccaaaccatccgtgaagtcagaa
ttaagccctgtgaccaggccggccccccagccagctggggcaaataaagggccatctaga
tcaggatcgagagattccactccttcgagacctgcccaacagccattaagtagacccatg
cagtctccagggcggaactccatttctcctggtaggaatggaataagtcctcctaacaaa
ttatctcagttgccaaggacttcatcccctagtactgcatcgaccaagtcctccgggtct
gggaagatgtcctatacgtctccaggcagacagatgagtcagcagaaccttagcaaacaa
acgggtttatccaagaatggcagtagtatcccaagaagtgagtctgcctccaaaggactg
aatcagatgagtaatagcaatggatccaacaaaaaggtggagctttctagaatgtcttca
actaaatcgagtggaagtgaatccgataggtcagagagacctgtattagtacgccagtca
actttcatcaaagaagctccaagcccaaccctaaggagaaaattggaggaatctgcttca
tttgaatctctctctccatcttctagaccagattctcccactaggtcccaggcacagact
ccagttttaagcccttcccttcctgatatgtctctgtctgcacatccatccattcagtct
ggtgggtggcgcaaactcccacctaatctcagtcccaccatagagtacaatgacggaaga
ccagcaaagcgccatgatattgcacgctcccattctgaaagtccttcgagacttccaatt
aataggtcaggaacctggaaacgggagcacagcaagcattcgtcatcccttcctcgagta
agcacttggagaagaactggaagttcatcctccattctttctgcttcatcggaatccagt
gaaaaagcaaaaagtgaggatgaaaaacacgtgaactcgatttcaggaaccaaacaaacg
aaggaaaaccaagtatccacaaaaggaacatggagaaaaataaaagaaaatgatatttct
cccacaaatagtacctctcagaccacttcctcaggtgctgcaaatggtgctgaatcaaag
actctaatttatcaaatggcacctgctgtttctaaaacagaggatgtttgggtgagaatt
gaggactgtcccattaacaaccctcgatccgggagatccccaacaggaaacacgccccct
gtgattgacactgttttggaaaaggggaacccaaacgctaaagatgcaaaagataatcag
ggaaaaccaagtgtgggtaacggcagtggccccgtacgcgccgtgggtttggaaaaccgc
ctgaactcctttatccaggtagaggcccccgaccagaagggaacggaggcaaaaccggga
ctgagtaaccctgtcgctgcaccagaggtgaacgagagttgtgcagccgagcgcaccccg
ttcagctccagcagctcaagcaagcacagttcccccagcgggaccgtcgctgccagagtg
accccctttaattacaacccgagccctcggaagagcagcgcggacggcacgtcagcccgg
ccgtcccagatccccacgccggtggccaccgccacgaagaaacgggattccaagactgac
ggcgccgagtccggcggaacccagagccctaagcgccattccgggtcttacctcgtgacg
tccgtgtga

KEGG   Vulpes vulpes (red fox): 112935524
Entry
112935524         CDS       T05911                                 

Gene name
APC2
Definition
(RefSeq) adenomatous polyposis coli protein 2
  KO
K02085  adenomatosis polyposis coli protein
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04310  Wnt signaling pathway
vvp04390  Hippo signaling pathway
vvp04550  Signaling pathways regulating pluripotency of stem cells
vvp04810  Regulation of actin cytoskeleton
vvp04934  Cushing syndrome
vvp05010  Alzheimer disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05165  Human papillomavirus infection
vvp05200  Pathways in cancer
vvp05206  MicroRNAs in cancer
vvp05210  Colorectal cancer
vvp05213  Endometrial cancer
vvp05217  Basal cell carcinoma
vvp05224  Breast cancer
vvp05225  Hepatocellular carcinoma
vvp05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112935524 (APC2)
   04390 Hippo signaling pathway
    112935524 (APC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    112935524 (APC2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    112935524 (APC2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112935524 (APC2)
   05206 MicroRNAs in cancer
    112935524 (APC2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    112935524 (APC2)
   05225 Hepatocellular carcinoma
    112935524 (APC2)
   05226 Gastric cancer
    112935524 (APC2)
   05217 Basal cell carcinoma
    112935524 (APC2)
   05213 Endometrial cancer
    112935524 (APC2)
   05224 Breast cancer
    112935524 (APC2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112935524 (APC2)
   05022 Pathways of neurodegeneration - multiple diseases
    112935524 (APC2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    112935524 (APC2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    112935524 (APC2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:vvp01009]
    112935524 (APC2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:vvp03036]
    112935524 (APC2)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:vvp04812]
    112935524 (APC2)
Protein phosphatases and associated proteins [BR:vvp01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     112935524 (APC2)
Chromosome and associated proteins [BR:vvp03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    112935524 (APC2)
Cytoskeleton proteins [BR:vvp04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    EB / APC
     112935524 (APC2)
SSDB
Motif
Pfam: APC_basic APC_rep APC_N_CC APC_r Arm Suppressor_APC Arm_APC_u3 ZapB bZIP_1 Sec2p Leu_zip HALZ Herpes_BLRF2 IL4 Wtap
Other DBs
NCBI-GeneID: 112935524
NCBI-ProteinID: XP_025875062
UniProt: A0A3Q7UPB2
LinkDB
Position
Unknown
AA seq 2080 aa
MAVGLPAQPWGSHQQPGHRSLTRCQPSQHFSCPSVGRAGGLSPTLRQLRWGGSLSARGSG
ADSADAHVRGPVSCVSGPRLDLRPTALPGARPVGHAACPLWHPSGEPSDLWPQALQELRM
ASSVAPYEQLVRQVEALKAENSHLRQELRDNSSHLSKLETETSGMKEVLKHLQGKLEQEA
GVLVSLGQTEVLEQLKALQMDITSLYNLKFHAPALDPEPTARTPEGSPVHGSGPSKDSFG
ELGRATIRLLEELDRERCFLLNEIEKEEKEKLWYYSQLQGLSKRLDELPHVETVSGGWGT
GGXDLIRQQLEFEAQHIRSLMEERFGTSDEMVQRAQIRASRLEQIDQELLSAQDRVQQTE
PQALLAVKSVPVDEDPDTEVPTHPEDGVPQPGNSKVEVVFWLLSMLATRDQEDTARTLLA
MSSSPESCVAMRRSGCLPLLLQILHGAEAGAGGRNGAPGAPGAKDARMRANAALHNIVFS
QPDQGLARKEMRVLHVLEQIRAYCETCWDWLQARDAADGGAGGAPVPIEPQICQATCAVM
KLSFDEEYRRAMNELGGLQAVAELLQVDYEMHKMTRDPLNLALRRYAGMTLTNLTFGDVA
NKATLCARRGCMEAIVAQLASESEELHQVVSSILRNLSWRADINSKKVLREVGSMTALMQ
CVLRASKESTLKSVLSALWNLSAHSTENKAAICQVDGALGFLVSTLTYKCQSNSLAIIES
GGGILRNVSSLIATREDYRQVLRDHNCLQTLLQHLTSHSLTIVSNACGTLWNLSARSPRD
QELLWDLGAVGMLRNLVHSKHKMIAMGSAAALRNLLAHRPAKYQTTTTAVSPGACAPSLY
VRKQRALEAELDTRRLAQALDHLEKQGLPEAEADAEAASKKPLPPLRHLDGLARDYASDS
GCFDDDEAPSLAAAAATAEPASPAVLSLFLGSPFLQGQALARAPPARRGGPEAEKEAGGE
VAVAARAKAKLALAVARIDRLVEDISALHTSSDDSFSLSSGDPGQEAPREGRAQSCSPCR
RPEGRRQEAGGRAHPLLRLKAAQASLSNDSLNSGSTGDGRCPREHTRPCPLAVLAEHREG
SPCSQARPSRLDLHLPGGQEPASRDSSAADACVRTIKLSPTYQHVPLFEGNPRATMGSLA
PGARKEAWLPAEGLSKVPEKLAAEAVPLCLSRCSSLSSLSSAGRPGPSEAGDLDSDSSLE
GLEEAGPSKADLDGAWLGPGAVSLPVAIPTPQRGRGLGVEDTTPSSSSENCVQETPLVLS
RCSSVSSLSSFESPSIASSVASEPCSGLGSGTVSPSELPDSPGQTMPPSRSKTPPLAPVP
PGERESTQFSLQWESYVKRFLDIADRRERCRLPSELDAGSVRFTVEKPDENFSCASSLSA
LALHEHYVQKDVELRLLPPACPERGGGGGSGGPGLHFAXXXXXXXXXXXXXXXXXXXXXX
XXVYMLVPAPARVDDSAEGTPVTFSSATSLSDETLQAPPQEPDRHKPAGREAPARQATGH
RHRAWGTGRSRVGLELPLRRPASACTERDSGRPSPARGDRGDRGDGALQSLCLTTPTEEA
VYCFYDDSDEDPPVAVAPPRRPSAIPRAVKREPPAGRKGVQATPQPAEAPRAQPSLIADE
TPPCYSLSSSASSLSEPDPPAHPPARARAPKAAVTKAPGAGGASDSLRSPRAESGPLRRC
VAPEASSGSDSGPSESGLSGASTLPRKGRRLQAGGQAGQAARPENRDPAVMQRGTSGPEK
LRGAQKPACRVPAVLRGRTVIYVPSAAPRAQPKGAPGTRAALRKMGPPSPAQPAAPANTP
SPGQPRSRSLHRPGKISELAALSPPQRSTTPPARLAKAPSSGSSPASPASQPPTRRPPLG
PQAAGPLPGPGASLVPQTPTRALLSKQHKTQKSPVRIPFMQSARRSSDGEARPLPRVAAP
GTTWRRIRDEDVPHILRSTLPATALPLMGAPPEEGPGGPPQRKTSDAVVQTEDFAATKTN
SSTSPSLESRGPPQAPVSGPTALLGSDVDGPGPTKAPTSVPFIHEGLGVAAGGFPASRHG
SPSRSARVPPFNYVPSPMVSATTDLAAEKAPTAAPASLLE
NT seq 6243 nt   +upstreamnt  +downstreamnt
atggcggtgggcctgcccgcccagccgtgggggtcccaccagcagccgggccaccgctct
ctgacgcgttgtcagccgtcgcagcatttttcttgcccgtcggtggggcgagctggtggt
ctgtcgcctaccctccggcagctgcgctgggggggctcgctgtcagcgcgcgggtcagga
gccgacagtgcggacgctcacgtgcgcgggccggtcagctgcgtgtctgggccgcgtctg
gacctccgtcccacggctctgcccggcgctcgccccgttggccacgcggcgtgtccgctc
tggcacccctcgggtgagccttctgacctgtggccgcaggcgctgcaggagctgaggatg
gcgagctccgtggcaccctacgagcagctggtgcggcaggtggaggccttgaaggcagag
aacagccacctgaggcaggagctgcgggacaattccagccacctgtccaagctggagacg
gagacatctggcatgaaggaggtcctcaagcacctacaaggcaagctggagcaggaggcc
ggagtgctggtgtccctggggcagaccgaggtgctggagcagctgaaagccctgcagatg
gacatcaccagcctgtacaacctcaagttccacgccccggccctggacccggagcccacc
gcccggactcccgaaggcagccccgtccacggctcggggccctccaaggacagcttcggg
gagctgggccgggctaccatccggctgctggaggagctggaccgggaacggtgtttcctg
ctgaacgagatcgagaaggaggagaaggagaagctgtggtattactcgcagctgcagggc
ctgtccaagcgcctggacgagctcccgcacgtggagacggtgagcggcgggtgggggacg
ggggggntggacctgatccggcagcagctggagttcgaggcccagcacatccgctcgctg
atggaggagcgcttcggcacctcggacgagatggtgcagcgcgcgcagatccgagcttcg
cgcctggagcagattgatcaggagctgctgtcggcgcaggaccgggtgcagcagaccgag
ccccaggccctgctggcggtgaagtcagtgccggtggacgaggacccagacactgaggtc
cccacgcaccctgaggatggtgtccctcagccgggcaacagcaaggtggaggtggtcttc
tggctgctgtccatgctggcgacgcgggaccaggaggacacggcgcgcaccctgctggcg
atgtccagctccccggagagctgcgtggctatgcgccgctcggggtgcctgccgctgctg
ctgcagatcctgcacggtgccgaggctggcgcggggggtcgcaacggagcccccggggcg
ccgggggccaaggacgcgcgcatgcgggccaacgcggcgctgcacaacatcgtcttctcg
cagccggaccagggcctggcgcgcaaggagatgcgcgtcctgcacgtgctggagcagatc
cgcgcctactgtgagacctgctgggactggctgcaggcccgggacgccgcggacgggggc
gcgggcggcgcccccgtccccatcgagccccagatctgccaggccacctgcgccgtgatg
aagctgtccttcgacgaggagtaccgccgagccatgaatgagctgggtgggctgcaggcc
gtggccgagctgctgcaggtggattacgagatgcacaagatgacgcgggacccactcaac
ctcgccctgcgccgatacgccggcatgaccctcaccaacctcaccttcggcgacgtggcc
aacaaggccaccctgtgtgcccgccggggctgcatggaggccatcgtggcccagctggct
tccgagagcgaggagctgcaccaggtggtgtccagcatcctgcgcaacctgtcctggcgg
gcagacatcaacagcaagaaggtgctgagggaggtcgggagcatgaccgccctgatgcag
tgcgtcctgcgagcctccaaggagtccaccctgaagagcgtgctcagcgccctgtggaac
ctgtcggcacacagcacggagaacaaggcagccatctgccaggtggacggcgcgctgggc
ttcctggtgagcacgctgacctacaagtgccagagcaactccctggccatcatcgagagc
ggcggcggcatcctgcgcaacgtgtccagcctcatcgccacgcgggaggactacagacag
gtgctccgggaccataactgcctgcagacgctgctccagcacctgacgtcccacagcctg
accatcgtgagcaacgcctgcggcacgctctggaacctgtccgcccgcagcccgcgcgac
caggagctgctgtgggacctgggggccgtgggcatgctgcgcaacctggtgcactccaag
cacaagatgatcgccatgggcagcgccgccgcgctgcgcaacctgctggcccaccggcct
gccaagtaccagaccaccaccacggccgtgtcccccggcgcctgcgcgcccagcctgtac
gtgaggaagcagcgggcgctggaggccgagctggacacgcggcgcctggcgcaggcgctc
gaccacctggagaagcagggcctgcccgaggccgaggccgacgctgaggccgcctccaag
aagcccctgccgcccctgcggcacctggacgggctggcccgggactacgcctcagactcg
ggctgcttcgacgacgacgaggcgccctccctggccgccgccgctgccaccgcggagcct
gccagccccgccgtgctgtccctcttcctggggagccccttcctgcaggggcaggcgctg
gcccgcgcccctccggcccgccgcggtggcccggaggcagagaaggaggccggcggggag
gtggccgtggcggccagggccaaggccaagctggcgctggcggtggcacggatcgacagg
ctggtggaggacatctcagccctgcacacctcgtctgatgacagcttcagcctcagctcc
ggggaccctgggcaggaggcgccgcgcgagggccgtgcccagtcctgctccccttgccgg
cggcccgagggcaggcggcaggaggctggcggccgtgcccacccgctactgcggctcaag
gccgcccaggccagcctctccaatgacagtctcaacagcggcagcaccggtgacggacgc
tgtccccgtgagcacactcggccctgcccgctggccgtgctggcggagcaccgggagggg
tccccgtgcagccaggcgcggcccagccggctcgacctccatctgccaggcggccaggag
ccagcgtcccgggacagctctgctgccgacgcctgtgtgcgtaccatcaagctgtcgccc
acctaccagcacgtcccactcttcgagggcaaccccagggccaccatggggtccctggcc
cccggagcccggaaggaggcctggctgcccgcagagggtctgagcaaggtgccggagaag
ctggcggcagaggcggtgccactctgcctgtcccgctgcagctccctgtcctcgctgtcc
tcggccggccgcccaggccctagcgaggccggggacctggacagtgactcttccctggag
gggctagaggaggcaggacccagcaaggcagacttggacggggcctggctcgggcctggg
gccgtctccctgcccgtggccatccccaccccccagcggggccgtggcctgggcgttgag
gacaccacgccgtccagctcctcggagaactgcgtgcaggaaacgccgctggtgctgagc
cgctgcagctcggtgagctccctgagcagtttcgagagcccgtccatcgccagctctgtg
gccagcgagccgtgcagtgggctgggcagcggcacggtcagccccagcgagctgcccgac
agccccgggcagaccatgccacccagccgtagcaagacgccgccgctggcccccgtgccc
cctggcgagcgcgagagcacccagttcagcttgcagtgggagagctacgtgaagcgcttc
ctggacatcgcggaccgccgcgagcgctgccggcttccgtcggagctggacgccgggagc
gtgcgcttcacggtggagaagccggacgagaacttctcgtgcgcttccagcctcagcgcg
ctggccctgcacgagcactacgtgcagaaggacgtggaactgcggctgctgccccccgcc
tgccccgagcgcgggggcggcggcggcagcggcggccccggcctgcactttgctgnnnnn
nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn
nnnnnngtctacatgctggtgcccgcccccgcccgggtggacgactccgccgagggcacg
cccgtcaccttctccagtgccacctcacttagcgacgagacgctgcaggcgcctccccag
gagccagacagacataagcccgccggccgggaggcccccgccaggcaggccaccgggcac
aggcacagggcgtggggcactggccgcagccgggtggggctggagctgccccttcgccgg
ccggcgagcgcctgcactgaacgggacagcggccgccccagcccagcgcgaggggaccga
ggggaccgaggggacggggcgctgcagtctctgtgcctcacgacacccaccgaggaggcc
gtgtactgcttctacgacgactccgacgaggatccacccgtggccgtggcgcccccgcgg
cgaccatccgccatcccccgggccgtgaagagagagcccccggccggcaggaagggggtg
caggccacgccccagcccgcggaggccccccgcgcgcagcccagcctcatcgccgacgag
accccgccctgctactccctgagctcctccgccagttcgctcagcgagccggacccccct
gcgcacccgcccgcccgggcccgagctcccaaggccgctgtcaccaaggcccccggcgct
gggggcgcgagcgacagcctccggagcccgcgggccgagtcggggccgctgcgccgctgt
gtcgcccccgaggcctcgtccgggtctgactccggcccgtccgagtcggggctgtcgggg
gcctccaccctgcccaggaagggccggcggctgcaggcggggggccaggcgggccaggcg
gcgaggccggagaaccgggaccctgcggtgatgcagcgcggcacgagcggccccgagaag
ctgcggggcgcgcagaagcccgcgtgcagggtcccggccgtgctccggggccggaccgtg
atctacgtgcccagcgcggccccccgggcccagcccaaaggcgcccccggcacccgcgcg
gccctgaggaagatgggccccccgagtcccgcgcagcctgcagcgcctgccaacaccccg
agccccgggcagccccggtcccggagcctgcaccgaccgggcaagatctcggagctggcg
gcgctgagccctccgcagaggagcaccacgccgcccgcccgcctggccaaggccccctcc
tccggctcctcccccgcctccccggcctcccagccgcccacgaggaggccgcccctgggc
ccccaggccgcgggacccctacccggcccgggggcatccctggtgccccagacgcccacg
cgggccctgctgtccaagcagcacaagacgcagaagtcaccggtgcggatccccttcatg
cagagcgcccgccgcagcagcgatggggaggcgcggccactgccaagggtggcggcgccg
ggcaccacgtggcgtcgcatccgggacgaggacgtcccacacatcctgcggagcacactg
cccgccaccgccctgccactgatgggcgccccgcccgaggagggccccggcggccccccg
cagcgcaagaccagcgacgcggtggtccagacagaggacttcgctgccacgaagaccaac
tccagcacgtccccgagcctggaaagcaggggccccccccaggccccggtcagcggcccc
accgccctcctgggcagtgatgtggacgggcctggtcccaccaaggcgcccacctctgtt
cccttcatccacgaaggcctgggggtggctgcggggggctttcccgccagccggcacggc
tcccccagccgctcggcccgtgtgccccccttcaactacgtgcccagccccatggtgtca
gccaccactgacttggccgcagagaaagcccccaccgctgcccctgccagcctcctggaa
tag

DBGET integrated database retrieval system