KEGG   Vulpes vulpes (red fox): 112915706
Entry
112915706         CDS       T05911                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01524  Platinum drug resistance
vvp04115  p53 signaling pathway
vvp04210  Apoptosis
vvp04215  Apoptosis - multiple species
vvp04932  Non-alcoholic fatty liver disease
vvp05010  Alzheimer disease
vvp05012  Parkinson disease
vvp05014  Amyotrophic lateral sclerosis
vvp05016  Huntington disease
vvp05017  Spinocerebellar ataxia
vvp05020  Prion disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05132  Salmonella infection
vvp05134  Legionellosis
vvp05145  Toxoplasmosis
vvp05152  Tuberculosis
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05200  Pathways in cancer
vvp05210  Colorectal cancer
vvp05222  Small cell lung cancer
vvp05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112915706
   04215 Apoptosis - multiple species
    112915706
   04115 p53 signaling pathway
    112915706
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112915706
  09162 Cancer: specific types
   05210 Colorectal cancer
    112915706
   05222 Small cell lung cancer
    112915706
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112915706
   05012 Parkinson disease
    112915706
   05014 Amyotrophic lateral sclerosis
    112915706
   05016 Huntington disease
    112915706
   05017 Spinocerebellar ataxia
    112915706
   05020 Prion disease
    112915706
   05022 Pathways of neurodegeneration - multiple diseases
    112915706
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112915706
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112915706
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112915706
   05134 Legionellosis
    112915706
   05152 Tuberculosis
    112915706
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112915706
   05161 Hepatitis B
    112915706
   05160 Hepatitis C
    112915706
   05164 Influenza A
    112915706
   05162 Measles
    112915706
   05168 Herpes simplex virus 1 infection
    112915706
   05163 Human cytomegalovirus infection
    112915706
   05167 Kaposi sarcoma-associated herpesvirus infection
    112915706
   05169 Epstein-Barr virus infection
    112915706
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112915706
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112915706
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 112915706
NCBI-ProteinID: XP_025848900
UniProt: A0A3Q7T203
LinkDB
Position
Unknown
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKTGERADLIAYLKKATKE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcgcagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaacctccacggtttatttgggcggaag
accggtcaggcccctggattttcttacacggatgccaacaagaacaaaggcatcacctgg
ggagaggagaccctgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatcttcgctggcattaagaagacaggggaaagagcagacttaatagcttatctcaaa
aaagctactaaggagtaa

KEGG   Vulpes vulpes (red fox): 112916549
Entry
112916549         CDS       T05911                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: cytochrome c, testis-specific-like
  KO
K08738  cytochrome c
Organism
vvp  Vulpes vulpes (red fox)
Pathway
vvp01524  Platinum drug resistance
vvp04115  p53 signaling pathway
vvp04210  Apoptosis
vvp04215  Apoptosis - multiple species
vvp04932  Non-alcoholic fatty liver disease
vvp05010  Alzheimer disease
vvp05012  Parkinson disease
vvp05014  Amyotrophic lateral sclerosis
vvp05016  Huntington disease
vvp05017  Spinocerebellar ataxia
vvp05020  Prion disease
vvp05022  Pathways of neurodegeneration - multiple diseases
vvp05132  Salmonella infection
vvp05134  Legionellosis
vvp05145  Toxoplasmosis
vvp05152  Tuberculosis
vvp05160  Hepatitis C
vvp05161  Hepatitis B
vvp05162  Measles
vvp05163  Human cytomegalovirus infection
vvp05164  Influenza A
vvp05167  Kaposi sarcoma-associated herpesvirus infection
vvp05168  Herpes simplex virus 1 infection
vvp05169  Epstein-Barr virus infection
vvp05170  Human immunodeficiency virus 1 infection
vvp05200  Pathways in cancer
vvp05210  Colorectal cancer
vvp05222  Small cell lung cancer
vvp05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:vvp00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    112916549
   04215 Apoptosis - multiple species
    112916549
   04115 p53 signaling pathway
    112916549
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    112916549
  09162 Cancer: specific types
   05210 Colorectal cancer
    112916549
   05222 Small cell lung cancer
    112916549
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    112916549
   05012 Parkinson disease
    112916549
   05014 Amyotrophic lateral sclerosis
    112916549
   05016 Huntington disease
    112916549
   05017 Spinocerebellar ataxia
    112916549
   05020 Prion disease
    112916549
   05022 Pathways of neurodegeneration - multiple diseases
    112916549
  09166 Cardiovascular disease
   05416 Viral myocarditis
    112916549
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    112916549
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    112916549
   05134 Legionellosis
    112916549
   05152 Tuberculosis
    112916549
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    112916549
   05161 Hepatitis B
    112916549
   05160 Hepatitis C
    112916549
   05164 Influenza A
    112916549
   05162 Measles
    112916549
   05168 Herpes simplex virus 1 infection
    112916549
   05163 Human cytomegalovirus infection
    112916549
   05167 Kaposi sarcoma-associated herpesvirus infection
    112916549
   05169 Epstein-Barr virus infection
    112916549
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112916549
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112916549
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 112916549
NCBI-ProteinID: XP_025850054
UniProt: A0A3Q7RX45
LinkDB
Position
Unknown
AA seq 125 aa
MGDAEAVKKIFIENCAQCHTVEKGGKRKTGRNLWDLFGXKTGQAPGYSFSDANKNKGIIW
GEETLMEYLENPKKYITGTKMVFAGLRKKSGRKKLIRYLKQATSCNLENISYKPKFSNIK
YCMFK
NT seq 378 nt   +upstreamnt  +downstreamnt
atgggagatgctgaagcagtcaagaagatatttattgaaaactgtgctcagtgccacaca
gtagaaaaaggtggaaaacgtaagacaggtcgaaatctctgggatctttttgganagaaa
acagggcaagcaccaggatattcattttctgatgctaacaaaaacaaaggtattatctgg
ggagaggaaactctgatggaatatttggagaacccaaagaaatatatcactggaactaaa
atggtctttgctggtcttagaaagaagagtgggagaaaaaagcttattcgatatttgaaa
caggcaacatcttgcaacttagaaaatattagttataagccaaaattttccaatatcaaa
tattgcatgtttaagtaa

DBGET integrated database retrieval system