KEGG   Vulpes vulpes (red fox): 112915542
Entry
112915542         CDS       T05911                                 

Gene name
RCHY1
Definition
(RefSeq) RING finger and CHY zinc finger domain-containing protein 1 isoform X1
  KO
K10144  RING finger and CHY zinc finger domain-containing protein 1 [EC:2.3.2.27]
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp04115  p53 signaling pathway
vvp04120  Ubiquitin mediated proteolysis
vvp05162  Measles
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    112915542 (RCHY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    112915542 (RCHY1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    112915542 (RCHY1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:vvp04121]
    112915542 (RCHY1)
Enzymes [BR:vvp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     112915542 (RCHY1)
Ubiquitin system [BR:vvp04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    112915542 (RCHY1)
SSDB
Motif
Pfam: zinc_ribbon_6 zf-CHY zf-RING_2 zf-C3HC4 zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-C3HC4_3 Prok-RING_4 zf-RING_11 zf-rbx1
Other DBs
NCBI-GeneID: 112915542
NCBI-ProteinID: XP_025848768
UniProt: A0A3Q7RUQ7
LinkDB
Position
Unknown
AA seq 259 aa
MAASAREDGARGQKQGLRGCEHYDRGCLLKAPCCDKLYTCRLCHDNNEDHQLDRFKVKEV
QCINCEKIQHAQQTCEECSTLFGEYYCSICHLFDKDKKQYHCENCGICRIGPKEDFFHCL
KCNLCLAMNLQGKHKCIENVSRQNCPICLEDIHTSRVVAHVLPCGHLLHRTCYEEMLKEG
YRCPLCMHSALDMTRYWRQLDDEVAQTPMPSEYQNMTVDILCNDCNGRSTVQFHILGMKC
NICESYNTAQANRISLDQQ
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcggcttcggcgcgggaagatggcgcccgaggccaaaagcaagggcttaggggctgc
gagcactacgacagaggatgcctcctgaaggcaccttgctgtgacaaactttatacttgt
cggttgtgtcatgataacaatgaagatcatcagctagatcgctttaaagtgaaggaagtg
cagtgcataaactgtgaaaaaattcaacatgcccaacagacctgtgaggaatgtagcaca
ttgtttggggaatattattgcagtatatgccatctctttgacaaagacaagaagcagtat
cattgtgaaaactgtggaatttgtaggattggtccaaaggaagattttttccattgtttg
aaatgtaacttatgcctagctatgaatctccaaggaaagcacaagtgtattgaaaatgtt
tcccggcagaattgtccaatatgtttggaggatattcatacatcccgtgttgttgctcat
gtcttgccatgtggacatcttttacatagaacatgttatgaagaaatgttgaaagaaggc
tacagatgtcccttgtgtatgcattctgctttagatatgactagatactggagacagctg
gatgatgaggtagcacagactcctatgccatcagaataccagaacatgactgtggatatt
ctctgcaatgattgtaatgggagatctacagtccagttccatatattaggcatgaaatgt
aatatttgtgaatcctacaatactgctcaagctaatagaatttcactagatcagcaatga

DBGET integrated database retrieval system